From unknown Sat Aug 09 01:12:08 2025 X-Loop: help-debbugs@gnu.org Subject: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets Resent-From: Jostein =?UTF-8?Q?Kj=C3=B8nigsen?= Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Wed, 05 Mar 2025 09:34:02 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: report 76759 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: patch To: 76759@debbugs.gnu.org Cc: "Ergus via Emacs development discussions." X-Debbugs-Original-To: bug-gnu-emacs@gnu.org Received: via spool by submit@debbugs.gnu.org id=B.17411671973374 (code B ref -1); Wed, 05 Mar 2025 09:34:02 +0000 Received: (at submit) by debbugs.gnu.org; 5 Mar 2025 09:33:17 +0000 Received: from localhost ([127.0.0.1]:35268 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tpl7q-0000sH-3T for submit@debbugs.gnu.org; Wed, 05 Mar 2025 04:33:16 -0500 Received: from lists.gnu.org ([2001:470:142::17]:45934) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tpl7j-0000rk-Vg for submit@debbugs.gnu.org; Wed, 05 Mar 2025 04:33:10 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tpl7d-0007Yl-6A; Wed, 05 Mar 2025 04:33:01 -0500 Received: from fhigh-a1-smtp.messagingengine.com ([103.168.172.152]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tpl7Z-0002sh-DK; Wed, 05 Mar 2025 04:33:00 -0500 Received: from phl-compute-12.internal (phl-compute-12.phl.internal [10.202.2.52]) by mailfhigh.phl.internal (Postfix) with ESMTP id 0622B11401C0; Wed, 5 Mar 2025 04:32:53 -0500 (EST) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-12.internal (MEProxy); Wed, 05 Mar 2025 04:32:53 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= secure.kjonigsen.net; h=cc:cc:content-type:content-type:date :date:from:from:in-reply-to:message-id:mime-version:reply-to :subject:subject:to:to; s=fm3; t=1741167173; x=1741253573; bh=jb mLETdglPZAT+FD7LdRGuW5RnFSZkR1yh1CskMZvBY=; b=tvyBuENwxd6HdA8BKY 2DqVQT3SVc64DHeakXWYyCU2kaXAOhUYjwD3SVa9oq0yvBO43kRAsMZXKcTd57k7 +lirpSyNaNZfdnVaOkCjpNfA4+jZwVN0nFh+YbXLQzw0GbiHnWMAmd5I19lQohWe 47RfhNjL+zWjvmd2FLqmMiq+/WVQERobGVx3duFLYX2AUjSBcpwjYzedTDkDekj7 V4fJZ1D4hjD6YO/WZXm2N8QloO3mkLD/7ysnD94zapxK7bOgg351jGRfGJwNhOce Uq3Pe7QgUTAvsqNMqpSo75exvdrSVfR8LujiKvXOUDW5GLOLlXHjkoVFmTBWBdjR vBZA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:message-id :mime-version:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1741167173; x= 1741253573; bh=jbmLETdglPZAT+FD7LdRGuW5RnFSZkR1yh1CskMZvBY=; b=z /hsOVXdNIxb9z2XXbbr19KZ4BLvFcyzDyosUazlDayI9tenYUamd5kPAFc5vDPGU DZpiKZD78aQ/m/4GXsUB0CSTTpj6dMmRngvCq1oLxX3M24mPQMH14c/Wcr7d/1jf Gn6ypZt6EjcDIMsVuwMefVDEdjlPy0LTanIk6EEFAw9Qp6+KGUjDeV5fj20/V7b6 8DVb5V3SM/8ISWtEpGyl/0iuu7/IEQkYY4ZxM16g0cAnae/5FukuqcgqNseClxjs 4Gwv1Hiwe+0wwk/u3CHPG5bncaQtTZG2q/9ZBg1/mAHXWoiKmiFQ6bc1AtaWCTuq lZRfZ1IE1Ld4YJvdCqRHQ== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddutdeggeeiucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpih gvnhhtshculddquddttddmnecujfgurhephfgtggfukfffvefvofesrgdtmherhhdtvden ucfhrhhomheplfhoshhtvghinhcumfhjpphnihhgshgvnhcuoehjohhsthgvihhnsehsvg gtuhhrvgdrkhhjohhnihhgshgvnhdrnhgvtheqnecuggftrfgrthhtvghrnhepleetveeu ffeihfdvgeeivdeiveelleegtedujefhjeekkeffueekjefgffeggfelnecuvehluhhsth gvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomhepjhhoshhtvghinhesshgv tghurhgvrdhkjhhonhhighhsvghnrdhnvghtpdhnsggprhgtphhtthhopedvpdhmohguvg epshhmthhpohhuthdprhgtphhtthhopegsuhhgqdhgnhhuqdgvmhgrtghssehgnhhurdho rhhgpdhrtghpthhtohepvghmrggtshdquggvvhgvlhesghhnuhdrohhrgh X-ME-Proxy: Feedback-ID: ib2f84088:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 5 Mar 2025 04:32:51 -0500 (EST) From: Jostein =?UTF-8?Q?Kj=C3=B8nigsen?= Content-Type: multipart/alternative; boundary="Apple-Mail=_DCC3467D-9594-44D0-A1AF-E72761DF7A0B" Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3826.400.131.1.6\)) Message-Id: Date: Wed, 5 Mar 2025 10:32:39 +0100 X-Mailer: Apple Mail (2.3826.400.131.1.6) Received-SPF: pass client-ip=103.168.172.152; envelope-from=jostein@secure.kjonigsen.net; helo=fhigh-a1-smtp.messagingengine.com X-Spam_score_int: -26 X-Spam_score: -2.7 X-Spam_bar: -- X-Spam_report: (-2.7 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, HTML_MESSAGE=0.001, RCVD_IN_DNSWL_LOW=-0.7, RCVD_IN_VALIDITY_RPBL_BLOCKED=0.001, RCVD_IN_VALIDITY_SAFE_BLOCKED=0.001, SPF_HELO_PASS=-0.001, SPF_PASS=-0.001 autolearn=ham autolearn_force=no X-Spam_action: no action X-Spam-Score: 0.7 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.3 (/) --Apple-Mail=_DCC3467D-9594-44D0-A1AF-E72761DF7A0B Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset=utf-8 Hey everyone. I found a bug in makefile-mode fontification. Currently shell-commands/make-instructions within a target may get = fontified as make-targets if they contain a : (colon) sign. Consider the following make-target: ------- Makefile ------ run-docker: build-docker docker run -p 8080:8080 imagename -------------------------- This defined a make-target called "run-docker" which depends on = "build-docker", which runs the command "docker run -p 8080:8080 = imagename". In the current code, since the command contains a ":" the whole text up = to that point ("docker run -p 8080") gets fontified as a make-target, = even though it's clearly not declared at the beginning of the line. Based on my digging, this seems to be due to the matching criteria = defined in makefile-dependency-regex. A common pattern used in this regex is "[^\n$#]" (with slight = variations), which (from how I read regexps) aims to match anything = which is not a lineshift, a $-sign or a #-sign. "Anything" in this case would then also include whitespace, which IMO is = the source of the bug. I've tried changing this part of the statement in parts of the regex to = "[^\n\s$#]", like in the attached patch. Ie also exclude leading = whitespace. =46rom what I've tested, it does not seem to have any = adverse effects, although I may not have tested all areas affected by = this change. Feel free to test the suggested changes, and let me know if they can be = improved in any way. =EF=BF=BC =E2=80=94 Kind Regards Jostein Kj=C3=B8nigsen In GNU Emacs 31.0.50 (build 19, aarch64-apple-darwin24.3.0, NS appkit-2575.40 Version 15.3.1 (Build 24D70)) of 2025-03-03 built on SOK67R3KWV97 Repository revision: 38ed2238316a83ad2c95db04f115c38ade48514f Repository branch: master Windowing system distributor 'Apple', version 10.3.2575 System Description: macOS 15.3.1 Configured using: 'configure --with-tree-sitter --with-native-compilation --with-imagemagick --with-harfbuzz' Configured features: ACL GLIB GNUTLS IMAGEMAGICK LCMS2 LIBXML2 MODULES NATIVE_COMP NOTIFY KQUEUE NS PDUMPER PNG RSVG SQLITE3 THREADS TOOLKIT_SCROLL_BARS TREE_SITTER WEBP XIM ZLIB Important settings: value of $LC_ALL: en_US.UTF-8 value of $LC_CTYPE: UTF-8 value of $LANG: en_US.UTF-8 locale-coding-system: utf-8-unix Major mode: BSDmakefile Minor modes in effect: treemacs-filewatch-mode: t treemacs-follow-mode: t treemacs-hide-gitignored-files-mode: t treemacs-git-mode: t treemacs-fringe-indicator-mode: t global-git-commit-mode: t magit-auto-revert-mode: t electric-pair-mode: t highlight-symbol-mode: t flycheck-mode: t editorconfig-mode: t indent-bars-mode: t completion-preview-mode: t which-function-mode: t delete-selection-mode: t global-auto-revert-mode: t poetry-tracking-mode: t all-the-icons-completion-mode: t marginalia-mode: t vertico-mode: t global-nlinum-mode: t nlinum-mode: t override-global-mode: t server-mode: t global-hl-line-mode: t pixel-scroll-precision-mode: t doom-modeline-mode: t tooltip-mode: t global-eldoc-mode: t show-paren-mode: t electric-indent-mode: t mouse-wheel-mode: t menu-bar-mode: t file-name-shadow-mode: t global-font-lock-mode: t font-lock-mode: t blink-cursor-mode: t minibuffer-regexp-mode: t column-number-mode: t line-number-mode: t indent-tabs-mode: t transient-mark-mode: t auto-composition-mode: t auto-encryption-mode: t auto-compression-mode: t hs-minor-mode: t Load-path shadows: /Users/josteink/.emacs.d/elpa/transient-20250301.2218/transient hides = /Users/josteink/build/emacs/lisp/transient Features: (shadow sort mail-extr emacsbug lisp-mnt re-builder make-mode dockerfile-ts-mode conf-mode em-unix em-term term ehelp em-script em-prompt em-pred em-ls em-hist em-glob em-extpipe em-cmpl em-dirs em-basic em-banner em-alias esh-mode esh-var expand-region text-mode-expansions the-org-mode-expansions python-el-fgallina-expansions html-mode-expansions er-basic-expansions expand-region-core expand-region-custom whitespace hydra lv treemacs-hydras tabify treemacs-mouse-interface treemacs treemacs-header-line treemacs-compatibility treemacs-mode treemacs-bookmarks treemacs-tags treemacs-interface treemacs-persistence treemacs-filewatch-mode treemacs-follow-mode treemacs-rendering treemacs-annotations treemacs-async treemacs-workspaces treemacs-dom treemacs-visuals treemacs-fringe-indicator treemacs-faces treemacs-icons treemacs-scope treemacs-themes treemacs-core-utils pfuture ht treemacs-logging treemacs-customization treemacs-macros ido yaml-ts-mode display-line-numbers misearch multi-isearch help-fns radix-tree bicep-ts-mode magit-gitignore git-rebase goto-addr magit-extras vc-hg vc-bzr vc-src vc-sccs vc-svn vc-cvs vc-rcs log-view vc bug-reference magit-bookmark magit-submodule magit-blame magit-stash magit-reflog magit-bisect magit-push magit-pull magit-fetch magit-clone magit-remote magit-commit magit-sequence magit-notes magit-worktree magit-tag magit-merge magit-branch magit-reset magit-files magit-refs magit-status magit magit-repos magit-apply magit-wip magit-log magit-diff smerge-mode git-commit log-edit pcvs-util magit-core magit-autorevert magit-margin magit-transient magit-process with-editor magit-mode benchmark magit-git magit-base magit-section cursor-sensor crm llama markdown-mode add-log elec-pair json-ts-mode vc-git vc-dispatcher tramp-cache time-stamp tramp-sh pulse org-duration diary-lib diary-loaddefs cal-iso disp-table oc-basic ol-eww ol-rmail ol-mhe ol-irc ol-info ol-gnus nnselect gnus-art mm-uu mml2015 mm-view mml-smime smime gnutls dig gnus-sum gnus-group gnus-undo gnus-start gnus-dbus dbus gnus-cloud nnimap nnmail mail-source utf7 nnoo gnus-spec gnus-int gnus-range message sendmail yank-media rfc822 mml mml-sec epa derived epg rfc6068 epg-config mm-decode mm-bodies mm-encode mail-parse rfc2231 rfc2047 rfc2045 ietf-drums mailabbrev gmm-utils mailheader gnus-win ol-docview doc-view jka-compr image-mode exif dired dired-loaddefs ol-bibtex bibtex ol-bbdb ol-w3m ol-doi org-link-doi org-agenda elisp-slime-nav etags fileloop paredit highlight-symbol flycheck editorconfig editorconfig-core editorconfig-core-handle editorconfig-fnmatch indent-bars-ts indent-bars cus-edit cus-start cus-load face-remap color eglot tree-widget external-completion jsonrpc flymake diff ert ewoc debug backtrace compile completion-preview which-func hideshow eww vtable url-queue shr pixel-fill kinsoku url-file svg xml puny mm-url gnus nnheader gnus-util mail-utils range wid-edit mm-util mail-prsvr tramp trampver tramp-integration tramp-message tramp-compat shell parse-time iso8601 tramp-loaddefs imenu ob-plantuml delsel autorevert filenotify embark-org org-element org-persist org-id org-refile org-element-ast inline avl-tree org ob ob-tangle ob-ref ob-lob ob-table ob-exp org-macro org-src sh-script smie executable ob-comint org-pcomplete org-list org-footnote org-faces org-entities time-date noutline outline ob-emacs-lisp ob-core ob-eval org-cycle org-table ol org-fold org-fold-core org-keys oc org-loaddefs find-func cal-menu calendar cal-loaddefs org-version org-compat org-macs poetry pyvenv eshell esh-cmd esh-ext esh-proc esh-opt esh-io esh-arg pcomplete esh-module esh-module-loaddefs esh-util embark-consult consult bookmark text-property-search embark ffap orderless all-the-icons-completion marginalia vertico nlinum linum use-package-bind-key bind-key server hl-line pixel-scroll cua-base all-the-icons all-the-icons-faces data-material data-weathericons data-octicons data-fileicons data-faicons data-alltheicons doom-modeline doom-modeline-segments doom-modeline-env doom-modeline-core shrink-path f s dash nerd-icons nerd-icons-faces nerd-icons-data nerd-icons-data-mdicon nerd-icons-data-flicon nerd-icons-data-codicon nerd-icons-data-devicon nerd-icons-data-sucicon nerd-icons-data-wicon nerd-icons-data-faicon nerd-icons-data-powerline nerd-icons-data-octicon nerd-icons-data-pomicon nerd-icons-data-ipsicon dracula-theme use-package-ensure use-package-core finder-inf all-the-icons-completion-autoloads all-the-icons-autoloads bmx-mode-autoloads cargo-autoloads cmake-mode-autoloads combobulate-autoloads combobulate-go combobulate-json combobulate-yaml combobulate-css combobulate-js-ts combobulate-python combobulate-html combobulate-toml combobulate-cursor multiple-cursors mc-separate-operations rectangular-region-mode mc-mark-pop mc-edit-lines mc-hide-unmatched-lines-mode mc-mark-more sgml-mode facemenu dom thingatpt mc-cycle-cursors multiple-cursors-core advice comp comp-cstr cl-extra help-mode warnings comp-run comp-common rect combobulate-query savehist xref files-x scheme combobulate-ui transient pp format-spec edmacro kmacro combobulate-display combobulate-ztree combobulate-envelope combobulate-manipulation python rx project compat comint ansi-osc ring ansi-color combobulate-procedure combobulate-navigation combobulate-misc combobulate-setup tempo combobulate-interface combobulate-settings diff-mode track-changes easy-mmode treesit generator combobulate-rules company-autoloads copilot-mode-autoloads crontab-mode-autoloads dap-mode-autoloads bui-autoloads doom-modeline-autoloads dracula-theme-autoloads elisp-slime-nav-autoloads embark-consult-autoloads consult-autoloads embark-autoloads expand-region-autoloads flycheck-autoloads highlight-symbol-autoloads indent-bars-autoloads lsp-docker-autoloads lsp-treemacs-autoloads lsp-mode-autoloads magit-autoloads pcase magit-section-autoloads llama-autoloads marginalia-autoloads markdown-mode-autoloads multiple-cursors-autoloads nerd-icons-autoloads nlinum-autoloads orderless-autoloads paredit-autoloads poetry-autoloads powershell-autoloads pyvenv-autoloads shrink-path-autoloads f-autoloads spinner-autoloads transient-autoloads treemacs-autoloads cfrs-autoloads posframe-autoloads ht-autoloads hydra-autoloads lv-autoloads pfuture-autoloads ace-window-autoloads avy-autoloads s-autoloads dash-autoloads undo-tree-autoloads queue-autoloads vertico-autoloads wgrep-autoloads info with-editor-autoloads wsd-mode-autoloads yaml-autoloads package browse-url xdg url url-proxy url-privacy url-expand url-methods url-history url-cookie generate-lisp-file url-domsuf url-util mailcap url-handlers url-parse auth-source cl-seq eieio eieio-core cl-macs icons password-cache json subr-x map byte-opt gv bytecomp byte-compile url-vars cl-loaddefs cl-lib rmc iso-transl tooltip cconv eldoc paren electric uniquify ediff-hook vc-hooks lisp-float-type elisp-mode mwheel term/ns-win ns-win ucs-normalize mule-util term/common-win tool-bar dnd fontset image regexp-opt fringe tabulated-list replace newcomment text-mode lisp-mode prog-mode register page tab-bar menu-bar rfn-eshadow isearch easymenu timer select scroll-bar mouse jit-lock font-lock syntax font-core term/tty-colors frame minibuffer nadvice seq simple cl-generic indonesian philippine cham georgian utf-8-lang misc-lang vietnamese tibetan thai tai-viet lao korean japanese eucjp-ms cp51932 hebrew greek romanian slovak czech european ethiopic indian cyrillic chinese composite emoji-zwj charscript charprop case-table epa-hook jka-cmpr-hook help abbrev obarray oclosure cl-preloaded button loaddefs theme-loaddefs faces cus-face macroexp files window text-properties overlay sha1 md5 base64 format env code-pages mule custom widget keymap hashtable-print-readable backquote threads kqueue cocoa ns lcms2 multi-tty make-network-process tty-child-frames native-compile emacs) Memory information: ((conses 16 1136723 236110) (symbols 48 57070 3) (strings 32 315761 12126) (string-bytes 1 9424642) (vectors 16 112250) (vector-slots 8 2121204 187375) (floats 8 1899 10828) (intervals 56 21125 6631) (buffers 992 88)) --Apple-Mail=_DCC3467D-9594-44D0-A1AF-E72761DF7A0B Content-Type: multipart/mixed; boundary="Apple-Mail=_7D2A2F88-BB78-40DB-8AAF-5DD1DFEA48D5" --Apple-Mail=_7D2A2F88-BB78-40DB-8AAF-5DD1DFEA48D5 Content-Transfer-Encoding: quoted-printable Content-Type: text/html; charset=us-ascii
Hey = everyone.

I found a bug in makefile-mode = fontification.

Currently = shell-commands/make-instructions within a target may get fontified as = make-targets if they contain a : (colon) = sign.

Consider the following = make-target:

------- Makefile = ------

run-docker: = build-docker
docker run -p 8080:8080 = imagename

--------------------------
<= div>
This defined a make-target called "run-docker" which = depends on "build-docker", which runs the command "docker run -p = 8080:8080 imagename".

In the current code, = since the command contains a ":" the whole text up to that point = ("docker run -p 8080") gets fontified as a make-target, even though it's = clearly not declared at the beginning of the = line.

Based on my digging, this seems to be due = to the matching criteria defined = in makefile-dependency-regex.

A = common pattern used in this regex is "[^\n$#]" (with slight = variations), which (from how I read regexps) aims to match anything = which is not a lineshift, a $-sign or a = #-sign.

"Anything" in this case would then also = include whitespace, which IMO is the source of the = bug.

I've tried changing this part of the = statement in parts of the regex to "[^\n\s$#]", like in the = attached patch. Ie also exclude leading whitespace. =46rom what I've = tested, it does not seem to have any adverse effects, although I may not = have tested all areas affected by this = change.

Feel free to test the suggested = changes, and let me know if they can be improved in any = way.

= --Apple-Mail=_7D2A2F88-BB78-40DB-8AAF-5DD1DFEA48D5 Content-Disposition: attachment; filename=0001-Fix-fontification-error-in-makefile-mode.patch Content-Type: application/octet-stream; x-unix-mode=0644; name="0001-Fix-fontification-error-in-makefile-mode.patch" Content-Transfer-Encoding: quoted-printable =46rom=209774fe6028b0c5341aa7bf85adf20464e9ac4b5e=20Mon=20Sep=2017=20= 00:00:00=202001=0AFrom:=20=3D?UTF-8?q?Jostein=3D20Kj=3DC3=3DB8nigsen?=3D=20= =0ADate:=20Wed,=205=20Mar=202025=2010:24:09=20= +0100=0ASubject:=20[PATCH]=20Fix=20fontification=20error=20in=20= makefile-mode.=0A=0A-=20lisp/progmodes/make-mode.el:=20= makefile-dependency-regex=0A=0AEnsure=20we=20check=20for=20leading=20= spaces=20when=20trying=20to=20match=20make-targets.=0A---=0A=20= lisp/progmodes/make-mode.el=20|=202=20+-=0A=201=20file=20changed,=201=20= insertion(+),=201=20deletion(-)=0A=0Adiff=20--git=20= a/lisp/progmodes/make-mode.el=20b/lisp/progmodes/make-mode.el=0Aindex=20= 0ae74630cff..7e0ccb0697e=20100644=0A---=20a/lisp/progmodes/make-mode.el=0A= +++=20b/lisp/progmodes/make-mode.el=0A@@=20-226,7=20+226,7=20@@=20= makefile-runtime-macros-list=0A=20;;=20index=20in=20= makefile-imenu-generic-expression.=0A=20(defvar=20= makefile-dependency-regex=0A=20=20=20;;=20Allow=20for=20two=20nested=20= levels=20$(v1:$(v2:$(v3:a=3Db)=3Dc)=3Dd)=0A-=20=20= "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[}= )]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^= \n$#:=3D]\\)+?\\)\\(:\\)\\(?:[=20\t]*$\\|[^=3D\n]\\(?:[^#\n]*?;[=20= \t]*\\(.+\\)\\)?\\)"=0A+=20=20= "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n\s$#})]+?= [})]\\)\\|[^\n\s$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n\s$#)}]\\)+?[})]\\|[^({]\\= )\\|[^\n\s$#:=3D]\\)+?\\)\\(:\\)\\(?:[=20\t]*$\\|[^=3D\n]\\(?:[^#\n]*?;[=20= \t]*\\(.+\\)\\)?\\)"=0A=20=20=20"Regex=20used=20to=20find=20dependency=20= lines=20in=20a=20makefile.")=0A=20=0A=20(defconst=20= makefile-bsdmake-dependency-regex=0A--=20=0A2.48.1=0A=0A= --Apple-Mail=_7D2A2F88-BB78-40DB-8AAF-5DD1DFEA48D5 Content-Transfer-Encoding: quoted-printable Content-Type: text/html; charset=utf-8
=E2=80=94
Kind Regards
Jostein = Kj=C3=B8nigsen


In GNU Emacs 31.0.50 (build 19, = aarch64-apple-darwin24.3.0, NS
 appkit-2575.40 Version = 15.3.1 (Build 24D70)) of 2025-03-03 built = on
 SOK67R3KWV97
Repository revision: = 38ed2238316a83ad2c95db04f115c38ade48514f
Repository branch: = master
Windowing system distributor 'Apple', version = 10.3.2575
System Description:  macOS = 15.3.1

Configured = using:
 'configure --with-tree-sitter = --with-native-compilation
 --with-imagemagick = --with-harfbuzz'

Configured = features:
ACL GLIB GNUTLS IMAGEMAGICK LCMS2 LIBXML2 MODULES = NATIVE_COMP NOTIFY
KQUEUE NS PDUMPER PNG RSVG SQLITE3 THREADS = TOOLKIT_SCROLL_BARS
TREE_SITTER WEBP XIM = ZLIB

Important settings:
  value = of $LC_ALL: en_US.UTF-8
  value of $LC_CTYPE: = UTF-8
  value of $LANG: en_US.UTF-8
  = locale-coding-system: utf-8-unix

Major mode: = BSDmakefile

Minor modes in = effect:
  treemacs-filewatch-mode: t
  = treemacs-follow-mode: t
  = treemacs-hide-gitignored-files-mode: t
  = treemacs-git-mode: t
  treemacs-fringe-indicator-mode: = t
  global-git-commit-mode: t
  = magit-auto-revert-mode: t
  electric-pair-mode: = t
  highlight-symbol-mode: t
  = flycheck-mode: t
  editorconfig-mode: t
  = indent-bars-mode: t
  completion-preview-mode: = t
  which-function-mode: t
  = delete-selection-mode: t
  global-auto-revert-mode: = t
  poetry-tracking-mode: t
  = all-the-icons-completion-mode: t
  marginalia-mode: = t
  vertico-mode: t
  global-nlinum-mode: = t
  nlinum-mode: t
  override-global-mode: = t
  server-mode: t
  global-hl-line-mode: = t
  pixel-scroll-precision-mode: t
  = doom-modeline-mode: t
  tooltip-mode: t
  = global-eldoc-mode: t
  show-paren-mode: = t
  electric-indent-mode: t
  = mouse-wheel-mode: t
  menu-bar-mode: t
  = file-name-shadow-mode: t
  global-font-lock-mode: = t
  font-lock-mode: t
  blink-cursor-mode: = t
  minibuffer-regexp-mode: t
  = column-number-mode: t
  line-number-mode: = t
  indent-tabs-mode: t
  = transient-mark-mode: t
  auto-composition-mode: = t
  auto-encryption-mode: t
  = auto-compression-mode: t
  hs-minor-mode: = t

Load-path = shadows:
/Users/josteink/.emacs.d/elpa/transient-20250301.2218/t= ransient hides = /Users/josteink/build/emacs/lisp/transient

Featur= es:
(shadow sort mail-extr emacsbug lisp-mnt re-builder = make-mode
dockerfile-ts-mode conf-mode em-unix em-term term = ehelp em-script
em-prompt em-pred em-ls em-hist em-glob = em-extpipe em-cmpl em-dirs
em-basic em-banner em-alias = esh-mode esh-var expand-region
text-mode-expansions = the-org-mode-expansions
python-el-fgallina-expansions = html-mode-expansions er-basic-expansions
expand-region-core = expand-region-custom whitespace hydra lv
treemacs-hydras = tabify treemacs-mouse-interface treemacs
treemacs-header-line = treemacs-compatibility treemacs-mode
treemacs-bookmarks = treemacs-tags treemacs-interface = treemacs-persistence
treemacs-filewatch-mode = treemacs-follow-mode treemacs-rendering
treemacs-annotations = treemacs-async treemacs-workspaces = treemacs-dom
treemacs-visuals treemacs-fringe-indicator = treemacs-faces treemacs-icons
treemacs-scope treemacs-themes = treemacs-core-utils pfuture ht
treemacs-logging = treemacs-customization treemacs-macros ido = yaml-ts-mode
display-line-numbers misearch multi-isearch = help-fns radix-tree
bicep-ts-mode magit-gitignore git-rebase = goto-addr magit-extras vc-hg
vc-bzr vc-src vc-sccs vc-svn = vc-cvs vc-rcs log-view vc bug-reference
magit-bookmark = magit-submodule magit-blame magit-stash = magit-reflog
magit-bisect magit-push magit-pull magit-fetch = magit-clone magit-remote
magit-commit magit-sequence = magit-notes magit-worktree magit-tag
magit-merge magit-branch = magit-reset magit-files magit-refs magit-status
magit = magit-repos magit-apply magit-wip magit-log magit-diff = smerge-mode
git-commit log-edit pcvs-util magit-core = magit-autorevert magit-margin
magit-transient magit-process = with-editor magit-mode benchmark magit-git
magit-base = magit-section cursor-sensor crm llama markdown-mode = add-log
elec-pair json-ts-mode vc-git vc-dispatcher = tramp-cache time-stamp
tramp-sh pulse org-duration diary-lib = diary-loaddefs cal-iso disp-table
oc-basic ol-eww ol-rmail = ol-mhe ol-irc ol-info ol-gnus nnselect gnus-art
mm-uu mml2015 = mm-view mml-smime smime gnutls dig gnus-sum = gnus-group
gnus-undo gnus-start gnus-dbus dbus gnus-cloud = nnimap nnmail mail-source
utf7 nnoo gnus-spec gnus-int = gnus-range message sendmail yank-media
rfc822 mml mml-sec epa = derived epg rfc6068 epg-config mm-decode
mm-bodies mm-encode = mail-parse rfc2231 rfc2047 rfc2045 ietf-drums
mailabbrev = gmm-utils mailheader gnus-win ol-docview doc-view = jka-compr
image-mode exif dired dired-loaddefs ol-bibtex = bibtex ol-bbdb ol-w3m
ol-doi org-link-doi org-agenda = elisp-slime-nav etags fileloop paredit
highlight-symbol = flycheck editorconfig = editorconfig-core
editorconfig-core-handle = editorconfig-fnmatch indent-bars-ts indent-bars
cus-edit = cus-start cus-load face-remap color eglot = tree-widget
external-completion jsonrpc flymake diff ert ewoc = debug backtrace
compile completion-preview which-func hideshow = eww vtable url-queue shr
pixel-fill kinsoku url-file svg xml = puny mm-url gnus nnheader gnus-util
mail-utils range wid-edit = mm-util mail-prsvr tramp trampver
tramp-integration = tramp-message tramp-compat shell parse-time = iso8601
tramp-loaddefs imenu ob-plantuml delsel autorevert = filenotify embark-org
org-element org-persist org-id = org-refile org-element-ast inline
avl-tree org ob ob-tangle = ob-ref ob-lob ob-table ob-exp org-macro
org-src sh-script smie = executable ob-comint org-pcomplete org-list
org-footnote = org-faces org-entities time-date noutline = outline
ob-emacs-lisp ob-core ob-eval org-cycle org-table ol = org-fold
org-fold-core org-keys oc org-loaddefs find-func = cal-menu calendar
cal-loaddefs org-version org-compat org-macs = poetry pyvenv eshell
esh-cmd esh-ext esh-proc esh-opt esh-io = esh-arg pcomplete esh-module
esh-module-loaddefs esh-util = embark-consult consult bookmark
text-property-search embark = ffap orderless all-the-icons-completion
marginalia vertico = nlinum linum use-package-bind-key bind-key server
hl-line = pixel-scroll cua-base all-the-icons = all-the-icons-faces
data-material data-weathericons = data-octicons data-fileicons
data-faicons data-alltheicons = doom-modeline doom-modeline-segments
doom-modeline-env = doom-modeline-core shrink-path f s dash = nerd-icons
nerd-icons-faces nerd-icons-data = nerd-icons-data-mdicon
nerd-icons-data-flicon = nerd-icons-data-codicon = nerd-icons-data-devicon
nerd-icons-data-sucicon = nerd-icons-data-wicon = nerd-icons-data-faicon
nerd-icons-data-powerline = nerd-icons-data-octicon
nerd-icons-data-pomicon = nerd-icons-data-ipsicon dracula-theme
use-package-ensure = use-package-core finder-inf
all-the-icons-completion-autoloads = all-the-icons-autoloads
bmx-mode-autoloads cargo-autoloads = cmake-mode-autoloads
combobulate-autoloads combobulate-go = combobulate-json combobulate-yaml
combobulate-css = combobulate-js-ts combobulate-python = combobulate-html
combobulate-toml combobulate-cursor = multiple-cursors
mc-separate-operations = rectangular-region-mode mc-mark-pop = mc-edit-lines
mc-hide-unmatched-lines-mode mc-mark-more = sgml-mode facemenu dom
thingatpt mc-cycle-cursors = multiple-cursors-core advice comp comp-cstr
cl-extra help-mode = warnings comp-run comp-common rect combobulate-query
savehist = xref files-x scheme combobulate-ui transient pp = format-spec
edmacro kmacro combobulate-display = combobulate-ztree
combobulate-envelope = combobulate-manipulation python rx project compat
comint = ansi-osc ring ansi-color = combobulate-procedure
combobulate-navigation combobulate-misc = combobulate-setup tempo
combobulate-interface = combobulate-settings diff-mode track-changes
easy-mmode = treesit generator combobulate-rules = company-autoloads
copilot-mode-autoloads = crontab-mode-autoloads dap-mode-autoloads
bui-autoloads = doom-modeline-autoloads = dracula-theme-autoloads
elisp-slime-nav-autoloads = embark-consult-autoloads consult-autoloads
embark-autoloads = expand-region-autoloads = flycheck-autoloads
highlight-symbol-autoloads = indent-bars-autoloads = lsp-docker-autoloads
lsp-treemacs-autoloads lsp-mode-autoloads = magit-autoloads pcase
magit-section-autoloads llama-autoloads = marginalia-autoloads
markdown-mode-autoloads = multiple-cursors-autoloads = nerd-icons-autoloads
nlinum-autoloads orderless-autoloads = paredit-autoloads poetry-autoloads
powershell-autoloads = pyvenv-autoloads shrink-path-autoloads = f-autoloads
spinner-autoloads transient-autoloads = treemacs-autoloads cfrs-autoloads
posframe-autoloads = ht-autoloads hydra-autoloads lv-autoloads
pfuture-autoloads = ace-window-autoloads avy-autoloads s-autoloads
dash-autoloads = undo-tree-autoloads queue-autoloads = vertico-autoloads
wgrep-autoloads info with-editor-autoloads = wsd-mode-autoloads
yaml-autoloads package browse-url xdg url = url-proxy url-privacy
url-expand url-methods url-history = url-cookie generate-lisp-file
url-domsuf url-util mailcap = url-handlers url-parse auth-source cl-seq
eieio eieio-core = cl-macs icons password-cache json subr-x map byte-opt
gv = bytecomp byte-compile url-vars cl-loaddefs cl-lib rmc = iso-transl
tooltip cconv eldoc paren electric uniquify = ediff-hook vc-hooks
lisp-float-type elisp-mode mwheel = term/ns-win ns-win ucs-normalize
mule-util term/common-win = tool-bar dnd fontset image regexp-opt fringe
tabulated-list = replace newcomment text-mode lisp-mode prog-mode register
page = tab-bar menu-bar rfn-eshadow isearch easymenu timer = select
scroll-bar mouse jit-lock font-lock syntax font-core = term/tty-colors
frame minibuffer nadvice seq simple cl-generic = indonesian philippine
cham georgian utf-8-lang misc-lang = vietnamese tibetan thai tai-viet lao
korean japanese eucjp-ms = cp51932 hebrew greek romanian slovak czech
european ethiopic = indian cyrillic chinese composite emoji-zwj = charscript
charprop case-table epa-hook jka-cmpr-hook help = abbrev obarray oclosure
cl-preloaded button loaddefs = theme-loaddefs faces cus-face macroexp
files window = text-properties overlay sha1 md5 base64 format env
code-pages = mule custom widget keymap hashtable-print-readable = backquote
threads kqueue cocoa ns lcms2 multi-tty = make-network-process
tty-child-frames native-compile = emacs)

Memory information:
((conses = 16 1136723 236110) (symbols 48 57070 3)
 (strings 32 = 315761 12126) (string-bytes 1 9424642)
 (vectors 16 = 112250) (vector-slots 8 2121204 187375)
 (floats 8 1899 = 10828) (intervals 56 21125 6631) (buffers 992 = 88))

= --Apple-Mail=_7D2A2F88-BB78-40DB-8AAF-5DD1DFEA48D5-- --Apple-Mail=_DCC3467D-9594-44D0-A1AF-E72761DF7A0B-- From unknown Sat Aug 09 01:12:08 2025 X-Loop: help-debbugs@gnu.org Subject: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets Resent-From: "Dr. Arne Babenhauserheide" Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Wed, 05 Mar 2025 11:56:01 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 76759 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: patch To: Jostein =?UTF-8?Q?Kj=C3=B8nigsen?= Cc: 76759@debbugs.gnu.org, emacs-devel@gnu.org X-Debbugs-Original-Cc: bug-gnu-emacs@gnu.org, "Ergus via Emacs development discussions." Received: via spool by submit@debbugs.gnu.org id=B.174117570710281 (code B ref -1); Wed, 05 Mar 2025 11:56:01 +0000 Received: (at submit) by debbugs.gnu.org; 5 Mar 2025 11:55:07 +0000 Received: from localhost ([127.0.0.1]:35926 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tpnL9-0002eu-Ap for submit@debbugs.gnu.org; Wed, 05 Mar 2025 06:55:07 -0500 Received: from lists.gnu.org ([2001:470:142::17]:50660) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tpnL6-0002aX-Nm for submit@debbugs.gnu.org; Wed, 05 Mar 2025 06:55:05 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tpnKt-0008TR-07; Wed, 05 Mar 2025 06:54:51 -0500 Received: from mout.web.de ([217.72.192.78]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tpnKr-0002dH-7i; Wed, 05 Mar 2025 06:54:50 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=web.de; s=s29768273; t=1741175685; x=1741780485; i=arne_bab@web.de; bh=6hLvZGCJlD9DLE7251z0fCm9BkMRurDNxtTUfScZ1kM=; h=X-UI-Sender-Class:From:To:Cc:Subject:In-Reply-To:References:Date: Message-ID:MIME-Version:Content-Type:cc:content-transfer-encoding: content-type:date:from:message-id:mime-version:reply-to:subject: to; b=Avs3qSYtuAKGs8c90uPAmrMoHCMVwoxzWoSCJ61rhWm1UuQq4yEjyMxs1EbkhRbP Yku14O4pWm74QV57vxzRy1nOhjUIuHV6n4CWFc5E8haOcQ5lzf6C+PTZAVhZwMA2h +6XVntX2llpNpUlKKgCCbsr/z29K9NsiBPt1QAIHyIlk7iWKVZqbgNCLTrj/S1HLJ Ji3QMFU0eD2TRyF8c/U7uErojDWxUURdwz8VIMlNJnzF5hDdxbOSQJsCjsGwe4aPS gP1ajWmXWFMfqt4cbJkMnQ3wZG8eytUJ0Jgsc06lPCiAgq+i/hjML46noP7dhckOA dgoClTeah4MzBirwCw== X-UI-Sender-Class: 814a7b36-bfc1-4dae-8640-3722d8ec6cd6 Received: from fluss ([84.165.28.160]) by smtp.web.de (mrweb106 [213.165.67.124]) with ESMTPSA (Nemesis) id 1N7QQB-1tBWOm06G5-00woIs; Wed, 05 Mar 2025 12:54:45 +0100 From: "Dr. Arne Babenhauserheide" In-Reply-To: ("Jostein =?UTF-8?Q?Kj=C3=B8nigsen?="'s message of "Wed, 5 Mar 2025 10:32:39 +0100") References: User-Agent: mu4e 1.12.8; emacs 30.0.92 Date: Wed, 05 Mar 2025 12:54:41 +0100 Message-ID: <87wmd33d6m.fsf@web.de> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha256; protocol="application/pgp-signature" X-Provags-ID: V03:K1:I05O7+SF2zYV4R6CP95kuoHfTwqICNUbzBR8TjDGErgHK+ZvKTN TVNUp6P9kpwY5LBdZegvKeWkHRf91L3PFtqDS2CDrQluhweOyTPXf8fkE4koo6qu/I3Ldr6 lQNFnhyLOFI1OEB3dlxilBQ9VxVWaH4agPLMNKsJlR6sgMGKnIDaYb4oFMS8uG5UvH5tTry rDgZ2bC47lKEXxGSxJK6w== X-Spam-Flag: NO UI-OutboundReport: notjunk:1;M01:P0:lDpbybPSxKc=;AkLGkmnLejTa79tK8Kx6yaGzVA/ 3a/f0OfnIJA2TsAAsoj1pv/DzUvtTNUbQ/lKD254eVQXEAI5kQh1Oao4APbtXdCFXoywgQ6WI WFZGVycjJg+kGM0I1Kw5eVkJQHvd+bjNMnzjcKHMhWBXzXxztG3jB/26qXjA2NE07LvvRuD9g FmJFFhwzkiMJFzjDztSt48IrN8jxzbIFGdfu08jWUQRltl0Ueb7DWIRIv33hVW464dx8dsSpw 2Jd47c8YeuUX3H9PBPsyHW11c90VmJEbYXaNvIX/1Oj/bT8HD+pVEAHKvmB9W8XnoAxraTSvP 8l7EJ+hJOWGKcBlXYnkOjkuuw43K2rpuBhpl2+0vo4cvf8Kf/IjgtWNGk7bpRyCbtrzgE1ARC fjT08++68PJ97dSkfTmBcz9ri1RG1H0iOuYdX3iPo+tFfNAD4K9d/edA35/KIrflaumdsd/iQ JKCa3b+VlzQybHZYMPK6Gb0J6vH1koJBL2nLx0NZfbDsTc3Odw4xDsivSHSkPv5w+3HRZQkTf gmLydqlDgiyAfX7hpCYbkUazCiG3XOsrw6Esu24tSmVzZjtO1f1zReU9wGEklL3zX1OvT6qA3 1ZiZnq/HVrmXQZ/5Ut7jl3RCneH/KNNiqmO/oR4i9LRsZSL+F1KwKwsTCpxqa7JI5LaqoqJff YIv2VpanGfsqdqpccNIVJRSyOJ40Nrj4wONGauT/V8rIa0EmiB1HQY2BbrLhtB60+ke0e2wCi v6ajc/49DH9silu99sTX16NHcIKPeTLMBgM/Q21KAip5KvMXfoRbRGo62fDz+WgfNrUuA5YXG k28t77q+Z6LsV6y+haIMWm6QebX3ffwIwUokrvEOG92Ck5m/Jm+x5kyb/P5lRAJriJm3G9QKX s1u67vIil2rtw5hqsq8PuYLfWa8Rz4BukkefpfBCCSZ3mDq9+gIrzboV/ZXx955GFza0ImwuP nr/UEIddeFwQERV7BY6p/5jd7u334lLfYs2Z6MV0KA7xh27dZvmHfeg15Gnjcn/Fq7S2cQw1P JE3xzqRvlqlzQ7WY8ACHAbfndXzooEu0/pobzOEl2Kui/fzNMidK+r1jgqvrl/9L+fir+0NDd nQvyac7nNCNQiMWcXKQ8lz83VKRQnp0XdOh9BoKmCMUJrfhxFwMJ4r5ZvvDyX69UGvjDevWLh DgqxKTOYaksUHPvUAtJynaKQmmmzA0q0uUdfkXpjXK4QSTRcNkpYQVrCukv8mD2agS5Y+eUED Sq0ReSCfbyMn8pzt2MGpFI+xqeuJdbp3hair1KV33w6rFo0H6v7c0I044AOALfyRvF5k0vAOd fbjN0JRe/kziMBPg88r/I18rYIdznGv5VhmvzBsYG45FZahMmHtfCJM/n1j+WEjQz4e4BOfvD lBMXb/c6HlD08V8eQwl8e20YXo85YvUB7onVo= Received-SPF: pass client-ip=217.72.192.78; envelope-from=arne_bab@web.de; helo=mout.web.de X-Spam_score_int: -27 X-Spam_score: -2.8 X-Spam_bar: -- X-Spam_report: (-2.8 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, FREEMAIL_FROM=0.001, RCVD_IN_DNSWL_LOW=-0.7, RCVD_IN_MSPIKE_H5=0.001, RCVD_IN_MSPIKE_WL=0.001, RCVD_IN_VALIDITY_RPBL_BLOCKED=0.001, RCVD_IN_VALIDITY_SAFE_BLOCKED=0.001, SPF_HELO_NONE=0.001, SPF_PASS=-0.001 autolearn=ham autolearn_force=no X-Spam_action: no action X-Spam-Score: 0.0 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Hi Jostein, Jostein Kj=C3=B8nigsen writes: > A common pattern used in this regex is "[^\n$#]" (with slight variations)= , which (from how I read regexps) aims to match anything which is not a > lineshift, a $-sign or a #-sign. > > "Anything" in this case would then also include whitespace, which IMO is = the source of the bug. > > I've tried changing this part of the statement in parts of the regex to "= [^\n\s$#]", like in the attached patch. Ie also exclude leading whitespace. > From what I've tested, it does not seem to have any adverse effects, alth= ough I may not have tested all areas affected by this change. From=20the Makefile format, I think this should not be leading whitespace, but only leading tabs. Leading spaces in rules are a syntax error. Can you check whether \t instead of \s also works? Best wishes, Arne =2D-=20 Unpolitisch sein hei=C3=9Ft politisch sein, ohne es zu merken. draketo.de --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQJEBAEBCAAuFiEE801qEjXQSQPNItXAE++NRSQDw+sFAmfIO4EQHGFybmVfYmFi QHdlYi5kZQAKCRAT741FJAPD6403EACKovVuo4u/9KHg9HbU1/07mlb67Xaju8Hp CHA3Nt9QXvR3TIuwbyJGnmbGsZ1h9Bx727hJJRNQIvimnkn8n4kjPWoimvLcqbwb Xb8SGi7kQrPvWtaH3zY1ZHdPpr3zIYQrRnaoP9vqWWpJzgNmNioSs1XBn+JxBWwk WVHc3Ypk9XtolAB8xjTDKl7JZ//JS+W6Fj5PqSnDgmm+yvrde8yaN0qU86HhDusw laVNfDvr5gXm/uTDPJPO6/AYj1s0TJ5FsPMjbgnlgNxO/0NQeQmo2L4i7S4pBqip UCLyXMpRofAbhJ1Rk/jPpPAR9MMEJ5qDTgPvGTzDgvf0DSxPQo0sSDhwGMU2Fplu BIypZzp03jN6mw0N+EDbluFI6NswVUg5iDQuOz+ztsyaXNIdDxduCV8cuXfAWRof yAtkDlvB+i6lxyq79ykMqrQFju+7sqhoiucVEqDc5qUTnbyOhy5smowKaJvwwoT0 Wy7QUSMqKLEt50L642UT5T5Fqa1ET9k/qdWlWc/dyHEHIpln1NrazzJbW/AtLpe7 rmPr6/3U0MJxsxUf2K9qI5fbfh3FNmuePq7P0FV6G05Btz33Xxc/XTMMWbL/374K 8myhUsza4llHp/EncYE/zfj08sA40FoZG/jVw4TaiwtBhfeqr0eUHH6w8ebR/xZk MnyGiC9C1YjEBAEBCAAuFiEE3Si95tmHXKvOSosd3M8NswvBBUgFAmfIO4EQHGFy bmVfYmFiQHdlYi5kZQAKCRDczw2zC8EFSIMyBACCXLuBV5himltN0okMMOhQdGWD SHFIiTSXoC2kp4svNyipQLYyZTKLWpBhXRjHAdYd8c5+T5gVDgmMHqrkDaDFT9Zq 9HDACt2tnqA3UVIsJehup6p3CJIujc3cvJwGFMZJtoyQhHH3YjbJ5QNhL8gEPrpy BQnevD4mE1xhP59bMg== =l6F5 -----END PGP SIGNATURE----- --=-=-=-- From unknown Sat Aug 09 01:12:08 2025 X-Loop: help-debbugs@gnu.org Subject: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets Resent-From: Mauro Aranda Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Wed, 05 Mar 2025 13:02:02 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 76759 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: patch To: Jostein =?UTF-8?Q?Kj=C3=B8nigsen?= , 76759@debbugs.gnu.org Received: via spool by 76759-submit@debbugs.gnu.org id=B76759.17411796621431 (code B ref 76759); Wed, 05 Mar 2025 13:02:02 +0000 Received: (at 76759) by debbugs.gnu.org; 5 Mar 2025 13:01:02 +0000 Received: from localhost ([127.0.0.1]:36060 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tpoMw-0000Mp-0T for submit@debbugs.gnu.org; Wed, 05 Mar 2025 08:01:02 -0500 Received: from mail-pl1-x631.google.com ([2607:f8b0:4864:20::631]:56767) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.84_2) (envelope-from ) id 1tpoMt-0000MB-H8 for 76759@debbugs.gnu.org; Wed, 05 Mar 2025 08:01:00 -0500 Received: by mail-pl1-x631.google.com with SMTP id d9443c01a7336-223785beedfso87333185ad.1 for <76759@debbugs.gnu.org>; Wed, 05 Mar 2025 05:00:59 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1741179653; x=1741784453; darn=debbugs.gnu.org; h=content-transfer-encoding:in-reply-to:from:content-language :references:to:subject:user-agent:mime-version:date:message-id:from :to:cc:subject:date:message-id:reply-to; bh=NrJAaC8JtjRDeJquhk0d6yolO9E04qvj/fjhmTb3Y+c=; b=EZ+ESaySlkvabX5V1P7C351hs2H7wFYSH/jxETkIwri9h2xlAoIo9S5jgJ52vQPA3/ HSxeISSAbhIz5kunYWZpLA5RQ2Zaf/ah/WQHvkaksil5/uo2YEdTR338lTfA8EU6QK7m QyNTrnbkIuyeMvA09bMbAXjKqAzObLGB1cJcrccavlVVY6LEb039DpI25MMZbSQSjS7q XSBQv34KQ2qOJgcsFM56BLCG1BYcVnRNyJkynlOWrbYky6ukMiRMqTl2numKmiXxc0uF kpjXBqD4z8+LHukc+n2ztSm0iUYKPwfyxzzGWXqtuOWi/8HNJjm9cTfnG4rAY/llOY/Q AC1g== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1741179653; x=1741784453; h=content-transfer-encoding:in-reply-to:from:content-language :references:to:subject:user-agent:mime-version:date:message-id :x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=NrJAaC8JtjRDeJquhk0d6yolO9E04qvj/fjhmTb3Y+c=; b=QQLfSSxGmHeGIXANMUefA02cv1lv9hcSe+HMXQIorM4pI/0jY2pJXNXE6l8Ftqa125 zxbcGnJz/j2n3MVhAdkQ+n4ZJk18wPVu1RfY10/aqYruejgUlDoW0qVdT4k6QT6PUu7J e8SqOkymPVA+DoqTJAcUA6BkbBEl02WG174r1M0fuANg/T2If7gLlIRkwom5TMQNHB2y n8KPZSo3po+i1DATNyyiW5eLSUnJOFeOxfji4dRsHP1+JyNVPiD13FEHTNw1WG2cKAkM JGJaWWuZ4NLQwqLO7w5SIg5R4GoM6hjAuC9BKMSWSqs/mABCJSnOTG8Mu1xPp84lDMgG 9XxQ== X-Forwarded-Encrypted: i=1; AJvYcCUaqhh9MtEfdzxrw22vLegYS1RNQyHdZWoiB1uOXtOuXpAEGjGnOZ7v6Kl2njQzWVcL9UnKag==@debbugs.gnu.org X-Gm-Message-State: AOJu0Ywlc2sZCJDSXibdcwGgmAi5Cij9Nd9AjvD187jpUoCBjvPL0xwo fRhifQTH1LP1twFjUhHnadWKTKGjIH5hI8mgJL5bjiRnF0QVqmh9 X-Gm-Gg: ASbGncsJ1RgPIP9IDhpgICIaz/+f7y3bNon1ycje6itiHJgM2DsEIIDxf2Nd8g97xKz u93ADEmfkhulSnAQPn1eJaZQ4AuQNSOVqM4Xp7EgHacQ1Z7pua9WDyK3NM3chbrjuIYxswRcgxA sbLMoGY8BSu5ZuFd2IZ47VAGsI0Y0uVmcTH9TmDl6enIJHUX7eL5LUawAUJTP+xCIp1dGRdU9EY MO9C0JqUu6UzDthAv0lEAzo3bZ7+gMHCwKbQvGhdFChz1AEzjx3IF+rOWOStwSq3+4G5aE+9xns rWYP4RrsUvPJ14jJTOTzEYnNOdUlQqrlEjtXJKy8rioQ1+NfXuU= X-Google-Smtp-Source: AGHT+IGn0X/nifGozhMi/gPWIpGsmPBFbyWUbDxLrvHZyaX8q2dmmeiQBNImo1myI6FtkQFqeNBDRg== X-Received: by 2002:a17:902:f682:b0:223:37b8:c213 with SMTP id d9443c01a7336-223f1d359fdmr43831675ad.52.1741179652992; Wed, 05 Mar 2025 05:00:52 -0800 (PST) Received: from [192.168.0.234] ([181.228.33.6]) by smtp.gmail.com with ESMTPSA id 98e67ed59e1d1-2ff4e77629asm1257678a91.13.2025.03.05.05.00.51 (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Wed, 05 Mar 2025 05:00:52 -0800 (PST) Message-ID: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> Date: Wed, 5 Mar 2025 10:00:50 -0300 MIME-Version: 1.0 User-Agent: Mozilla Thunderbird References: Content-Language: en-US From: Mauro Aranda In-Reply-To: Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Spam-Score: 0.0 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Jostein Kjønigsen writes: > Hey everyone. > > I found a bug in makefile-mode fontification. > > Currently shell-commands/make-instructions within a target may get > fontified as make-targets if they contain a : (colon) sign. > > Consider the following make-target: > > ------- Makefile ------ > > run-docker: build-docker > docker run -p 8080:8080 imagename > > -------------------------- > > This defined a make-target called "run-docker" which depends on > "build-docker", which runs the command "docker run -p 8080:8080 > imagename". > > In the current code, since the command contains a ":" the whole text up > to that point ("docker run -p 8080") gets fontified as a make-target, even > though it's clearly not declared at the beginning of the line. > Looks like the 10th duplicate of Bug#17400. From unknown Sat Aug 09 01:12:08 2025 X-Loop: help-debbugs@gnu.org Subject: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets Resent-From: Jostein =?UTF-8?Q?Kj=C3=B8nigsen?= Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Wed, 05 Mar 2025 13:20:01 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 76759 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: patch To: Mauro Aranda , "Dr. Arne Babenhauserheide" Cc: 76759@debbugs.gnu.org Received: via spool by 76759-submit@debbugs.gnu.org id=B76759.17411807744381 (code B ref 76759); Wed, 05 Mar 2025 13:20:01 +0000 Received: (at 76759) by debbugs.gnu.org; 5 Mar 2025 13:19:34 +0000 Received: from localhost ([127.0.0.1]:36101 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tpoes-00018b-9o for submit@debbugs.gnu.org; Wed, 05 Mar 2025 08:19:34 -0500 Received: from fout-b4-smtp.messagingengine.com ([202.12.124.147]:49393) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tpoep-00018N-OJ for 76759@debbugs.gnu.org; Wed, 05 Mar 2025 08:19:32 -0500 Received: from phl-compute-05.internal (phl-compute-05.phl.internal [10.202.2.45]) by mailfout.stl.internal (Postfix) with ESMTP id 0F69811401F8; Wed, 5 Mar 2025 08:19:26 -0500 (EST) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-05.internal (MEProxy); Wed, 05 Mar 2025 08:19:26 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= secure.kjonigsen.net; h=cc:cc:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm3; t=1741180765; x=1741267165; bh=GwMACskg75D2lc9qflalow7YzUsaB8LVhmI8gjB4t/E=; b= ql6s/e+VFlqysTg3USNJVRD/3nR4On9XBDYjolChn9JZkzB1S9Vzc1khdw/xInBH xrzNJofZJAm4FG1BkosPypQ5qSF989YdVquRAx3t8kPYDL+wGsJi5K4xg/B2wd5h bMfcV9PMMMEQ7y52l6nooIdHKGXF0/+N0E05s2PhO/Fy3NTF6rrtjB46zyxm+wor gJ4iHz6mEjHwC38O8qT/dDUXxZk3TjcAJtOsKLiLAtgvSokiDZcJvUNfuMoNTtcC L6lHNnZNid/IACeH7wkkix+vgkzIxqpRN7DC3t/83A/dKQmMLryar3+e4kS9BeQk +dp+9C8u/8AyRzdFb4h1aw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t= 1741180765; x=1741267165; bh=GwMACskg75D2lc9qflalow7YzUsaB8LVhmI 8gjB4t/E=; b=aN/gBR9bJvdm4uPTqkVg0pF2dtNYd/t5jm2Hi7tjKHAQkjcaec4 B+r9loYROnjcWvcHZgtYUkQoZX/Szh1IpyE8VDv3+2Y+lAUJSsVaNBhbVNgUMNjp AkB+/WlSUiLNZOPGqru/ChzoSOAY6Izxktr1SlwJcUqarn22fAImJpGD/3fR2dve 3XLt/stpZJJlArhO6TipKihjmPIOsqf8LmIncvwR4iifb4n+DewK7TKouTa6mdFg x7L/cCW9qet96DWQ3YjI3BXZ4YVUxc2z5Lt6nu4FYMjKZO0b1nNwbSmohT+Qj5p7 vYGoh/ZhxB0tb6Gh36/qULGhnsgYJXmq3zQ== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddutdegleduucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpih gvnhhtshculddquddttddmnecujfgurhephffktgggufffjgevvfhfofesrgdtmherhhdt jeenucfhrhhomheplfhoshhtvghinhcumfhjpphnihhgshgvnhcuoehjohhsthgvihhnse hsvggtuhhrvgdrkhhjohhnihhgshgvnhdrnhgvtheqnecuggftrfgrthhtvghrnhepvdei tdeuheelfeefteejgfegvdevleduveekffefhffgjeekteejheetffegueegnecuvehluh hsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomhepjhhoshhtvghinhes shgvtghurhgvrdhkjhhonhhighhsvghnrdhnvghtpdhnsggprhgtphhtthhopeefpdhmoh guvgepshhmthhpohhuthdprhgtphhtthhopehmrghurhhoohgrrhgrnhgurgesghhmrghi lhdrtghomhdprhgtphhtthhopegrrhhnvggpsggrsgesfigvsgdruggvpdhrtghpthhtoh epjeeijeehleesuggvsggsuhhgshdrghhnuhdrohhrgh X-ME-Proxy: Feedback-ID: ib2f84088:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 5 Mar 2025 08:19:25 -0500 (EST) From: Jostein =?UTF-8?Q?Kj=C3=B8nigsen?= Message-Id: Content-Type: multipart/alternative; boundary="Apple-Mail=_24BF04F4-94C2-46C6-8B4B-832CEE20E26E" Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3826.400.131.1.6\)) Date: Wed, 5 Mar 2025 14:19:12 +0100 In-Reply-To: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> X-Mailer: Apple Mail (2.3826.400.131.1.6) X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Apple-Mail=_24BF04F4-94C2-46C6-8B4B-832CEE20E26E Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset=utf-8 > =46rom the Makefile format, I think this should not be leading = whitespace, but only leading tabs. Leading spaces in rules are a syntax = error. Can you check whether \t instead of \s also works? Good catch, Arne. Will check. > Looks like the 10th duplicate of Bug#17400. Also good catch, Mauro. Can someone merge these 2 bugs? But honestly: A more than 10 year old bug!!! About time we get it fixed! I'll report back as soon as I have a new patch! =E2=80=94 Kind Regards Jostein Kj=C3=B8nigsen --Apple-Mail=_24BF04F4-94C2-46C6-8B4B-832CEE20E26E Content-Transfer-Encoding: quoted-printable Content-Type: text/html; charset=utf-8
=46rom the Makefile = format, I think this should not be leading whitespace, but only leading = tabs. Leading spaces in rules are a syntax error. Can you check whether = \t instead of \s also works?

Good = catch, Arne. Will check.

Looks like the 10th duplicate of = Bug#17400.

Also good catch, = Mauro. Can someone merge these 2 bugs?

But = honestly: A more than 10 year old bug!!! About time we get it = fixed!

I'll report back as soon as I have = a new patch!

=E2=80=94
Kind Regards
Jostein = Kj=C3=B8nigsen

= --Apple-Mail=_24BF04F4-94C2-46C6-8B4B-832CEE20E26E-- From unknown Sat Aug 09 01:12:08 2025 X-Loop: help-debbugs@gnu.org Subject: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets Resent-From: Mauro Aranda Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Wed, 05 Mar 2025 13:29:01 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 76759 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: patch To: Jostein =?UTF-8?Q?Kj=C3=B8nigsen?= Cc: "Dr. Arne Babenhauserheide" , 76759@debbugs.gnu.org Received: via spool by 76759-submit@debbugs.gnu.org id=B76759.17411813106048 (code B ref 76759); Wed, 05 Mar 2025 13:29:01 +0000 Received: (at 76759) by debbugs.gnu.org; 5 Mar 2025 13:28:30 +0000 Received: from localhost ([127.0.0.1]:36124 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tponW-0001ZS-4X for submit@debbugs.gnu.org; Wed, 05 Mar 2025 08:28:30 -0500 Received: from mail-pj1-x1032.google.com ([2607:f8b0:4864:20::1032]:56699) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.84_2) (envelope-from ) id 1tponS-0001Z7-UC; Wed, 05 Mar 2025 08:28:27 -0500 Received: by mail-pj1-x1032.google.com with SMTP id 98e67ed59e1d1-2f9d3d0f55dso11000628a91.1; Wed, 05 Mar 2025 05:28:26 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1741181301; x=1741786101; darn=debbugs.gnu.org; h=content-transfer-encoding:in-reply-to:from:content-language :references:cc:to:subject:user-agent:mime-version:date:message-id :from:to:cc:subject:date:message-id:reply-to; bh=ULzSnmD1ItcDA5CMOaAR27mfki7S5XkZbmga5Ve+e4M=; b=FRZVkyORDLTAZE5w8ZKPHss5QvOhnUYoAUeZTORNsExfaGbtt400kzEx7nOzNAR7Eq /iQuc1/fDf+Q4K4QKTBtzvItk+f6LE0+yB3vDL//rArjco+WE4rKFT+8qIvuYGIA0Iy2 gIRRQ9n2rGFBKJbdDykB/b36WqPEj2EucmYX3pBPcStD00hyQ0zZQQIiN8q10Jon3v3l LJh54ltDM2A2a0lteKBM0L6uffWLtcmZZ0dJnZQX7MNJKd/I8rp6noTH6Z0DKWkImzKt ZPqJiF61y9JMsf7mgbCP4hxNZDflC/hEKPcKY/gfwRp32r2t93fACX07aoewxegNGaSe SoOQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1741181301; x=1741786101; h=content-transfer-encoding:in-reply-to:from:content-language :references:cc:to:subject:user-agent:mime-version:date:message-id :x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=ULzSnmD1ItcDA5CMOaAR27mfki7S5XkZbmga5Ve+e4M=; b=IOzlNSufHAqJsibpshcIF1aQFuQ7t4C/xYn/XLOCFBfNddLw0Y2B9HDCbfWJkf9Iwd Ma8BgefIrM028TREJewozlGjjiJh02zZuuwkOs7IISaVKdnNcFHsogRlaNcawOxTlDrp U/qfksVmHIQriV6TfRw+k5GPm97RG78kusXSo5EXcvdcyumYqJRNHhwZjW0Ulz91xzPZ a2n9RfcphLPKh29678PtgRdPP1cOsArDNif4HfuxT606Fbldjra+GgElwfcfShfxlKKi iyPNDcqQgvEqoAZLAGg9a0U6Msttw0Brx60434gUA2KXzqQwmAbP1SSiJfTYv+AlKpnP zrZQ== X-Forwarded-Encrypted: i=1; AJvYcCWFlr6WIRDWOiGxmAPwrCaYd0gk/WReJmxbkRJcwV7DH4U/roc66UJ5vOCa7vSA5BhHipfoloSy@debbugs.gnu.org X-Gm-Message-State: AOJu0YyqAHSvF4IoNjqyzbHpTnomhtWLp41tRTTYw8eb9lCppAKO6pUb YF1GyH5gdl5+1FpYcrUz8LomlJW7HSYWEyFOXirG9pdhhH7kOn1d X-Gm-Gg: ASbGncumzIKZ5EgrA9lC1WZIbdYErVjzUHVdRDCRKgZGoq1CjSw2X0pESuWZvX8ZFOM pidd95xTZpfP8TshDsXLcrXPN2+DdQ/1jdb8AINiJyqp7w+KeuAQhZMmdPHK0pS9fsrKiOWeyF8 T0YxUaLQmWhHRP9KOf232ePMGxJxEVLtGB/xadIFQWp81AnCFcZKeU5Bkb0E8DDic0k91JjjWrl gP3EhdWgPMRMPbkTGif9PJ2Je2nHenipH/7YajLKT8mM8WrmxRATIh/82TZYErDb9xHFGozFwba AnO1SgPCaHcURAJfiBUJNdWWvsLq3Xi8gzDJJqCpLzb4YK2pbQU= X-Google-Smtp-Source: AGHT+IEF2f6/1XtOy+PyzZu/s2DhIyO/ZyJxFZSgZAqr1h/Jz/KxM//uOQLF+GYhImliKzntdzmC/w== X-Received: by 2002:a17:90b:2e44:b0:2ee:c918:cd60 with SMTP id 98e67ed59e1d1-2ff49753517mr5374086a91.20.1741181300714; Wed, 05 Mar 2025 05:28:20 -0800 (PST) Received: from [192.168.0.234] ([181.228.33.6]) by smtp.gmail.com with ESMTPSA id d9443c01a7336-223501d2778sm112891595ad.36.2025.03.05.05.28.19 (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Wed, 05 Mar 2025 05:28:20 -0800 (PST) Message-ID: Date: Wed, 5 Mar 2025 10:28:17 -0300 MIME-Version: 1.0 User-Agent: Mozilla Thunderbird References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> Content-Language: en-US From: Mauro Aranda In-Reply-To: Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Spam-Score: 0.0 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) merge 17400 76759 quit Jostein Kjønigsen writes: >  Looks like the 10th duplicate of Bug#17400. > > Also good catch, Mauro. Can someone merge these 2 bugs? Thanks for confirming.  Merging the bugs now. > But honestly: A more than 10 year old bug!!! About time we get it fixed! > > I'll report back as soon as I have a new patch! Thanks for working on this. From unknown Sat Aug 09 01:12:08 2025 X-Loop: help-debbugs@gnu.org Subject: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets Resent-From: Jostein =?UTF-8?Q?Kj=C3=B8nigsen?= Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Wed, 05 Mar 2025 13:30:04 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 76759 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: confirmed patch To: Mauro Aranda , "Dr. Arne Babenhauserheide" Cc: 76759@debbugs.gnu.org, "Ergus via Emacs development discussions." Received: via spool by 76759-submit@debbugs.gnu.org id=B76759.17411813526176 (code B ref 76759); Wed, 05 Mar 2025 13:30:04 +0000 Received: (at 76759) by debbugs.gnu.org; 5 Mar 2025 13:29:12 +0000 Received: from localhost ([127.0.0.1]:36137 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tpooC-0001bX-D1 for submit@debbugs.gnu.org; Wed, 05 Mar 2025 08:29:12 -0500 Received: from fout-b4-smtp.messagingengine.com ([202.12.124.147]:36061) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tpoo8-0001ax-Vw for 76759@debbugs.gnu.org; Wed, 05 Mar 2025 08:29:09 -0500 Received: from phl-compute-01.internal (phl-compute-01.phl.internal [10.202.2.41]) by mailfout.stl.internal (Postfix) with ESMTP id 6C5651140176; Wed, 5 Mar 2025 08:29:03 -0500 (EST) Received: from phl-mailfrontend-01 ([10.202.2.162]) by phl-compute-01.internal (MEProxy); Wed, 05 Mar 2025 08:29:03 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= secure.kjonigsen.net; h=cc:cc:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm3; t=1741181343; x=1741267743; bh=e6HBT0b7kd9jrw2lXu71P9B+llfED88z1umU75GlAII=; b= A1yAGaTYvfvmJIoEZs6VNHkMxl7Egfsj7vEgwEQDIstl8NTji5vy2A1OtlX9FBkG iviHKkHlwUXC2KaHjMWPEoUEFqnBEQg6fX1W39+/pPLVjFPTzCKIg2qFJD9/1BdY RZggAxRUfurbY4Mxy3rmm7cSCKB383aYmiOk2qyjzHZfltFvyBiVK5Gq+zupQDCp Npmh9IjriyayG71FHlizHXXQTcoA7wvHGFTdOzcdzKy8LWkCXF748365x+qSMvXU /oHo72uODWhJdZ6fi4bURxyI/TMb5i1O5qL7n04+IFr04j4LEqiRZ8355sD+WQpt ZOcxuGzT8D0yafVXElLXYw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t= 1741181343; x=1741267743; bh=e6HBT0b7kd9jrw2lXu71P9B+llfED88z1um U75GlAII=; b=MQR8pT9+j1L35pXkO5vtGxzhRedHjw0Pix67GvQ0C95ZZ1u0c2H jGGBZDn3Msj1R5N+0DZYdoPxxl87pApKMtqnAfJBsht7yzO5FFnuJGpU7iEswaDM VzghgnOZghokRGtD3F6b7vhBxA8j88740UT2zsEYMrhwIWmpwsXUBRBQu9wXPONG d81fNYuTllrjhpBfT9m/NPKCk4jtl9kP8gdugAL+lAoa26xKa+7dkAeCzMcurODO LOgvBLZvtmC1vCIIpoaPVXKElIYWPFWE+zKVCVEoqZidFLgFeyHDP+yiFFLVhJJq vhT6IbmPl1GNblOzBaUVq6TFog8qMWJeWDg== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddutdegleefucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpih gvnhhtshculddquddttddmnecujfgurhephffktgggufffjgevvfhfofesrgdtmherhhdt vdenucfhrhhomheplfhoshhtvghinhcumfhjpphnihhgshgvnhcuoehjohhsthgvihhnse hsvggtuhhrvgdrkhhjohhnihhgshgvnhdrnhgvtheqnecuggftrfgrthhtvghrnhepgeeg ffevieeggedujeehhfeftdegtddugeejuedvteeujeeutdekieejieejteelnecuvehluh hsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomhepjhhoshhtvghinhes shgvtghurhgvrdhkjhhonhhighhsvghnrdhnvghtpdhnsggprhgtphhtthhopeegpdhmoh guvgepshhmthhpohhuthdprhgtphhtthhopehmrghurhhoohgrrhgrnhgurgesghhmrghi lhdrtghomhdprhgtphhtthhopegrrhhnvggpsggrsgesfigvsgdruggvpdhrtghpthhtoh epjeeijeehleesuggvsggsuhhgshdrghhnuhdrohhrghdprhgtphhtthhopegvmhgrtghs qdguvghvvghlsehgnhhurdhorhhg X-ME-Proxy: Feedback-ID: ib2f84088:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 5 Mar 2025 08:29:02 -0500 (EST) From: Jostein =?UTF-8?Q?Kj=C3=B8nigsen?= Message-Id: Content-Type: multipart/alternative; boundary="Apple-Mail=_C05E37ED-D71A-4B2C-BDC1-1A0F1DF65426" Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3826.400.131.1.6\)) Date: Wed, 5 Mar 2025 14:28:49 +0100 In-Reply-To: References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> X-Mailer: Apple Mail (2.3826.400.131.1.6) X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Apple-Mail=_C05E37ED-D71A-4B2C-BDC1-1A0F1DF65426 Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset=utf-8 Tested with \t and that works too. Attached is a patch containing these = changes and which fixes this (these) bug(s). =EF=BF=BC =E2=80=94 Kind Regards Jostein Kj=C3=B8nigsen > On 5 Mar 2025, at 14:19, Jostein Kj=C3=B8nigsen = wrote: >=20 >> =46rom the Makefile format, I think this should not be leading = whitespace, but only leading tabs. Leading spaces in rules are a syntax = error. Can you check whether \t instead of \s also works? >=20 >=20 > Good catch, Arne. Will check. >=20 >> Looks like the 10th duplicate of Bug#17400. >=20 >=20 > Also good catch, Mauro. Can someone merge these 2 bugs? >=20 > But honestly: A more than 10 year old bug!!! About time we get it = fixed! >=20 > I'll report back as soon as I have a new patch! >=20 > =E2=80=94 > Kind Regards > Jostein Kj=C3=B8nigsen >=20 --Apple-Mail=_C05E37ED-D71A-4B2C-BDC1-1A0F1DF65426 Content-Type: multipart/mixed; boundary="Apple-Mail=_ED394EC3-E220-409E-B5C9-D008B6A74791" --Apple-Mail=_ED394EC3-E220-409E-B5C9-D008B6A74791 Content-Transfer-Encoding: 7bit Content-Type: text/html; charset=us-ascii
Tested with \t and that works too. Attached is a patch containing these changes and which fixes this (these) bug(s).

--Apple-Mail=_ED394EC3-E220-409E-B5C9-D008B6A74791 Content-Disposition: attachment; filename=0001-Fix-fontification-error-in-makefile-mode.patch Content-Type: application/octet-stream; x-unix-mode=0644; name="0001-Fix-fontification-error-in-makefile-mode.patch" Content-Transfer-Encoding: quoted-printable =46rom=20ca150c19ae03f55a7f83026d3e52327ad7f37a4f=20Mon=20Sep=2017=20= 00:00:00=202001=0AFrom:=20=3D?UTF-8?q?Jostein=3D20Kj=3DC3=3DB8nigsen?=3D=20= =0ADate:=20Wed,=205=20Mar=202025=2010:24:09=20= +0100=0ASubject:=20[PATCH]=20Fix=20fontification=20error=20in=20= makefile-mode.=0A=0A-=20lisp/progmodes/make-mode.el:=20= makefile-dependency-regex=0A=0AEnsure=20we=20check=20for=20leading=20= spaces=20when=20trying=20to=20match=20make-targets.=0A---=0A=20= lisp/progmodes/make-mode.el=20|=202=20+-=0A=201=20file=20changed,=201=20= insertion(+),=201=20deletion(-)=0A=0Adiff=20--git=20= a/lisp/progmodes/make-mode.el=20b/lisp/progmodes/make-mode.el=0Aindex=20= 0ae74630cff..29c1d025fef=20100644=0A---=20a/lisp/progmodes/make-mode.el=0A= +++=20b/lisp/progmodes/make-mode.el=0A@@=20-226,7=20+226,7=20@@=20= makefile-runtime-macros-list=0A=20;;=20index=20in=20= makefile-imenu-generic-expression.=0A=20(defvar=20= makefile-dependency-regex=0A=20=20=20;;=20Allow=20for=20two=20nested=20= levels=20$(v1:$(v2:$(v3:a=3Db)=3Dc)=3Dd)=0A-=20=20= "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[}= )]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^= \n$#:=3D]\\)+?\\)\\(:\\)\\(?:[=20\t]*$\\|[^=3D\n]\\(?:[^#\n]*?;[=20= \t]*\\(.+\\)\\)?\\)"=0A+=20=20= "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n\t$#})]+?= [})]\\)\\|[^\n\t$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n\t$#)}]\\)+?[})]\\|[^({]\\= )\\|[^\n\t$#:=3D]\\)+?\\)\\(:\\)\\(?:[=20\t]*$\\|[^=3D\n]\\(?:[^#\n]*?;[=20= \t]*\\(.+\\)\\)?\\)"=0A=20=20=20"Regex=20used=20to=20find=20dependency=20= lines=20in=20a=20makefile.")=0A=20=0A=20(defconst=20= makefile-bsdmake-dependency-regex=0A--=20=0A2.48.1=0A=0A= --Apple-Mail=_ED394EC3-E220-409E-B5C9-D008B6A74791 Content-Transfer-Encoding: quoted-printable Content-Type: text/html; charset=utf-8
=E2=80=94
Kind Regards
Jostein = Kj=C3=B8nigsen

On 5 Mar 2025, at 14:19, Jostein = Kj=C3=B8nigsen <jostein@secure.kjonigsen.net> wrote:

=46rom the Makefile = format, I think this should not be leading whitespace, but only leading = tabs. Leading spaces in rules are a syntax error. Can you check whether = \t instead of \s also works?

Good = catch, Arne. Will check.

Looks like the 10th duplicate of = Bug#17400.

Also good catch, = Mauro. Can someone merge these 2 bugs?

But = honestly: A more than 10 year old bug!!! About time we get it = fixed!

I'll report back as soon as I have = a new patch!

=E2=80=94
Kind Regards
Jostein = Kj=C3=B8nigsen


= --Apple-Mail=_ED394EC3-E220-409E-B5C9-D008B6A74791-- --Apple-Mail=_C05E37ED-D71A-4B2C-BDC1-1A0F1DF65426-- From unknown Sat Aug 09 01:12:08 2025 X-Loop: help-debbugs@gnu.org Subject: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets Resent-From: Jostein =?UTF-8?Q?Kj=C3=B8nigsen?= Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Sat, 08 Mar 2025 21:55:01 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 76759 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: confirmed patch To: Mauro Aranda , "Dr. Arne Babenhauserheide" Cc: 76759@debbugs.gnu.org, "Ergus via Emacs development discussions." Received: via spool by 76759-submit@debbugs.gnu.org id=B76759.174147088217099 (code B ref 76759); Sat, 08 Mar 2025 21:55:01 +0000 Received: (at 76759) by debbugs.gnu.org; 8 Mar 2025 21:54:42 +0000 Received: from localhost ([127.0.0.1]:57083 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tr281-0004Rj-O0 for submit@debbugs.gnu.org; Sat, 08 Mar 2025 16:54:42 -0500 Received: from fhigh-a6-smtp.messagingengine.com ([103.168.172.157]:32889) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tr27z-0004RV-Mm for 76759@debbugs.gnu.org; Sat, 08 Mar 2025 16:54:40 -0500 Received: from phl-compute-08.internal (phl-compute-08.phl.internal [10.202.2.48]) by mailfhigh.phl.internal (Postfix) with ESMTP id 9756C11400FB; Sat, 8 Mar 2025 16:54:33 -0500 (EST) Received: from phl-mailfrontend-01 ([10.202.2.162]) by phl-compute-08.internal (MEProxy); Sat, 08 Mar 2025 16:54:33 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= secure.kjonigsen.net; h=cc:cc:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm3; t=1741470873; x=1741557273; bh=+mc4qUeYPvTvRNKXeP1qQYLmrPju5Bo/KbBA/zHRYVk=; b= IQ2AfhGbTka346Zfy8iNg5pdAgD48tYaET6C60PDEZ/uvJmdLvmms4bEozNjiAWf xpOwHBJ0mYpHKohqrtKie5PnqOZP7+r1m0AOLpvppHrNLRzTj00q9ioCphtdTtpJ 4JDisO3tP8USr3orzp0uEfmETf8eBm0lbb70mYYxyE5uUzCVmCsd79LNlwpHyCQV J0spmbnC5ZqwS8Vnii3CR9cDvtO79hKPvCQrfm3YRiKt5K3b52VpY1uV+qs1xpwc Yg7xR20It+wnL5cL6cYQxs60zDMKGnMGlX9bAbi7sr3Mg/MqEhf/GZ8QAsg/pwtq 5s75gEIrVghyVh6r+4xG6A== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t= 1741470873; x=1741557273; bh=+mc4qUeYPvTvRNKXeP1qQYLmrPju5Bo/KbB A/zHRYVk=; b=M22Nq2C90iIxpOltNiaKSczuG0eWZaS5jS8dtE3cktVWflEjLfN 6sHatnpYGGCfIIEbdOo2FGLDekI9vLkYXQFSCq7DZkMmb4fMj9Hl1kpXzyI/025d AXoQj5wCQtTY86oAw4aJpaMOVTXyBCqj88lfOWFYRIBaGYDqVZMRdQEa3FFq11Za rynSPNOS8mSPae/YqPHHJFDeKJb0F4dPOXzLAl6D9fSbE0CzjIqS/dYzJmabh6Hv iE1AfyO2V/oPuNfRTfP2l3kFQ7OUZc+NS9AaHXSjcRIdEkV2M/IfFmPJhgImiDsl p6dxU69tw+LFhHD2wwhHvU9vK2uCQ2asKcA== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdduudegieelucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpih gvnhhtshculddquddttddmnecujfgurhephffktgggufffjgevvfhfofesrgdtmherhhdt jeenucfhrhhomheplfhoshhtvghinhcumfhjpphnihhgshgvnhcuoehjohhsthgvihhnse hsvggtuhhrvgdrkhhjohhnihhgshgvnhdrnhgvtheqnecuggftrfgrthhtvghrnhepvdei tdeuheelfeefteejgfegvdevleduveekffefhffgjeekteejheetffegueegnecuvehluh hsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomhepjhhoshhtvghinhes shgvtghurhgvrdhkjhhonhhighhsvghnrdhnvghtpdhnsggprhgtphhtthhopeegpdhmoh guvgepshhmthhpohhuthdprhgtphhtthhopehmrghurhhoohgrrhgrnhgurgesghhmrghi lhdrtghomhdprhgtphhtthhopegrrhhnvggpsggrsgesfigvsgdruggvpdhrtghpthhtoh epjeeijeehleesuggvsggsuhhgshdrghhnuhdrohhrghdprhgtphhtthhopegvmhgrtghs qdguvghvvghlsehgnhhurdhorhhg X-ME-Proxy: Feedback-ID: ib2f84088:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Sat, 8 Mar 2025 16:54:32 -0500 (EST) From: Jostein =?UTF-8?Q?Kj=C3=B8nigsen?= Message-Id: <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Content-Type: multipart/alternative; boundary="Apple-Mail=_F362A61D-34A7-4A8F-9FEB-B565D3C59929" Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3826.400.131.1.6\)) Date: Sat, 8 Mar 2025 22:54:22 +0100 In-Reply-To: References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> X-Mailer: Apple Mail (2.3826.400.131.1.6) X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Apple-Mail=_F362A61D-34A7-4A8F-9FEB-B565D3C59929 Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset=utf-8 Any news on this one? Has anyone tested this? Anyone have any objection to the change? =E2=80=94 Kind Regards Jostein Kj=C3=B8nigsen > On 5 Mar 2025, at 14:28, Jostein Kj=C3=B8nigsen = wrote: >=20 > Tested with \t and that works too. Attached is a patch containing = these changes and which fixes this (these) bug(s). >=20 > <0001-Fix-fontification-error-in-makefile-mode.patch> > =E2=80=94 > Kind Regards > Jostein Kj=C3=B8nigsen >=20 >> On 5 Mar 2025, at 14:19, Jostein Kj=C3=B8nigsen = wrote: >>=20 >>> =46rom the Makefile format, I think this should not be leading = whitespace, but only leading tabs. Leading spaces in rules are a syntax = error. Can you check whether \t instead of \s also works? >>=20 >>=20 >> Good catch, Arne. Will check. >>=20 >>> Looks like the 10th duplicate of Bug#17400. >>=20 >>=20 >> Also good catch, Mauro. Can someone merge these 2 bugs? >>=20 >> But honestly: A more than 10 year old bug!!! About time we get it = fixed! >>=20 >> I'll report back as soon as I have a new patch! >>=20 >> =E2=80=94 >> Kind Regards >> Jostein Kj=C3=B8nigsen >>=20 >=20 --Apple-Mail=_F362A61D-34A7-4A8F-9FEB-B565D3C59929 Content-Transfer-Encoding: quoted-printable Content-Type: text/html; charset=utf-8 Any news on = this one?

Has anyone tested this? Anyone have any = objection to the change?

=E2=80=94
Kind Regards
Jostein = Kj=C3=B8nigsen

On 5 Mar 2025, at 14:28, Jostein = Kj=C3=B8nigsen <jostein@secure.kjonigsen.net> wrote:

Tested with \t and that works too. Attached is = a patch containing these changes and which fixes this (these) = bug(s).

<0001-Fix-fontification= -error-in-makefile-mode.patch>
=E2=80=94
Kind Regards
Jostein = Kj=C3=B8nigsen

On 5 Mar 2025, at 14:19, Jostein = Kj=C3=B8nigsen <jostein@secure.kjonigsen.net> wrote:

=46rom the Makefile = format, I think this should not be leading whitespace, but only leading = tabs. Leading spaces in rules are a syntax error. Can you check whether = \t instead of \s also works?

Good = catch, Arne. Will check.

Looks like the 10th duplicate of = Bug#17400.

Also good catch, = Mauro. Can someone merge these 2 bugs?

But = honestly: A more than 10 year old bug!!! About time we get it = fixed!

I'll report back as soon as I have = a new patch!

=E2=80=94
Kind Regards
Jostein = Kj=C3=B8nigsen
=



= --Apple-Mail=_F362A61D-34A7-4A8F-9FEB-B565D3C59929-- From unknown Sat Aug 09 01:12:08 2025 X-Loop: help-debbugs@gnu.org Subject: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets Resent-From: Eli Zaretskii Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Sun, 09 Mar 2025 06:35:02 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 76759 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: confirmed patch To: Jostein =?UTF-8?Q?Kj=C3=B8nigsen?= , Stefan Monnier , Paul Smith Cc: arne_bab@web.de, 76759@debbugs.gnu.org, maurooaranda@gmail.com, emacs-devel@gnu.org Received: via spool by 76759-submit@debbugs.gnu.org id=B76759.174150209426506 (code B ref 76759); Sun, 09 Mar 2025 06:35:02 +0000 Received: (at 76759) by debbugs.gnu.org; 9 Mar 2025 06:34:54 +0000 Received: from localhost ([127.0.0.1]:57817 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1trAFR-0006tS-Hd for submit@debbugs.gnu.org; Sun, 09 Mar 2025 01:34:53 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:51448) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1trAFP-0006tB-Ms for 76759@debbugs.gnu.org; Sun, 09 Mar 2025 01:34:52 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1trAFJ-0000Vv-I4; Sun, 09 Mar 2025 01:34:45 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-Version:References:Subject:In-Reply-To:To:From: Date; bh=dpfiI2XO+vdHL1kT/swhzk5wnvlZpXPmM5iX6mcKYBE=; b=PEFOewRet+UtelDOMqYo TsbyQH+LGIBGjuEj2R6anEPcOqgpp2xi8WWB726UBnbDjAB4YOiWvA90zjHnx67kigufLFdlrzwh+ 124WnuDoK6mi7Az7NWly2nTrosg1kqRQYVhcOfQm8U7KEJjyxtOmuXG64H8CH0caaC70xNIDTV4vB p3FhXYJadqEF5vpkylzMEugsJEyRFLCSBGCKYUAiQzmKFZbxAog+K7tRDKmu44R14PE4Tc6DN0kwl f/mipRscNxnEX2SyMR0ayP58260JI83hN3652wfYz4xkHx3aXK+izmda8cPwwyXlgqIACUGW/1XNi ramKW8jM/tzfQQ==; Date: Sun, 09 Mar 2025 08:34:40 +0200 Message-Id: <86ecz6iuf3.fsf@gnu.org> From: Eli Zaretskii In-Reply-To: <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> (message from Jostein =?UTF-8?Q?Kj=C3=B8nigsen?= on Sat, 8 Mar 2025 22:54:22 +0100) References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="=-=-=" X-Spam-Score: -2.3 (--) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) --=-=-= Content-Type: text/plain; charset=iso-8859-1 Content-Transfer-Encoding: quoted-printable > Cc: 76759@debbugs.gnu.org, > "Ergus via Emacs development discussions." > From: Jostein Kj=F8nigsen > Date: Sat, 8 Mar 2025 22:54:22 +0100 >=20 > Any news on this one? >=20 > Has anyone tested this? Anyone have any objection to the change? The Makefile syntax is tricky wrt whitespace, and target names can include colons, definitely on MS-Windows, but also on Posix systems. Also, there are various old formats, like that of Imakefile, that should still be supported, AFAIK. And we don't have a test suite for this mode. So I very much wonder whether this change will introduce regressions. Maybe Paul Smith, the maintainer of GNU Make (CC'ed), could help us here. Or maybe Stefan has comments? For their convenience, I re-attach the proposed patch below. Thanks. --=-=-= Content-Type: text/x-patch Content-Disposition: attachment; filename=0001-Fix-fontification-error-in-makefile-mode.patch >From 9774fe6028b0c5341aa7bf85adf20464e9ac4b5e Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Jostein=20Kj=C3=B8nigsen?= Date: Wed, 5 Mar 2025 10:24:09 +0100 Subject: [PATCH] Fix fontification error in makefile-mode. - lisp/progmodes/make-mode.el: makefile-dependency-regex Ensure we check for leading spaces when trying to match make-targets. --- lisp/progmodes/make-mode.el | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/lisp/progmodes/make-mode.el b/lisp/progmodes/make-mode.el index 0ae74630cff..7e0ccb0697e 100644 --- a/lisp/progmodes/make-mode.el +++ b/lisp/progmodes/make-mode.el @@ -226,7 +226,7 @@ makefile-runtime-macros-list ;; index in makefile-imenu-generic-expression. (defvar makefile-dependency-regex ;; Allow for two nested levels $(v1:$(v2:$(v3:a=b)=c)=d) - "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[})]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" + "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n\s$#})]+?[})]\\)\\|[^\n\s$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n\s$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n\s$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" "Regex used to find dependency lines in a makefile.") (defconst makefile-bsdmake-dependency-regex -- 2.48.1 --=-=-=-- From unknown Sat Aug 09 01:12:08 2025 MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) X-Loop: help-debbugs@gnu.org From: help-debbugs@gnu.org (GNU bug Tracking System) To: Jostein =?UTF-8?Q?Kj=C3=B8nigsen?= Subject: bug#76759: closed (Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets) Message-ID: References: X-Gnu-PR-Message: they-closed 76759 X-Gnu-PR-Package: emacs X-Gnu-PR-Keywords: confirmed patch Reply-To: 76759@debbugs.gnu.org Date: Mon, 10 Mar 2025 02:17:03 +0000 Content-Type: multipart/mixed; boundary="----------=_1741573023-4241-1" This is a multi-part message in MIME format... ------------=_1741573023-4241-1 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="utf-8" Your bug report #76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instruc= tions as make targets which was filed against the emacs package, has been closed. The explanation is attached below, along with your original report. If you require more details, please reply to 76759@debbugs.gnu.org. --=20 76759: https://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D76759 GNU Bug Tracking System Contact help-debbugs@gnu.org with problems ------------=_1741573023-4241-1 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at 76759-done) by debbugs.gnu.org; 10 Mar 2025 02:16:13 +0000 Received: from localhost ([127.0.0.1]:35280 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1trSgf-00014U-DE for submit@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:13 -0400 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:30555) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1trSgc-000147-IU for 76759-done@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:11 -0400 Received: from pmg1.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 00DB810004C; Sun, 9 Mar 2025 22:08:07 -0400 (EDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1741572486; bh=2gCWTxzhV3+OS7BQrbQBBvR/ao+UvJRf4YW3uB49t5s=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=gQ4POv+A3bjs7tLlosoDYKpH1CNnJ212j89toN8fapJ74W6Bf6Ubs5iG6nHevRa0d eRgvFCleL2MtvSXEzchignOVG+5ly2gblJL4b3XG9jZNoFY/8TU3fvgaqZpP67ztiv BlEa+sNPuWRRRI63JZ+7TgGjcYWvZoeHCRmQDP52jAumhyQz0NUMGqrTu+TykVBaHK SAdgFhjiqoLgw+fWToYWwFA83gl8DbfCEUd30QsI9FRc9lhpHqFXofCCOOgobi9a1A ePI5hm4HkSmGkC+bFVIcsXr456TCMGQxO2Q0nCjKltzqQrDSFRgavibbhy/j+gRfsF nLBj5Wn1elc4Q== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 474DC100034; Sun, 9 Mar 2025 22:08:06 -0400 (EDT) Received: from alfajor (unknown [104.247.242.5]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 047521204EE; Sun, 9 Mar 2025 22:08:05 -0400 (EDT) From: Stefan Monnier To: Jostein =?windows-1252?Q?Kj=F8nigsen?= Subject: Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets In-Reply-To: <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Message-ID: References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Date: Sun, 09 Mar 2025 22:08:04 -0400 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.299 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76759-done Cc: "Dr. Arne Babenhauserheide" , "Ergus via Emacs development discussions." , Mauro Aranda , 76759-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > Any news on this one? Looks OK, tho I think it's a bit more strict than necessary: the TABs we need to avoid can be only at the beginning of the line, so not inside the $(...). So it's only one of the [^...] that needs the \t. Here's what I did: - Start from the current monster: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[})]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Change the `\\(?:[^({]\\|.` to `\\(?:[^({]\\|[({]` because I think the `.` was just an optimization. And since the two alternatives are now mutually exclusive, swap them: \\(?:[^({]\\|.[^\n$#})]+?[})]\\) => \\(?:[({][^\n$#})]+?[})]\\|[^({]\\) - Now the regexp has become: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({][^\n$#})]+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Make the nested construction explicit, so it's a bit more manageable: (letrec ((elems-re (lambda (n &optional outer) (if (< n 1) "[^\n$#})]+?" (concat "\\(?:\\$\\(?:" "[({]" (funcall elems-re (- n 1)) "[})]" "\\|[^({]\\)" "\\|[^\n$#" (if outer ":=" ")}") "]\\)+?"))))) (concat ;; Allow for two nested levels $(v1:$(v2:$(v3:a=b)=c)=d) "^\\(" (funcall elems-re 3 'outer) "\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)")) - Disallow TABs in the outer case by replacing ":=" with "\t:=" (that's one of the TABs you added in your version of the patch). This is still not quite right, since AFAIK TABs are allowed to appear outside of $(...) as long as they're not at BOL, but I think it's better than what we've had so far (and the regexp still has several other limitations anyway). Pushed to `master`. Stefan ------------=_1741573023-4241-1 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at submit) by debbugs.gnu.org; 5 Mar 2025 09:33:17 +0000 Received: from localhost ([127.0.0.1]:35268 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tpl7q-0000sH-3T for submit@debbugs.gnu.org; Wed, 05 Mar 2025 04:33:16 -0500 Received: from lists.gnu.org ([2001:470:142::17]:45934) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tpl7j-0000rk-Vg for submit@debbugs.gnu.org; Wed, 05 Mar 2025 04:33:10 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tpl7d-0007Yl-6A; Wed, 05 Mar 2025 04:33:01 -0500 Received: from fhigh-a1-smtp.messagingengine.com ([103.168.172.152]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tpl7Z-0002sh-DK; Wed, 05 Mar 2025 04:33:00 -0500 Received: from phl-compute-12.internal (phl-compute-12.phl.internal [10.202.2.52]) by mailfhigh.phl.internal (Postfix) with ESMTP id 0622B11401C0; Wed, 5 Mar 2025 04:32:53 -0500 (EST) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-12.internal (MEProxy); Wed, 05 Mar 2025 04:32:53 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= secure.kjonigsen.net; h=cc:cc:content-type:content-type:date :date:from:from:in-reply-to:message-id:mime-version:reply-to :subject:subject:to:to; s=fm3; t=1741167173; x=1741253573; bh=jb mLETdglPZAT+FD7LdRGuW5RnFSZkR1yh1CskMZvBY=; b=tvyBuENwxd6HdA8BKY 2DqVQT3SVc64DHeakXWYyCU2kaXAOhUYjwD3SVa9oq0yvBO43kRAsMZXKcTd57k7 +lirpSyNaNZfdnVaOkCjpNfA4+jZwVN0nFh+YbXLQzw0GbiHnWMAmd5I19lQohWe 47RfhNjL+zWjvmd2FLqmMiq+/WVQERobGVx3duFLYX2AUjSBcpwjYzedTDkDekj7 V4fJZ1D4hjD6YO/WZXm2N8QloO3mkLD/7ysnD94zapxK7bOgg351jGRfGJwNhOce Uq3Pe7QgUTAvsqNMqpSo75exvdrSVfR8LujiKvXOUDW5GLOLlXHjkoVFmTBWBdjR vBZA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:message-id :mime-version:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1741167173; x= 1741253573; bh=jbmLETdglPZAT+FD7LdRGuW5RnFSZkR1yh1CskMZvBY=; b=z /hsOVXdNIxb9z2XXbbr19KZ4BLvFcyzDyosUazlDayI9tenYUamd5kPAFc5vDPGU DZpiKZD78aQ/m/4GXsUB0CSTTpj6dMmRngvCq1oLxX3M24mPQMH14c/Wcr7d/1jf Gn6ypZt6EjcDIMsVuwMefVDEdjlPy0LTanIk6EEFAw9Qp6+KGUjDeV5fj20/V7b6 8DVb5V3SM/8ISWtEpGyl/0iuu7/IEQkYY4ZxM16g0cAnae/5FukuqcgqNseClxjs 4Gwv1Hiwe+0wwk/u3CHPG5bncaQtTZG2q/9ZBg1/mAHXWoiKmiFQ6bc1AtaWCTuq lZRfZ1IE1Ld4YJvdCqRHQ== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddutdeggeeiucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpih gvnhhtshculddquddttddmnecujfgurhephfgtggfukfffvefvofesrgdtmherhhdtvden ucfhrhhomheplfhoshhtvghinhcumfhjpphnihhgshgvnhcuoehjohhsthgvihhnsehsvg gtuhhrvgdrkhhjohhnihhgshgvnhdrnhgvtheqnecuggftrfgrthhtvghrnhepleetveeu ffeihfdvgeeivdeiveelleegtedujefhjeekkeffueekjefgffeggfelnecuvehluhhsth gvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomhepjhhoshhtvghinhesshgv tghurhgvrdhkjhhonhhighhsvghnrdhnvghtpdhnsggprhgtphhtthhopedvpdhmohguvg epshhmthhpohhuthdprhgtphhtthhopegsuhhgqdhgnhhuqdgvmhgrtghssehgnhhurdho rhhgpdhrtghpthhtohepvghmrggtshdquggvvhgvlhesghhnuhdrohhrgh X-ME-Proxy: Feedback-ID: ib2f84088:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 5 Mar 2025 04:32:51 -0500 (EST) From: =?utf-8?Q?Jostein_Kj=C3=B8nigsen?= Content-Type: multipart/alternative; boundary="Apple-Mail=_DCC3467D-9594-44D0-A1AF-E72761DF7A0B" Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3826.400.131.1.6\)) Subject: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets Message-Id: Date: Wed, 5 Mar 2025 10:32:39 +0100 To: bug-gnu-emacs@gnu.org X-Mailer: Apple Mail (2.3826.400.131.1.6) Received-SPF: pass client-ip=103.168.172.152; envelope-from=jostein@secure.kjonigsen.net; helo=fhigh-a1-smtp.messagingengine.com X-Spam_score_int: -26 X-Spam_score: -2.7 X-Spam_bar: -- X-Spam_report: (-2.7 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, HTML_MESSAGE=0.001, RCVD_IN_DNSWL_LOW=-0.7, RCVD_IN_VALIDITY_RPBL_BLOCKED=0.001, RCVD_IN_VALIDITY_SAFE_BLOCKED=0.001, SPF_HELO_PASS=-0.001, SPF_PASS=-0.001 autolearn=ham autolearn_force=no X-Spam_action: no action X-Spam-Score: 0.7 (/) X-Debbugs-Envelope-To: submit Cc: "Ergus via Emacs development discussions." X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.3 (/) --Apple-Mail=_DCC3467D-9594-44D0-A1AF-E72761DF7A0B Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset=utf-8 Hey everyone. I found a bug in makefile-mode fontification. Currently shell-commands/make-instructions within a target may get = fontified as make-targets if they contain a : (colon) sign. Consider the following make-target: ------- Makefile ------ run-docker: build-docker docker run -p 8080:8080 imagename -------------------------- This defined a make-target called "run-docker" which depends on = "build-docker", which runs the command "docker run -p 8080:8080 = imagename". In the current code, since the command contains a ":" the whole text up = to that point ("docker run -p 8080") gets fontified as a make-target, = even though it's clearly not declared at the beginning of the line. Based on my digging, this seems to be due to the matching criteria = defined in makefile-dependency-regex. A common pattern used in this regex is "[^\n$#]" (with slight = variations), which (from how I read regexps) aims to match anything = which is not a lineshift, a $-sign or a #-sign. "Anything" in this case would then also include whitespace, which IMO is = the source of the bug. I've tried changing this part of the statement in parts of the regex to = "[^\n\s$#]", like in the attached patch. Ie also exclude leading = whitespace. =46rom what I've tested, it does not seem to have any = adverse effects, although I may not have tested all areas affected by = this change. Feel free to test the suggested changes, and let me know if they can be = improved in any way. =EF=BF=BC =E2=80=94 Kind Regards Jostein Kj=C3=B8nigsen In GNU Emacs 31.0.50 (build 19, aarch64-apple-darwin24.3.0, NS appkit-2575.40 Version 15.3.1 (Build 24D70)) of 2025-03-03 built on SOK67R3KWV97 Repository revision: 38ed2238316a83ad2c95db04f115c38ade48514f Repository branch: master Windowing system distributor 'Apple', version 10.3.2575 System Description: macOS 15.3.1 Configured using: 'configure --with-tree-sitter --with-native-compilation --with-imagemagick --with-harfbuzz' Configured features: ACL GLIB GNUTLS IMAGEMAGICK LCMS2 LIBXML2 MODULES NATIVE_COMP NOTIFY KQUEUE NS PDUMPER PNG RSVG SQLITE3 THREADS TOOLKIT_SCROLL_BARS TREE_SITTER WEBP XIM ZLIB Important settings: value of $LC_ALL: en_US.UTF-8 value of $LC_CTYPE: UTF-8 value of $LANG: en_US.UTF-8 locale-coding-system: utf-8-unix Major mode: BSDmakefile Minor modes in effect: treemacs-filewatch-mode: t treemacs-follow-mode: t treemacs-hide-gitignored-files-mode: t treemacs-git-mode: t treemacs-fringe-indicator-mode: t global-git-commit-mode: t magit-auto-revert-mode: t electric-pair-mode: t highlight-symbol-mode: t flycheck-mode: t editorconfig-mode: t indent-bars-mode: t completion-preview-mode: t which-function-mode: t delete-selection-mode: t global-auto-revert-mode: t poetry-tracking-mode: t all-the-icons-completion-mode: t marginalia-mode: t vertico-mode: t global-nlinum-mode: t nlinum-mode: t override-global-mode: t server-mode: t global-hl-line-mode: t pixel-scroll-precision-mode: t doom-modeline-mode: t tooltip-mode: t global-eldoc-mode: t show-paren-mode: t electric-indent-mode: t mouse-wheel-mode: t menu-bar-mode: t file-name-shadow-mode: t global-font-lock-mode: t font-lock-mode: t blink-cursor-mode: t minibuffer-regexp-mode: t column-number-mode: t line-number-mode: t indent-tabs-mode: t transient-mark-mode: t auto-composition-mode: t auto-encryption-mode: t auto-compression-mode: t hs-minor-mode: t Load-path shadows: /Users/josteink/.emacs.d/elpa/transient-20250301.2218/transient hides = /Users/josteink/build/emacs/lisp/transient Features: (shadow sort mail-extr emacsbug lisp-mnt re-builder make-mode dockerfile-ts-mode conf-mode em-unix em-term term ehelp em-script em-prompt em-pred em-ls em-hist em-glob em-extpipe em-cmpl em-dirs em-basic em-banner em-alias esh-mode esh-var expand-region text-mode-expansions the-org-mode-expansions python-el-fgallina-expansions html-mode-expansions er-basic-expansions expand-region-core expand-region-custom whitespace hydra lv treemacs-hydras tabify treemacs-mouse-interface treemacs treemacs-header-line treemacs-compatibility treemacs-mode treemacs-bookmarks treemacs-tags treemacs-interface treemacs-persistence treemacs-filewatch-mode treemacs-follow-mode treemacs-rendering treemacs-annotations treemacs-async treemacs-workspaces treemacs-dom treemacs-visuals treemacs-fringe-indicator treemacs-faces treemacs-icons treemacs-scope treemacs-themes treemacs-core-utils pfuture ht treemacs-logging treemacs-customization treemacs-macros ido yaml-ts-mode display-line-numbers misearch multi-isearch help-fns radix-tree bicep-ts-mode magit-gitignore git-rebase goto-addr magit-extras vc-hg vc-bzr vc-src vc-sccs vc-svn vc-cvs vc-rcs log-view vc bug-reference magit-bookmark magit-submodule magit-blame magit-stash magit-reflog magit-bisect magit-push magit-pull magit-fetch magit-clone magit-remote magit-commit magit-sequence magit-notes magit-worktree magit-tag magit-merge magit-branch magit-reset magit-files magit-refs magit-status magit magit-repos magit-apply magit-wip magit-log magit-diff smerge-mode git-commit log-edit pcvs-util magit-core magit-autorevert magit-margin magit-transient magit-process with-editor magit-mode benchmark magit-git magit-base magit-section cursor-sensor crm llama markdown-mode add-log elec-pair json-ts-mode vc-git vc-dispatcher tramp-cache time-stamp tramp-sh pulse org-duration diary-lib diary-loaddefs cal-iso disp-table oc-basic ol-eww ol-rmail ol-mhe ol-irc ol-info ol-gnus nnselect gnus-art mm-uu mml2015 mm-view mml-smime smime gnutls dig gnus-sum gnus-group gnus-undo gnus-start gnus-dbus dbus gnus-cloud nnimap nnmail mail-source utf7 nnoo gnus-spec gnus-int gnus-range message sendmail yank-media rfc822 mml mml-sec epa derived epg rfc6068 epg-config mm-decode mm-bodies mm-encode mail-parse rfc2231 rfc2047 rfc2045 ietf-drums mailabbrev gmm-utils mailheader gnus-win ol-docview doc-view jka-compr image-mode exif dired dired-loaddefs ol-bibtex bibtex ol-bbdb ol-w3m ol-doi org-link-doi org-agenda elisp-slime-nav etags fileloop paredit highlight-symbol flycheck editorconfig editorconfig-core editorconfig-core-handle editorconfig-fnmatch indent-bars-ts indent-bars cus-edit cus-start cus-load face-remap color eglot tree-widget external-completion jsonrpc flymake diff ert ewoc debug backtrace compile completion-preview which-func hideshow eww vtable url-queue shr pixel-fill kinsoku url-file svg xml puny mm-url gnus nnheader gnus-util mail-utils range wid-edit mm-util mail-prsvr tramp trampver tramp-integration tramp-message tramp-compat shell parse-time iso8601 tramp-loaddefs imenu ob-plantuml delsel autorevert filenotify embark-org org-element org-persist org-id org-refile org-element-ast inline avl-tree org ob ob-tangle ob-ref ob-lob ob-table ob-exp org-macro org-src sh-script smie executable ob-comint org-pcomplete org-list org-footnote org-faces org-entities time-date noutline outline ob-emacs-lisp ob-core ob-eval org-cycle org-table ol org-fold org-fold-core org-keys oc org-loaddefs find-func cal-menu calendar cal-loaddefs org-version org-compat org-macs poetry pyvenv eshell esh-cmd esh-ext esh-proc esh-opt esh-io esh-arg pcomplete esh-module esh-module-loaddefs esh-util embark-consult consult bookmark text-property-search embark ffap orderless all-the-icons-completion marginalia vertico nlinum linum use-package-bind-key bind-key server hl-line pixel-scroll cua-base all-the-icons all-the-icons-faces data-material data-weathericons data-octicons data-fileicons data-faicons data-alltheicons doom-modeline doom-modeline-segments doom-modeline-env doom-modeline-core shrink-path f s dash nerd-icons nerd-icons-faces nerd-icons-data nerd-icons-data-mdicon nerd-icons-data-flicon nerd-icons-data-codicon nerd-icons-data-devicon nerd-icons-data-sucicon nerd-icons-data-wicon nerd-icons-data-faicon nerd-icons-data-powerline nerd-icons-data-octicon nerd-icons-data-pomicon nerd-icons-data-ipsicon dracula-theme use-package-ensure use-package-core finder-inf all-the-icons-completion-autoloads all-the-icons-autoloads bmx-mode-autoloads cargo-autoloads cmake-mode-autoloads combobulate-autoloads combobulate-go combobulate-json combobulate-yaml combobulate-css combobulate-js-ts combobulate-python combobulate-html combobulate-toml combobulate-cursor multiple-cursors mc-separate-operations rectangular-region-mode mc-mark-pop mc-edit-lines mc-hide-unmatched-lines-mode mc-mark-more sgml-mode facemenu dom thingatpt mc-cycle-cursors multiple-cursors-core advice comp comp-cstr cl-extra help-mode warnings comp-run comp-common rect combobulate-query savehist xref files-x scheme combobulate-ui transient pp format-spec edmacro kmacro combobulate-display combobulate-ztree combobulate-envelope combobulate-manipulation python rx project compat comint ansi-osc ring ansi-color combobulate-procedure combobulate-navigation combobulate-misc combobulate-setup tempo combobulate-interface combobulate-settings diff-mode track-changes easy-mmode treesit generator combobulate-rules company-autoloads copilot-mode-autoloads crontab-mode-autoloads dap-mode-autoloads bui-autoloads doom-modeline-autoloads dracula-theme-autoloads elisp-slime-nav-autoloads embark-consult-autoloads consult-autoloads embark-autoloads expand-region-autoloads flycheck-autoloads highlight-symbol-autoloads indent-bars-autoloads lsp-docker-autoloads lsp-treemacs-autoloads lsp-mode-autoloads magit-autoloads pcase magit-section-autoloads llama-autoloads marginalia-autoloads markdown-mode-autoloads multiple-cursors-autoloads nerd-icons-autoloads nlinum-autoloads orderless-autoloads paredit-autoloads poetry-autoloads powershell-autoloads pyvenv-autoloads shrink-path-autoloads f-autoloads spinner-autoloads transient-autoloads treemacs-autoloads cfrs-autoloads posframe-autoloads ht-autoloads hydra-autoloads lv-autoloads pfuture-autoloads ace-window-autoloads avy-autoloads s-autoloads dash-autoloads undo-tree-autoloads queue-autoloads vertico-autoloads wgrep-autoloads info with-editor-autoloads wsd-mode-autoloads yaml-autoloads package browse-url xdg url url-proxy url-privacy url-expand url-methods url-history url-cookie generate-lisp-file url-domsuf url-util mailcap url-handlers url-parse auth-source cl-seq eieio eieio-core cl-macs icons password-cache json subr-x map byte-opt gv bytecomp byte-compile url-vars cl-loaddefs cl-lib rmc iso-transl tooltip cconv eldoc paren electric uniquify ediff-hook vc-hooks lisp-float-type elisp-mode mwheel term/ns-win ns-win ucs-normalize mule-util term/common-win tool-bar dnd fontset image regexp-opt fringe tabulated-list replace newcomment text-mode lisp-mode prog-mode register page tab-bar menu-bar rfn-eshadow isearch easymenu timer select scroll-bar mouse jit-lock font-lock syntax font-core term/tty-colors frame minibuffer nadvice seq simple cl-generic indonesian philippine cham georgian utf-8-lang misc-lang vietnamese tibetan thai tai-viet lao korean japanese eucjp-ms cp51932 hebrew greek romanian slovak czech european ethiopic indian cyrillic chinese composite emoji-zwj charscript charprop case-table epa-hook jka-cmpr-hook help abbrev obarray oclosure cl-preloaded button loaddefs theme-loaddefs faces cus-face macroexp files window text-properties overlay sha1 md5 base64 format env code-pages mule custom widget keymap hashtable-print-readable backquote threads kqueue cocoa ns lcms2 multi-tty make-network-process tty-child-frames native-compile emacs) Memory information: ((conses 16 1136723 236110) (symbols 48 57070 3) (strings 32 315761 12126) (string-bytes 1 9424642) (vectors 16 112250) (vector-slots 8 2121204 187375) (floats 8 1899 10828) (intervals 56 21125 6631) (buffers 992 88)) --Apple-Mail=_DCC3467D-9594-44D0-A1AF-E72761DF7A0B Content-Type: multipart/mixed; boundary="Apple-Mail=_7D2A2F88-BB78-40DB-8AAF-5DD1DFEA48D5" --Apple-Mail=_7D2A2F88-BB78-40DB-8AAF-5DD1DFEA48D5 Content-Transfer-Encoding: quoted-printable Content-Type: text/html; charset=us-ascii
Hey = everyone.

I found a bug in makefile-mode = fontification.

Currently = shell-commands/make-instructions within a target may get fontified as = make-targets if they contain a : (colon) = sign.

Consider the following = make-target:

------- Makefile = ------

run-docker: = build-docker
docker run -p 8080:8080 = imagename

--------------------------
<= div>
This defined a make-target called "run-docker" which = depends on "build-docker", which runs the command "docker run -p = 8080:8080 imagename".

In the current code, = since the command contains a ":" the whole text up to that point = ("docker run -p 8080") gets fontified as a make-target, even though it's = clearly not declared at the beginning of the = line.

Based on my digging, this seems to be due = to the matching criteria defined = in makefile-dependency-regex.

A = common pattern used in this regex is "[^\n$#]" (with slight = variations), which (from how I read regexps) aims to match anything = which is not a lineshift, a $-sign or a = #-sign.

"Anything" in this case would then also = include whitespace, which IMO is the source of the = bug.

I've tried changing this part of the = statement in parts of the regex to "[^\n\s$#]", like in the = attached patch. Ie also exclude leading whitespace. =46rom what I've = tested, it does not seem to have any adverse effects, although I may not = have tested all areas affected by this = change.

Feel free to test the suggested = changes, and let me know if they can be improved in any = way.

= --Apple-Mail=_7D2A2F88-BB78-40DB-8AAF-5DD1DFEA48D5 Content-Disposition: attachment; filename=0001-Fix-fontification-error-in-makefile-mode.patch Content-Type: application/octet-stream; x-unix-mode=0644; name="0001-Fix-fontification-error-in-makefile-mode.patch" Content-Transfer-Encoding: quoted-printable =46rom=209774fe6028b0c5341aa7bf85adf20464e9ac4b5e=20Mon=20Sep=2017=20= 00:00:00=202001=0AFrom:=20=3D?UTF-8?q?Jostein=3D20Kj=3DC3=3DB8nigsen?=3D=20= =0ADate:=20Wed,=205=20Mar=202025=2010:24:09=20= +0100=0ASubject:=20[PATCH]=20Fix=20fontification=20error=20in=20= makefile-mode.=0A=0A-=20lisp/progmodes/make-mode.el:=20= makefile-dependency-regex=0A=0AEnsure=20we=20check=20for=20leading=20= spaces=20when=20trying=20to=20match=20make-targets.=0A---=0A=20= lisp/progmodes/make-mode.el=20|=202=20+-=0A=201=20file=20changed,=201=20= insertion(+),=201=20deletion(-)=0A=0Adiff=20--git=20= a/lisp/progmodes/make-mode.el=20b/lisp/progmodes/make-mode.el=0Aindex=20= 0ae74630cff..7e0ccb0697e=20100644=0A---=20a/lisp/progmodes/make-mode.el=0A= +++=20b/lisp/progmodes/make-mode.el=0A@@=20-226,7=20+226,7=20@@=20= makefile-runtime-macros-list=0A=20;;=20index=20in=20= makefile-imenu-generic-expression.=0A=20(defvar=20= makefile-dependency-regex=0A=20=20=20;;=20Allow=20for=20two=20nested=20= levels=20$(v1:$(v2:$(v3:a=3Db)=3Dc)=3Dd)=0A-=20=20= "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[}= )]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^= \n$#:=3D]\\)+?\\)\\(:\\)\\(?:[=20\t]*$\\|[^=3D\n]\\(?:[^#\n]*?;[=20= \t]*\\(.+\\)\\)?\\)"=0A+=20=20= "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n\s$#})]+?= [})]\\)\\|[^\n\s$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n\s$#)}]\\)+?[})]\\|[^({]\\= )\\|[^\n\s$#:=3D]\\)+?\\)\\(:\\)\\(?:[=20\t]*$\\|[^=3D\n]\\(?:[^#\n]*?;[=20= \t]*\\(.+\\)\\)?\\)"=0A=20=20=20"Regex=20used=20to=20find=20dependency=20= lines=20in=20a=20makefile.")=0A=20=0A=20(defconst=20= makefile-bsdmake-dependency-regex=0A--=20=0A2.48.1=0A=0A= --Apple-Mail=_7D2A2F88-BB78-40DB-8AAF-5DD1DFEA48D5 Content-Transfer-Encoding: quoted-printable Content-Type: text/html; charset=utf-8
=E2=80=94
Kind Regards
Jostein = Kj=C3=B8nigsen


In GNU Emacs 31.0.50 (build 19, = aarch64-apple-darwin24.3.0, NS
 appkit-2575.40 Version = 15.3.1 (Build 24D70)) of 2025-03-03 built = on
 SOK67R3KWV97
Repository revision: = 38ed2238316a83ad2c95db04f115c38ade48514f
Repository branch: = master
Windowing system distributor 'Apple', version = 10.3.2575
System Description:  macOS = 15.3.1

Configured = using:
 'configure --with-tree-sitter = --with-native-compilation
 --with-imagemagick = --with-harfbuzz'

Configured = features:
ACL GLIB GNUTLS IMAGEMAGICK LCMS2 LIBXML2 MODULES = NATIVE_COMP NOTIFY
KQUEUE NS PDUMPER PNG RSVG SQLITE3 THREADS = TOOLKIT_SCROLL_BARS
TREE_SITTER WEBP XIM = ZLIB

Important settings:
  value = of $LC_ALL: en_US.UTF-8
  value of $LC_CTYPE: = UTF-8
  value of $LANG: en_US.UTF-8
  = locale-coding-system: utf-8-unix

Major mode: = BSDmakefile

Minor modes in = effect:
  treemacs-filewatch-mode: t
  = treemacs-follow-mode: t
  = treemacs-hide-gitignored-files-mode: t
  = treemacs-git-mode: t
  treemacs-fringe-indicator-mode: = t
  global-git-commit-mode: t
  = magit-auto-revert-mode: t
  electric-pair-mode: = t
  highlight-symbol-mode: t
  = flycheck-mode: t
  editorconfig-mode: t
  = indent-bars-mode: t
  completion-preview-mode: = t
  which-function-mode: t
  = delete-selection-mode: t
  global-auto-revert-mode: = t
  poetry-tracking-mode: t
  = all-the-icons-completion-mode: t
  marginalia-mode: = t
  vertico-mode: t
  global-nlinum-mode: = t
  nlinum-mode: t
  override-global-mode: = t
  server-mode: t
  global-hl-line-mode: = t
  pixel-scroll-precision-mode: t
  = doom-modeline-mode: t
  tooltip-mode: t
  = global-eldoc-mode: t
  show-paren-mode: = t
  electric-indent-mode: t
  = mouse-wheel-mode: t
  menu-bar-mode: t
  = file-name-shadow-mode: t
  global-font-lock-mode: = t
  font-lock-mode: t
  blink-cursor-mode: = t
  minibuffer-regexp-mode: t
  = column-number-mode: t
  line-number-mode: = t
  indent-tabs-mode: t
  = transient-mark-mode: t
  auto-composition-mode: = t
  auto-encryption-mode: t
  = auto-compression-mode: t
  hs-minor-mode: = t

Load-path = shadows:
/Users/josteink/.emacs.d/elpa/transient-20250301.2218/t= ransient hides = /Users/josteink/build/emacs/lisp/transient

Featur= es:
(shadow sort mail-extr emacsbug lisp-mnt re-builder = make-mode
dockerfile-ts-mode conf-mode em-unix em-term term = ehelp em-script
em-prompt em-pred em-ls em-hist em-glob = em-extpipe em-cmpl em-dirs
em-basic em-banner em-alias = esh-mode esh-var expand-region
text-mode-expansions = the-org-mode-expansions
python-el-fgallina-expansions = html-mode-expansions er-basic-expansions
expand-region-core = expand-region-custom whitespace hydra lv
treemacs-hydras = tabify treemacs-mouse-interface treemacs
treemacs-header-line = treemacs-compatibility treemacs-mode
treemacs-bookmarks = treemacs-tags treemacs-interface = treemacs-persistence
treemacs-filewatch-mode = treemacs-follow-mode treemacs-rendering
treemacs-annotations = treemacs-async treemacs-workspaces = treemacs-dom
treemacs-visuals treemacs-fringe-indicator = treemacs-faces treemacs-icons
treemacs-scope treemacs-themes = treemacs-core-utils pfuture ht
treemacs-logging = treemacs-customization treemacs-macros ido = yaml-ts-mode
display-line-numbers misearch multi-isearch = help-fns radix-tree
bicep-ts-mode magit-gitignore git-rebase = goto-addr magit-extras vc-hg
vc-bzr vc-src vc-sccs vc-svn = vc-cvs vc-rcs log-view vc bug-reference
magit-bookmark = magit-submodule magit-blame magit-stash = magit-reflog
magit-bisect magit-push magit-pull magit-fetch = magit-clone magit-remote
magit-commit magit-sequence = magit-notes magit-worktree magit-tag
magit-merge magit-branch = magit-reset magit-files magit-refs magit-status
magit = magit-repos magit-apply magit-wip magit-log magit-diff = smerge-mode
git-commit log-edit pcvs-util magit-core = magit-autorevert magit-margin
magit-transient magit-process = with-editor magit-mode benchmark magit-git
magit-base = magit-section cursor-sensor crm llama markdown-mode = add-log
elec-pair json-ts-mode vc-git vc-dispatcher = tramp-cache time-stamp
tramp-sh pulse org-duration diary-lib = diary-loaddefs cal-iso disp-table
oc-basic ol-eww ol-rmail = ol-mhe ol-irc ol-info ol-gnus nnselect gnus-art
mm-uu mml2015 = mm-view mml-smime smime gnutls dig gnus-sum = gnus-group
gnus-undo gnus-start gnus-dbus dbus gnus-cloud = nnimap nnmail mail-source
utf7 nnoo gnus-spec gnus-int = gnus-range message sendmail yank-media
rfc822 mml mml-sec epa = derived epg rfc6068 epg-config mm-decode
mm-bodies mm-encode = mail-parse rfc2231 rfc2047 rfc2045 ietf-drums
mailabbrev = gmm-utils mailheader gnus-win ol-docview doc-view = jka-compr
image-mode exif dired dired-loaddefs ol-bibtex = bibtex ol-bbdb ol-w3m
ol-doi org-link-doi org-agenda = elisp-slime-nav etags fileloop paredit
highlight-symbol = flycheck editorconfig = editorconfig-core
editorconfig-core-handle = editorconfig-fnmatch indent-bars-ts indent-bars
cus-edit = cus-start cus-load face-remap color eglot = tree-widget
external-completion jsonrpc flymake diff ert ewoc = debug backtrace
compile completion-preview which-func hideshow = eww vtable url-queue shr
pixel-fill kinsoku url-file svg xml = puny mm-url gnus nnheader gnus-util
mail-utils range wid-edit = mm-util mail-prsvr tramp trampver
tramp-integration = tramp-message tramp-compat shell parse-time = iso8601
tramp-loaddefs imenu ob-plantuml delsel autorevert = filenotify embark-org
org-element org-persist org-id = org-refile org-element-ast inline
avl-tree org ob ob-tangle = ob-ref ob-lob ob-table ob-exp org-macro
org-src sh-script smie = executable ob-comint org-pcomplete org-list
org-footnote = org-faces org-entities time-date noutline = outline
ob-emacs-lisp ob-core ob-eval org-cycle org-table ol = org-fold
org-fold-core org-keys oc org-loaddefs find-func = cal-menu calendar
cal-loaddefs org-version org-compat org-macs = poetry pyvenv eshell
esh-cmd esh-ext esh-proc esh-opt esh-io = esh-arg pcomplete esh-module
esh-module-loaddefs esh-util = embark-consult consult bookmark
text-property-search embark = ffap orderless all-the-icons-completion
marginalia vertico = nlinum linum use-package-bind-key bind-key server
hl-line = pixel-scroll cua-base all-the-icons = all-the-icons-faces
data-material data-weathericons = data-octicons data-fileicons
data-faicons data-alltheicons = doom-modeline doom-modeline-segments
doom-modeline-env = doom-modeline-core shrink-path f s dash = nerd-icons
nerd-icons-faces nerd-icons-data = nerd-icons-data-mdicon
nerd-icons-data-flicon = nerd-icons-data-codicon = nerd-icons-data-devicon
nerd-icons-data-sucicon = nerd-icons-data-wicon = nerd-icons-data-faicon
nerd-icons-data-powerline = nerd-icons-data-octicon
nerd-icons-data-pomicon = nerd-icons-data-ipsicon dracula-theme
use-package-ensure = use-package-core finder-inf
all-the-icons-completion-autoloads = all-the-icons-autoloads
bmx-mode-autoloads cargo-autoloads = cmake-mode-autoloads
combobulate-autoloads combobulate-go = combobulate-json combobulate-yaml
combobulate-css = combobulate-js-ts combobulate-python = combobulate-html
combobulate-toml combobulate-cursor = multiple-cursors
mc-separate-operations = rectangular-region-mode mc-mark-pop = mc-edit-lines
mc-hide-unmatched-lines-mode mc-mark-more = sgml-mode facemenu dom
thingatpt mc-cycle-cursors = multiple-cursors-core advice comp comp-cstr
cl-extra help-mode = warnings comp-run comp-common rect combobulate-query
savehist = xref files-x scheme combobulate-ui transient pp = format-spec
edmacro kmacro combobulate-display = combobulate-ztree
combobulate-envelope = combobulate-manipulation python rx project compat
comint = ansi-osc ring ansi-color = combobulate-procedure
combobulate-navigation combobulate-misc = combobulate-setup tempo
combobulate-interface = combobulate-settings diff-mode track-changes
easy-mmode = treesit generator combobulate-rules = company-autoloads
copilot-mode-autoloads = crontab-mode-autoloads dap-mode-autoloads
bui-autoloads = doom-modeline-autoloads = dracula-theme-autoloads
elisp-slime-nav-autoloads = embark-consult-autoloads consult-autoloads
embark-autoloads = expand-region-autoloads = flycheck-autoloads
highlight-symbol-autoloads = indent-bars-autoloads = lsp-docker-autoloads
lsp-treemacs-autoloads lsp-mode-autoloads = magit-autoloads pcase
magit-section-autoloads llama-autoloads = marginalia-autoloads
markdown-mode-autoloads = multiple-cursors-autoloads = nerd-icons-autoloads
nlinum-autoloads orderless-autoloads = paredit-autoloads poetry-autoloads
powershell-autoloads = pyvenv-autoloads shrink-path-autoloads = f-autoloads
spinner-autoloads transient-autoloads = treemacs-autoloads cfrs-autoloads
posframe-autoloads = ht-autoloads hydra-autoloads lv-autoloads
pfuture-autoloads = ace-window-autoloads avy-autoloads s-autoloads
dash-autoloads = undo-tree-autoloads queue-autoloads = vertico-autoloads
wgrep-autoloads info with-editor-autoloads = wsd-mode-autoloads
yaml-autoloads package browse-url xdg url = url-proxy url-privacy
url-expand url-methods url-history = url-cookie generate-lisp-file
url-domsuf url-util mailcap = url-handlers url-parse auth-source cl-seq
eieio eieio-core = cl-macs icons password-cache json subr-x map byte-opt
gv = bytecomp byte-compile url-vars cl-loaddefs cl-lib rmc = iso-transl
tooltip cconv eldoc paren electric uniquify = ediff-hook vc-hooks
lisp-float-type elisp-mode mwheel = term/ns-win ns-win ucs-normalize
mule-util term/common-win = tool-bar dnd fontset image regexp-opt fringe
tabulated-list = replace newcomment text-mode lisp-mode prog-mode register
page = tab-bar menu-bar rfn-eshadow isearch easymenu timer = select
scroll-bar mouse jit-lock font-lock syntax font-core = term/tty-colors
frame minibuffer nadvice seq simple cl-generic = indonesian philippine
cham georgian utf-8-lang misc-lang = vietnamese tibetan thai tai-viet lao
korean japanese eucjp-ms = cp51932 hebrew greek romanian slovak czech
european ethiopic = indian cyrillic chinese composite emoji-zwj = charscript
charprop case-table epa-hook jka-cmpr-hook help = abbrev obarray oclosure
cl-preloaded button loaddefs = theme-loaddefs faces cus-face macroexp
files window = text-properties overlay sha1 md5 base64 format env
code-pages = mule custom widget keymap hashtable-print-readable = backquote
threads kqueue cocoa ns lcms2 multi-tty = make-network-process
tty-child-frames native-compile = emacs)

Memory information:
((conses = 16 1136723 236110) (symbols 48 57070 3)
 (strings 32 = 315761 12126) (string-bytes 1 9424642)
 (vectors 16 = 112250) (vector-slots 8 2121204 187375)
 (floats 8 1899 = 10828) (intervals 56 21125 6631) (buffers 992 = 88))

= --Apple-Mail=_7D2A2F88-BB78-40DB-8AAF-5DD1DFEA48D5-- --Apple-Mail=_DCC3467D-9594-44D0-A1AF-E72761DF7A0B-- ------------=_1741573023-4241-1-- From unknown Sat Aug 09 01:12:08 2025 MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) X-Loop: help-debbugs@gnu.org From: help-debbugs@gnu.org (GNU bug Tracking System) To: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson Subject: bug#17400: closed (Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets) Message-ID: References: <87mweyl9di.fsf@jidanni.org> X-Gnu-PR-Message: they-closed 17400 X-Gnu-PR-Package: emacs X-Gnu-PR-Keywords: confirmed patch Reply-To: 17400@debbugs.gnu.org Date: Mon, 10 Mar 2025 02:17:04 +0000 Content-Type: multipart/mixed; boundary="----------=_1741573024-4241-3" This is a multi-part message in MIME format... ------------=_1741573024-4241-3 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="utf-8" Your bug report #76759: makefile mode wrong colors upon shell ':' command which was filed against the emacs package, has been closed. The explanation is attached below, along with your original report. If you require more details, please reply to 17400@debbugs.gnu.org. --=20 76759: https://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D76759 GNU Bug Tracking System Contact help-debbugs@gnu.org with problems ------------=_1741573024-4241-3 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at 76759-done) by debbugs.gnu.org; 10 Mar 2025 02:16:13 +0000 Received: from localhost ([127.0.0.1]:35280 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1trSgf-00014U-DE for submit@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:13 -0400 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:30555) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1trSgc-000147-IU for 76759-done@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:11 -0400 Received: from pmg1.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 00DB810004C; Sun, 9 Mar 2025 22:08:07 -0400 (EDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1741572486; bh=2gCWTxzhV3+OS7BQrbQBBvR/ao+UvJRf4YW3uB49t5s=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=gQ4POv+A3bjs7tLlosoDYKpH1CNnJ212j89toN8fapJ74W6Bf6Ubs5iG6nHevRa0d eRgvFCleL2MtvSXEzchignOVG+5ly2gblJL4b3XG9jZNoFY/8TU3fvgaqZpP67ztiv BlEa+sNPuWRRRI63JZ+7TgGjcYWvZoeHCRmQDP52jAumhyQz0NUMGqrTu+TykVBaHK SAdgFhjiqoLgw+fWToYWwFA83gl8DbfCEUd30QsI9FRc9lhpHqFXofCCOOgobi9a1A ePI5hm4HkSmGkC+bFVIcsXr456TCMGQxO2Q0nCjKltzqQrDSFRgavibbhy/j+gRfsF nLBj5Wn1elc4Q== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 474DC100034; Sun, 9 Mar 2025 22:08:06 -0400 (EDT) Received: from alfajor (unknown [104.247.242.5]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 047521204EE; Sun, 9 Mar 2025 22:08:05 -0400 (EDT) From: Stefan Monnier To: Jostein =?windows-1252?Q?Kj=F8nigsen?= Subject: Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets In-Reply-To: <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Message-ID: References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Date: Sun, 09 Mar 2025 22:08:04 -0400 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.299 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76759-done Cc: "Dr. Arne Babenhauserheide" , "Ergus via Emacs development discussions." , Mauro Aranda , 76759-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > Any news on this one? Looks OK, tho I think it's a bit more strict than necessary: the TABs we need to avoid can be only at the beginning of the line, so not inside the $(...). So it's only one of the [^...] that needs the \t. Here's what I did: - Start from the current monster: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[})]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Change the `\\(?:[^({]\\|.` to `\\(?:[^({]\\|[({]` because I think the `.` was just an optimization. And since the two alternatives are now mutually exclusive, swap them: \\(?:[^({]\\|.[^\n$#})]+?[})]\\) => \\(?:[({][^\n$#})]+?[})]\\|[^({]\\) - Now the regexp has become: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({][^\n$#})]+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Make the nested construction explicit, so it's a bit more manageable: (letrec ((elems-re (lambda (n &optional outer) (if (< n 1) "[^\n$#})]+?" (concat "\\(?:\\$\\(?:" "[({]" (funcall elems-re (- n 1)) "[})]" "\\|[^({]\\)" "\\|[^\n$#" (if outer ":=" ")}") "]\\)+?"))))) (concat ;; Allow for two nested levels $(v1:$(v2:$(v3:a=b)=c)=d) "^\\(" (funcall elems-re 3 'outer) "\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)")) - Disallow TABs in the outer case by replacing ":=" with "\t:=" (that's one of the TABs you added in your version of the patch). This is still not quite right, since AFAIK TABs are allowed to appear outside of $(...) as long as they're not at BOL, but I think it's better than what we've had so far (and the regexp still has several other limitations anyway). Pushed to `master`. Stefan ------------=_1741573024-4241-3 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at submit) by debbugs.gnu.org; 4 May 2014 03:21:33 +0000 Received: from localhost ([127.0.0.1]:50260 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.80) (envelope-from ) id 1Wgmzc-0000XZ-CS for submit@debbugs.gnu.org; Sat, 03 May 2014 23:21:32 -0400 Received: from eggs.gnu.org ([208.118.235.92]:55890) by debbugs.gnu.org with esmtp (Exim 4.80) (envelope-from ) id 1WgmzY-0000XE-Sq for submit@debbugs.gnu.org; Sat, 03 May 2014 23:21:29 -0400 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1WgmzM-0002cL-S5 for submit@debbugs.gnu.org; Sat, 03 May 2014 23:21:23 -0400 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=-0.3 required=5.0 tests=BAYES_00, DATE_IN_PAST_03_06, T_DKIM_INVALID autolearn=disabled version=3.3.2 Received: from lists.gnu.org ([2001:4830:134:3::11]:33362) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1WgmzM-0002cH-PA for submit@debbugs.gnu.org; Sat, 03 May 2014 23:21:16 -0400 Received: from eggs.gnu.org ([2001:4830:134:3::10]:57569) by lists.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1WgmzG-0003sc-Mq for bug-gnu-emacs@gnu.org; Sat, 03 May 2014 23:21:16 -0400 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1Wgmz9-0002Zn-Bg for bug-gnu-emacs@gnu.org; Sat, 03 May 2014 23:21:10 -0400 Received: from homie.mail.dreamhost.com ([208.97.132.208]:55599 helo=homiemail-a3.g.dreamhost.com) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1Wgmz9-0002Zf-5x for bug-gnu-emacs@gnu.org; Sat, 03 May 2014 23:21:03 -0400 Received: from homiemail-a3.g.dreamhost.com (localhost [127.0.0.1]) by homiemail-a3.g.dreamhost.com (Postfix) with ESMTP id B96AB28406E for ; Sat, 3 May 2014 20:21:02 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=jidanni.org; h=from:to :subject:date:message-id:mime-version:content-type; s= jidanni.org; bh=K2MGWof8pl+WId9auqQOueom63I=; b=AgMDO9blqZymcyqG GpnFvqx2p9DZJPYAgEsw7VSqdQ87wdQpeggCE81UvCGDzrP1wNwiK62gCLWiH5pK T2uLKXwGux2gEFQ4lbcfHeH9d5Fy58RcEySqvuEiJMuQfURMpprNm13wdrDHZ/va 7O6dC9Q7f5XF2Aonqvx4nqXtOOg= Received: from jidanni.org (122-118-149-123.dynamic.hinet.net [122.118.149.123]) (using TLSv1 with cipher AES128-SHA (128/128 bits)) (No client certificate requested) (Authenticated sender: jidanni@jidanni.org) by homiemail-a3.g.dreamhost.com (Postfix) with ESMTPSA id 86AB028406C for ; Sat, 3 May 2014 20:21:02 -0700 (PDT) From: =?utf-8?B?56mN5Li55bC8?= Dan Jacobson To: bug-gnu-emacs Subject: makefile mode wrong colors upon shell ':' command Date: Sun, 04 May 2014 07:39:53 +0800 Message-ID: <87mweyl9di.fsf@jidanni.org> MIME-Version: 1.0 Content-Type: text/plain X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.6.x X-detected-operating-system: by eggs.gnu.org: Error: Malformed IPv6 address (bad octet value). X-Received-From: 2001:4830:134:3::11 X-Spam-Score: -3.9 (---) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.15 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.9 (---) $ cat Makefile z: x||: #why is line blue? x||l #OK $ help : :: : Null command. No effect; the command does nothing. Exit Status: Always succeeds. ------------=_1741573024-4241-3-- From unknown Sat Aug 09 01:12:08 2025 MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) X-Loop: help-debbugs@gnu.org From: help-debbugs@gnu.org (GNU bug Tracking System) To: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson Subject: bug#33681: closed (Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets) Message-ID: References: <87a7lfz95s.fsf@jidanni.org> X-Gnu-PR-Message: they-closed 33681 X-Gnu-PR-Package: emacs X-Gnu-PR-Keywords: confirmed patch Reply-To: 33681@debbugs.gnu.org Date: Mon, 10 Mar 2025 02:17:04 +0000 Content-Type: multipart/mixed; boundary="----------=_1741573024-4241-5" This is a multi-part message in MIME format... ------------=_1741573024-4241-5 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="utf-8" Your bug report #76759: GNUmakefile mode thinks : in shell commands starts targets which was filed against the emacs package, has been closed. The explanation is attached below, along with your original report. If you require more details, please reply to 33681@debbugs.gnu.org. --=20 76759: https://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D76759 GNU Bug Tracking System Contact help-debbugs@gnu.org with problems ------------=_1741573024-4241-5 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at 76759-done) by debbugs.gnu.org; 10 Mar 2025 02:16:13 +0000 Received: from localhost ([127.0.0.1]:35280 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1trSgf-00014U-DE for submit@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:13 -0400 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:30555) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1trSgc-000147-IU for 76759-done@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:11 -0400 Received: from pmg1.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 00DB810004C; Sun, 9 Mar 2025 22:08:07 -0400 (EDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1741572486; bh=2gCWTxzhV3+OS7BQrbQBBvR/ao+UvJRf4YW3uB49t5s=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=gQ4POv+A3bjs7tLlosoDYKpH1CNnJ212j89toN8fapJ74W6Bf6Ubs5iG6nHevRa0d eRgvFCleL2MtvSXEzchignOVG+5ly2gblJL4b3XG9jZNoFY/8TU3fvgaqZpP67ztiv BlEa+sNPuWRRRI63JZ+7TgGjcYWvZoeHCRmQDP52jAumhyQz0NUMGqrTu+TykVBaHK SAdgFhjiqoLgw+fWToYWwFA83gl8DbfCEUd30QsI9FRc9lhpHqFXofCCOOgobi9a1A ePI5hm4HkSmGkC+bFVIcsXr456TCMGQxO2Q0nCjKltzqQrDSFRgavibbhy/j+gRfsF nLBj5Wn1elc4Q== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 474DC100034; Sun, 9 Mar 2025 22:08:06 -0400 (EDT) Received: from alfajor (unknown [104.247.242.5]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 047521204EE; Sun, 9 Mar 2025 22:08:05 -0400 (EDT) From: Stefan Monnier To: Jostein =?windows-1252?Q?Kj=F8nigsen?= Subject: Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets In-Reply-To: <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Message-ID: References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Date: Sun, 09 Mar 2025 22:08:04 -0400 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.299 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76759-done Cc: "Dr. Arne Babenhauserheide" , "Ergus via Emacs development discussions." , Mauro Aranda , 76759-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > Any news on this one? Looks OK, tho I think it's a bit more strict than necessary: the TABs we need to avoid can be only at the beginning of the line, so not inside the $(...). So it's only one of the [^...] that needs the \t. Here's what I did: - Start from the current monster: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[})]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Change the `\\(?:[^({]\\|.` to `\\(?:[^({]\\|[({]` because I think the `.` was just an optimization. And since the two alternatives are now mutually exclusive, swap them: \\(?:[^({]\\|.[^\n$#})]+?[})]\\) => \\(?:[({][^\n$#})]+?[})]\\|[^({]\\) - Now the regexp has become: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({][^\n$#})]+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Make the nested construction explicit, so it's a bit more manageable: (letrec ((elems-re (lambda (n &optional outer) (if (< n 1) "[^\n$#})]+?" (concat "\\(?:\\$\\(?:" "[({]" (funcall elems-re (- n 1)) "[})]" "\\|[^({]\\)" "\\|[^\n$#" (if outer ":=" ")}") "]\\)+?"))))) (concat ;; Allow for two nested levels $(v1:$(v2:$(v3:a=b)=c)=d) "^\\(" (funcall elems-re 3 'outer) "\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)")) - Disallow TABs in the outer case by replacing ":=" with "\t:=" (that's one of the TABs you added in your version of the patch). This is still not quite right, since AFAIK TABs are allowed to appear outside of $(...) as long as they're not at BOL, but I think it's better than what we've had so far (and the regexp still has several other limitations anyway). Pushed to `master`. Stefan ------------=_1741573024-4241-5 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at submit) by debbugs.gnu.org; 9 Dec 2018 03:11:47 +0000 Received: from localhost ([127.0.0.1]:39105 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVpVS-0005h8-Rx for submit@debbugs.gnu.org; Sat, 08 Dec 2018 22:11:47 -0500 Received: from eggs.gnu.org ([208.118.235.92]:36152) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVpVQ-0005gt-VV for submit@debbugs.gnu.org; Sat, 08 Dec 2018 22:11:45 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gVpVL-0007ta-4B for submit@debbugs.gnu.org; Sat, 08 Dec 2018 22:11:39 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=1.0 required=5.0 tests=BAYES_40,FROM_EXCESS_BASE64 autolearn=disabled version=3.3.2 Received: from lists.gnu.org ([2001:4830:134:3::11]:35397) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1gVpVK-0007tF-Eb for submit@debbugs.gnu.org; Sat, 08 Dec 2018 22:11:38 -0500 Received: from eggs.gnu.org ([2001:4830:134:3::10]:45756) by lists.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1gVpVJ-0008Pm-Hr for bug-gnu-emacs@gnu.org; Sat, 08 Dec 2018 22:11:38 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gVpVF-0007rO-JU for bug-gnu-emacs@gnu.org; Sat, 08 Dec 2018 22:11:37 -0500 Received: from purple.birch.relay.mailchannels.net ([23.83.209.150]:13371) by eggs.gnu.org with esmtps (TLS1.0:DHE_RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1gVpVF-0007qh-76 for bug-gnu-emacs@gnu.org; Sat, 08 Dec 2018 22:11:33 -0500 X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id 8F5621241E7 for ; Sun, 9 Dec 2018 03:11:31 +0000 (UTC) Received: from pdx1-sub0-mail-a58.g.dreamhost.com (unknown [100.96.36.160]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id 3F84A123C99 for ; Sun, 9 Dec 2018 03:11:31 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from pdx1-sub0-mail-a58.g.dreamhost.com (pop.dreamhost.com [64.90.62.162]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384) by 0.0.0.0:2500 (trex/5.16.2); Sun, 09 Dec 2018 03:11:31 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|jidanni@jidanni.org X-MailChannels-Auth-Id: dreamhost X-Whimsical-Celery: 1c4543c83b6f5f1b_1544325091397_2621439609 X-MC-Loop-Signature: 1544325091397:1888880296 X-MC-Ingress-Time: 1544325091397 Received: from pdx1-sub0-mail-a58.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a58.g.dreamhost.com (Postfix) with ESMTP id D1E8F80402 for ; Sat, 8 Dec 2018 19:11:30 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=jidanni.org; h=from:to :subject:date:message-id:mime-version:content-type :content-transfer-encoding; s=jidanni.org; bh=sRsU/wVwG9XHb2QUbZ 7I5t9dUG4=; b=PZbQLoSki5x/XVfvd8Gv3HlyrFqTOtqM0oCI+ULXe0Pdovyv7B KBauupM+olM1uzgCLN7enXbewOT7TZ3hlIK8uB29C7US9dYIY2J2xXrh5UtmbWRw V7yOcavFu3LFZudhIlwdh4JRIBnpjGWGAv8jF/Qe/8wVehxXobbXVwnAQ= Received: from jidanni.org (1-170-86-214.dynamic-ip.hinet.net [1.170.86.214]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: jidanni@jidanni.org) by pdx1-sub0-mail-a58.g.dreamhost.com (Postfix) with ESMTPSA id 6E1138047F for ; Sat, 8 Dec 2018 19:11:30 -0800 (PST) X-DH-BACKEND: pdx1-sub0-mail-a58 From: =?utf-8?B?56mN5Li55bC8?= Dan Jacobson To: bug-gnu-emacs@gnu.org Subject: GNUmakefile mode thinks : in shell commands starts targets Date: Sun, 09 Dec 2018 11:11:27 +0800 Message-ID: <87a7lfz95s.fsf@jidanni.org> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 X-VR-OUT-STATUS: OK X-VR-OUT-SCORE: 0 X-VR-OUT-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedtkedrudegvddgvddtucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgdpffftgfetoffjqffuvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvffufffkgggtgfesthekredttddtjeenucfhrhhomhepnjjnnjcuffgrnhculfgrtghosghsohhnuceojhhiuggrnhhnihesjhhiuggrnhhnihdrohhrgheqnecukfhppedurddujedtrdekiedrvddugeenucfrrghrrghmpehmohguvgepshhmthhppdhhvghlohepjhhiuggrnhhnihdrohhrghdpihhnvghtpedurddujedtrdekiedrvddugedprhgvthhurhhnqdhprghthheppeeruhhtfhdqkeerueerheeimhfphefnihehhegsveekreepucffrghnucflrggtohgsshhonhcuoehjihgurghnnhhisehjihgurghnnhhirdhorhhgqedpmhgrihhlfhhrohhmpehjihgurghnnhhisehjihgurghnnhhirdhorhhgpdhnrhgtphhtthhopegsuhhgqdhgnhhuqdgvmhgrtghssehgnhhurdhorhhgnecuvehluhhsthgvrhfuihiivgeptd Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] [fuzzy] X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.6.x X-Received-From: 2001:4830:134:3::11 X-Spam-Score: -4.0 (----) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -5.0 (-----) Can you believe "echo a ||" is shown in face (makefile-targets) $ cat Makefile x: echo a || : echo b in GNUmakefile mode defined in =E2=80=98make-mode.el=E2=80=99. emacs-version "25.2.2" ------------=_1741573024-4241-5-- From unknown Sat Aug 09 01:12:08 2025 MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) X-Loop: help-debbugs@gnu.org From: help-debbugs@gnu.org (GNU bug Tracking System) To: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson Subject: bug#33900: closed (Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets) Message-ID: References: <87h8ex6uex.fsf@jidanni.org> X-Gnu-PR-Message: they-closed 33900 X-Gnu-PR-Package: emacs X-Gnu-PR-Keywords: confirmed patch Reply-To: 33900@debbugs.gnu.org Date: Mon, 10 Mar 2025 02:17:05 +0000 Content-Type: multipart/mixed; boundary="----------=_1741573025-4241-7" This is a multi-part message in MIME format... ------------=_1741573025-4241-7 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="utf-8" Your bug report #76759: GNUmakefile mode colors fooled by colons in shell commands which was filed against the emacs package, has been closed. The explanation is attached below, along with your original report. If you require more details, please reply to 33900@debbugs.gnu.org. --=20 76759: https://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D76759 GNU Bug Tracking System Contact help-debbugs@gnu.org with problems ------------=_1741573025-4241-7 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at 76759-done) by debbugs.gnu.org; 10 Mar 2025 02:16:13 +0000 Received: from localhost ([127.0.0.1]:35280 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1trSgf-00014U-DE for submit@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:13 -0400 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:30555) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1trSgc-000147-IU for 76759-done@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:11 -0400 Received: from pmg1.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 00DB810004C; Sun, 9 Mar 2025 22:08:07 -0400 (EDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1741572486; bh=2gCWTxzhV3+OS7BQrbQBBvR/ao+UvJRf4YW3uB49t5s=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=gQ4POv+A3bjs7tLlosoDYKpH1CNnJ212j89toN8fapJ74W6Bf6Ubs5iG6nHevRa0d eRgvFCleL2MtvSXEzchignOVG+5ly2gblJL4b3XG9jZNoFY/8TU3fvgaqZpP67ztiv BlEa+sNPuWRRRI63JZ+7TgGjcYWvZoeHCRmQDP52jAumhyQz0NUMGqrTu+TykVBaHK SAdgFhjiqoLgw+fWToYWwFA83gl8DbfCEUd30QsI9FRc9lhpHqFXofCCOOgobi9a1A ePI5hm4HkSmGkC+bFVIcsXr456TCMGQxO2Q0nCjKltzqQrDSFRgavibbhy/j+gRfsF nLBj5Wn1elc4Q== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 474DC100034; Sun, 9 Mar 2025 22:08:06 -0400 (EDT) Received: from alfajor (unknown [104.247.242.5]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 047521204EE; Sun, 9 Mar 2025 22:08:05 -0400 (EDT) From: Stefan Monnier To: Jostein =?windows-1252?Q?Kj=F8nigsen?= Subject: Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets In-Reply-To: <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Message-ID: References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Date: Sun, 09 Mar 2025 22:08:04 -0400 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.299 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76759-done Cc: "Dr. Arne Babenhauserheide" , "Ergus via Emacs development discussions." , Mauro Aranda , 76759-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > Any news on this one? Looks OK, tho I think it's a bit more strict than necessary: the TABs we need to avoid can be only at the beginning of the line, so not inside the $(...). So it's only one of the [^...] that needs the \t. Here's what I did: - Start from the current monster: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[})]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Change the `\\(?:[^({]\\|.` to `\\(?:[^({]\\|[({]` because I think the `.` was just an optimization. And since the two alternatives are now mutually exclusive, swap them: \\(?:[^({]\\|.[^\n$#})]+?[})]\\) => \\(?:[({][^\n$#})]+?[})]\\|[^({]\\) - Now the regexp has become: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({][^\n$#})]+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Make the nested construction explicit, so it's a bit more manageable: (letrec ((elems-re (lambda (n &optional outer) (if (< n 1) "[^\n$#})]+?" (concat "\\(?:\\$\\(?:" "[({]" (funcall elems-re (- n 1)) "[})]" "\\|[^({]\\)" "\\|[^\n$#" (if outer ":=" ")}") "]\\)+?"))))) (concat ;; Allow for two nested levels $(v1:$(v2:$(v3:a=b)=c)=d) "^\\(" (funcall elems-re 3 'outer) "\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)")) - Disallow TABs in the outer case by replacing ":=" with "\t:=" (that's one of the TABs you added in your version of the patch). This is still not quite right, since AFAIK TABs are allowed to appear outside of $(...) as long as they're not at BOL, but I think it's better than what we've had so far (and the regexp still has several other limitations anyway). Pushed to `master`. Stefan ------------=_1741573025-4241-7 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at submit) by debbugs.gnu.org; 29 Dec 2018 05:44:19 +0000 Received: from localhost ([127.0.0.1]:40792 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gd7Q2-0002Fe-PK for submit@debbugs.gnu.org; Sat, 29 Dec 2018 00:44:18 -0500 Received: from eggs.gnu.org ([208.118.235.92]:59091) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gd7Q0-0002FP-Lc for submit@debbugs.gnu.org; Sat, 29 Dec 2018 00:44:17 -0500 Received: from lists.gnu.org ([208.118.235.17]:46307) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1gd7Pv-0006sm-Bq for submit@debbugs.gnu.org; Sat, 29 Dec 2018 00:44:11 -0500 Received: from eggs.gnu.org ([208.118.235.92]:55713) by lists.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1gd7Ps-0000yz-0q for bug-gnu-emacs@gnu.org; Sat, 29 Dec 2018 00:44:11 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: *** X-Spam-Status: No, score=3.4 required=5.0 tests=BAYES_50,DATE_IN_PAST_03_06, FROM_EXCESS_BASE64,RCVD_IN_DNSWL_NONE autolearn=disabled version=3.3.2 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gd7Ct-0005Gc-65 for bug-gnu-emacs@gnu.org; Sat, 29 Dec 2018 00:30:47 -0500 Received: from goldenrod.birch.relay.mailchannels.net ([23.83.209.74]:6814) by eggs.gnu.org with esmtps (TLS1.0:DHE_RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1gd7Cs-0005EF-Qv for bug-gnu-emacs@gnu.org; Sat, 29 Dec 2018 00:30:43 -0500 X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id 634881242E0 for ; Sat, 29 Dec 2018 05:30:39 +0000 (UTC) Received: from pdx1-sub0-mail-a45.g.dreamhost.com (unknown [100.96.33.121]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id 11B321247AA for ; Sat, 29 Dec 2018 05:30:39 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from pdx1-sub0-mail-a45.g.dreamhost.com (pop.dreamhost.com [64.90.62.162]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384) by 0.0.0.0:2500 (trex/5.16.2); Sat, 29 Dec 2018 05:30:39 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|jidanni@jidanni.org X-MailChannels-Auth-Id: dreamhost X-Blushing-Broad: 77344d0d7b1ec7eb_1546061439221_2042137537 X-MC-Loop-Signature: 1546061439221:1781281392 X-MC-Ingress-Time: 1546061439221 Received: from pdx1-sub0-mail-a45.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a45.g.dreamhost.com (Postfix) with ESMTP id A3BAE803AB for ; Fri, 28 Dec 2018 21:30:38 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=jidanni.org; h=from:to :subject:date:message-id:mime-version:content-type; s= jidanni.org; bh=aptEoJeM8kNFTcmOSv0snVYV/CY=; b=OHVPmEfy6Niy/Umn 2IK+i668XcNISBRwKR7ecHT0LHZ4dIFI0q9P6xlZe64n2RjOvSY4BLOvqP2eUXtl mUz+y0TUJx0oLw3uTB6aueNFtLJjKD9SPhBF8gfa3KG0YK10Wp+eYdBuq3KIhr4f bQZGhhDSFOCT6xvX2T1BWybQzKw= Received: from jidanni.org (39-9-100-233.adsl.fetnet.net [39.9.100.233]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: jidanni@jidanni.org) by pdx1-sub0-mail-a45.g.dreamhost.com (Postfix) with ESMTPSA id BEDC5803A5 for ; Fri, 28 Dec 2018 21:30:36 -0800 (PST) X-DH-BACKEND: pdx1-sub0-mail-a45 From: =?utf-8?B?56mN5Li55bC8?= Dan Jacobson To: bug-gnu-emacs@gnu.org Subject: GNUmakefile mode colors fooled by colons in shell commands Date: Sat, 29 Dec 2018 08:36:22 +0800 Message-ID: <87h8ex6uex.fsf@jidanni.org> MIME-Version: 1.0 Content-Type: text/plain X-VR-OUT-STATUS: OK X-VR-OUT-SCORE: 0 X-VR-OUT-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedtledrtdejgdejkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucggtfgfnhhsuhgsshgtrhhisggvpdfftffgtefojffquffvnecuuegrihhlohhuthemuceftddtnecunecujfgurhephffvufffkfggtgesthdtredttddtjeenucfhrhhomhepnjjnnjcuffgrnhculfgrtghosghsohhnuceojhhiuggrnhhnihesjhhiuggrnhhnihdrohhrgheqnecuffhomhgrihhnpegvgigrmhhplhgvrdgtohhmnecukfhppeefledrledruddttddrvdeffeenucfrrghrrghmpehmohguvgepshhmthhppdhhvghlohepjhhiuggrnhhnihdrohhrghdpihhnvghtpeefledrledruddttddrvdeffedprhgvthhurhhnqdhprghthheppeeruhhtfhdqkeerueerheeimhfphefnihehhegsveekreepucffrghnucflrggtohgsshhonhcuoehjihgurghnnhhisehjihgurghnnhhirdhorhhgqedpmhgrihhlfhhrohhmpehjihgurghnnhhisehjihgurghnnhhirdhorhhgpdhnrhgtphhtthhopegsuhhgqdhgnhhuqdgvmhgrtghssehgnhhurdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] [fuzzy] X-Received-From: 23.83.209.74 X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.6.x X-Spam-Score: -2.9 (--) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.9 (---) $ cat Makefile U=https://www.example.com//forum.php?mod=forumdisplay all:new if ! test -f old; then touch old; fi diff old new > $T || : if test -s $T; then cat $T; echo https://www.example.com/; fi mv new old $ emacs -q Makefile See the weird colors caused by colons etc. on these lines? 1 U=https://www.example.com//forum.php?mod=forumdisplay 4 diff old new > $T || : 5 if test -s $T; then cat $T; echo https://www.example.com/; fi emacs-version "26.1" ------------=_1741573025-4241-7-- From unknown Sat Aug 09 01:12:08 2025 MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) X-Loop: help-debbugs@gnu.org From: help-debbugs@gnu.org (GNU bug Tracking System) To: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson Subject: bug#35299: closed (Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets) Message-ID: References: <87o955vjjl.8.fsf@jidanni.org> X-Gnu-PR-Message: they-closed 35299 X-Gnu-PR-Package: emacs X-Gnu-PR-Keywords: confirmed patch Reply-To: 35299@debbugs.gnu.org Date: Mon, 10 Mar 2025 02:17:05 +0000 Content-Type: multipart/mixed; boundary="----------=_1741573025-4241-9" This is a multi-part message in MIME format... ------------=_1741573025-4241-9 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="utf-8" Your bug report #76759: GNUmakefile mode wrong color sometime beyond TAB which was filed against the emacs package, has been closed. The explanation is attached below, along with your original report. If you require more details, please reply to 35299@debbugs.gnu.org. --=20 76759: https://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D76759 GNU Bug Tracking System Contact help-debbugs@gnu.org with problems ------------=_1741573025-4241-9 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at 76759-done) by debbugs.gnu.org; 10 Mar 2025 02:16:13 +0000 Received: from localhost ([127.0.0.1]:35280 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1trSgf-00014U-DE for submit@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:13 -0400 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:30555) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1trSgc-000147-IU for 76759-done@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:11 -0400 Received: from pmg1.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 00DB810004C; Sun, 9 Mar 2025 22:08:07 -0400 (EDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1741572486; bh=2gCWTxzhV3+OS7BQrbQBBvR/ao+UvJRf4YW3uB49t5s=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=gQ4POv+A3bjs7tLlosoDYKpH1CNnJ212j89toN8fapJ74W6Bf6Ubs5iG6nHevRa0d eRgvFCleL2MtvSXEzchignOVG+5ly2gblJL4b3XG9jZNoFY/8TU3fvgaqZpP67ztiv BlEa+sNPuWRRRI63JZ+7TgGjcYWvZoeHCRmQDP52jAumhyQz0NUMGqrTu+TykVBaHK SAdgFhjiqoLgw+fWToYWwFA83gl8DbfCEUd30QsI9FRc9lhpHqFXofCCOOgobi9a1A ePI5hm4HkSmGkC+bFVIcsXr456TCMGQxO2Q0nCjKltzqQrDSFRgavibbhy/j+gRfsF nLBj5Wn1elc4Q== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 474DC100034; Sun, 9 Mar 2025 22:08:06 -0400 (EDT) Received: from alfajor (unknown [104.247.242.5]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 047521204EE; Sun, 9 Mar 2025 22:08:05 -0400 (EDT) From: Stefan Monnier To: Jostein =?windows-1252?Q?Kj=F8nigsen?= Subject: Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets In-Reply-To: <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Message-ID: References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Date: Sun, 09 Mar 2025 22:08:04 -0400 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.299 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76759-done Cc: "Dr. Arne Babenhauserheide" , "Ergus via Emacs development discussions." , Mauro Aranda , 76759-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > Any news on this one? Looks OK, tho I think it's a bit more strict than necessary: the TABs we need to avoid can be only at the beginning of the line, so not inside the $(...). So it's only one of the [^...] that needs the \t. Here's what I did: - Start from the current monster: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[})]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Change the `\\(?:[^({]\\|.` to `\\(?:[^({]\\|[({]` because I think the `.` was just an optimization. And since the two alternatives are now mutually exclusive, swap them: \\(?:[^({]\\|.[^\n$#})]+?[})]\\) => \\(?:[({][^\n$#})]+?[})]\\|[^({]\\) - Now the regexp has become: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({][^\n$#})]+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Make the nested construction explicit, so it's a bit more manageable: (letrec ((elems-re (lambda (n &optional outer) (if (< n 1) "[^\n$#})]+?" (concat "\\(?:\\$\\(?:" "[({]" (funcall elems-re (- n 1)) "[})]" "\\|[^({]\\)" "\\|[^\n$#" (if outer ":=" ")}") "]\\)+?"))))) (concat ;; Allow for two nested levels $(v1:$(v2:$(v3:a=b)=c)=d) "^\\(" (funcall elems-re 3 'outer) "\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)")) - Disallow TABs in the outer case by replacing ":=" with "\t:=" (that's one of the TABs you added in your version of the patch). This is still not quite right, since AFAIK TABs are allowed to appear outside of $(...) as long as they're not at BOL, but I think it's better than what we've had so far (and the regexp still has several other limitations anyway). Pushed to `master`. Stefan ------------=_1741573025-4241-9 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at submit) by debbugs.gnu.org; 16 Apr 2019 19:26:37 +0000 Received: from localhost ([127.0.0.1]:38013 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hGTj3-0000gd-9r for submit@debbugs.gnu.org; Tue, 16 Apr 2019 15:26:37 -0400 Received: from eggs.gnu.org ([209.51.188.92]:50181) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hGTj1-0000gR-KQ for submit@debbugs.gnu.org; Tue, 16 Apr 2019 15:26:36 -0400 Received: from lists.gnu.org ([209.51.188.17]:45909) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1hGTiv-00074i-6u for submit@debbugs.gnu.org; Tue, 16 Apr 2019 15:26:29 -0400 Received: from eggs.gnu.org ([209.51.188.92]:36317) by lists.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1hGTiu-0007ji-1F for bug-gnu-emacs@gnu.org; Tue, 16 Apr 2019 15:26:28 -0400 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: * X-Spam-Status: No, score=1.8 required=5.0 tests=BAYES_50,FROM_EXCESS_BASE64, RCVD_IN_DNSWL_NONE,URIBL_BLOCKED autolearn=disabled version=3.3.2 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1hGTis-00073H-Vd for bug-gnu-emacs@gnu.org; Tue, 16 Apr 2019 15:26:27 -0400 Received: from cichlid.maple.relay.mailchannels.net ([23.83.214.36]:11737) by eggs.gnu.org with esmtps (TLS1.0:DHE_RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1hGTip-0006xj-Dr for bug-gnu-emacs@gnu.org; Tue, 16 Apr 2019 15:26:25 -0400 X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id 4EB535E265D for ; Tue, 16 Apr 2019 19:26:17 +0000 (UTC) Received: from pdx1-sub0-mail-a40.g.dreamhost.com (100-96-7-60.trex.outbound.svc.cluster.local [100.96.7.60]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id 3F6635E21AC for ; Tue, 16 Apr 2019 19:26:16 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from pdx1-sub0-mail-a40.g.dreamhost.com ([TEMPUNAVAIL]. [64.90.62.162]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384) by 0.0.0.0:2500 (trex/5.17.2); Tue, 16 Apr 2019 19:26:17 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|jidanni@jidanni.org X-MailChannels-Auth-Id: dreamhost X-White-Quick: 552d3700020a13bb_1555442776582_569505619 X-MC-Loop-Signature: 1555442776582:2850494359 X-MC-Ingress-Time: 1555442776581 Received: from pdx1-sub0-mail-a40.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a40.g.dreamhost.com (Postfix) with ESMTP id D38A580008 for ; Tue, 16 Apr 2019 12:26:10 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=jidanni.org; h=from:to :subject:date:message-id:mime-version:content-type; s= jidanni.org; bh=skbbVhTBGfSOBiVHRycX60XX1rM=; b=RLvn54mim8cPACs/ gTptbHnNri26GWDnAeu3vjky7v+4qd+cnZZtyR5+CTsDuWqBBibQD2m1FQRqyBgr k4fCICMfVcYBxls2nuz6nFeIGPlFyVImGRd3WVk24VaGvMq3SZqaeTeUHJlMgxLB OFbGgv49ghkvR8rVWHjWhHTHmCc= Received: from jidanni.org (220-140-7-151.dynamic-ip.hinet.net [220.140.7.151]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: jidanni@jidanni.org) by pdx1-sub0-mail-a40.g.dreamhost.com (Postfix) with ESMTPSA id 4733B80019 for ; Tue, 16 Apr 2019 12:26:10 -0700 (PDT) X-DH-BACKEND: pdx1-sub0-mail-a40 From: =?utf-8?B?56mN5Li55bC8?= Dan Jacobson To: bug-gnu-emacs@gnu.org Subject: GNUmakefile mode wrong color sometime beyond TAB Date: Wed, 17 Apr 2019 03:26:06 +0800 Message-ID: <87o955vjjl.8.fsf@jidanni.org> MIME-Version: 1.0 Content-Type: text/plain X-VR-OUT-STATUS: OK X-VR-OUT-SCORE: 0 X-VR-OUT-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduuddrfedugddufeekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgdpffftgfetoffjqffuvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvffufffkgggtsehttdertddttdejnecuhfhrohhmpejnnjjnucffrghnucflrggtohgsshhonhcuoehjihgurghnnhhisehjihgurghnnhhirdhorhhgqeenucfkphepvddvtddrudegtddrjedrudehudenucfrrghrrghmpehmohguvgepshhmthhppdhhvghlohepjhhiuggrnhhnihdrohhrghdpihhnvghtpedvvddtrddugedtrdejrdduhedupdhrvghtuhhrnhdqphgrthhhpeeprehuthhfqdekreeureehiehmpfehnfhiheehsgevkeerpecuffgrnhculfgrtghosghsohhnuceojhhiuggrnhhnihesjhhiuggrnhhnihdrohhrgheqpdhmrghilhhfrhhomhepjhhiuggrnhhnihesjhhiuggrnhhnihdrohhrghdpnhhrtghpthhtohepsghughdqghhnuhdqvghmrggtshesghhnuhdrohhrghenucevlhhushhtvghrufhiiigvpedt X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Received-From: 23.83.214.36 X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.6.x X-Spam-Score: -1.3 (-) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.3 (--) $ cat Makefile external_robots: mech-dump --links index.html|perl -nwle 'next unless m!http://[^/]+/!; print $$& . "robots.txt"'|xargs -n 1 wwwoffle scp: set -x -- $$(find * -type f -cmin -$${min-111}); for i do $${TEST} scp $$i $J:$J/$$i; done $ emacs Makefile The last line is mostly blue! ------------=_1741573025-4241-9-- From unknown Sat Aug 09 01:12:08 2025 MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) X-Loop: help-debbugs@gnu.org From: help-debbugs@gnu.org (GNU bug Tracking System) To: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson Subject: bug#36245: closed (Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets) Message-ID: References: <87tvcpfvu5.5.fsf@jidanni.org> X-Gnu-PR-Message: they-closed 36245 X-Gnu-PR-Package: emacs X-Gnu-PR-Keywords: confirmed patch Reply-To: 36245@debbugs.gnu.org Date: Mon, 10 Mar 2025 02:17:06 +0000 Content-Type: multipart/mixed; boundary="----------=_1741573026-4241-11" This is a multi-part message in MIME format... ------------=_1741573026-4241-11 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="utf-8" Your bug report #76759: GNUmakefile mode colors vs. colons in shell lines which was filed against the emacs package, has been closed. The explanation is attached below, along with your original report. If you require more details, please reply to 36245@debbugs.gnu.org. --=20 76759: https://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D76759 GNU Bug Tracking System Contact help-debbugs@gnu.org with problems ------------=_1741573026-4241-11 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at 76759-done) by debbugs.gnu.org; 10 Mar 2025 02:16:13 +0000 Received: from localhost ([127.0.0.1]:35280 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1trSgf-00014U-DE for submit@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:13 -0400 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:30555) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1trSgc-000147-IU for 76759-done@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:11 -0400 Received: from pmg1.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 00DB810004C; Sun, 9 Mar 2025 22:08:07 -0400 (EDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1741572486; bh=2gCWTxzhV3+OS7BQrbQBBvR/ao+UvJRf4YW3uB49t5s=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=gQ4POv+A3bjs7tLlosoDYKpH1CNnJ212j89toN8fapJ74W6Bf6Ubs5iG6nHevRa0d eRgvFCleL2MtvSXEzchignOVG+5ly2gblJL4b3XG9jZNoFY/8TU3fvgaqZpP67ztiv BlEa+sNPuWRRRI63JZ+7TgGjcYWvZoeHCRmQDP52jAumhyQz0NUMGqrTu+TykVBaHK SAdgFhjiqoLgw+fWToYWwFA83gl8DbfCEUd30QsI9FRc9lhpHqFXofCCOOgobi9a1A ePI5hm4HkSmGkC+bFVIcsXr456TCMGQxO2Q0nCjKltzqQrDSFRgavibbhy/j+gRfsF nLBj5Wn1elc4Q== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 474DC100034; Sun, 9 Mar 2025 22:08:06 -0400 (EDT) Received: from alfajor (unknown [104.247.242.5]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 047521204EE; Sun, 9 Mar 2025 22:08:05 -0400 (EDT) From: Stefan Monnier To: Jostein =?windows-1252?Q?Kj=F8nigsen?= Subject: Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets In-Reply-To: <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Message-ID: References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Date: Sun, 09 Mar 2025 22:08:04 -0400 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.299 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76759-done Cc: "Dr. Arne Babenhauserheide" , "Ergus via Emacs development discussions." , Mauro Aranda , 76759-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > Any news on this one? Looks OK, tho I think it's a bit more strict than necessary: the TABs we need to avoid can be only at the beginning of the line, so not inside the $(...). So it's only one of the [^...] that needs the \t. Here's what I did: - Start from the current monster: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[})]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Change the `\\(?:[^({]\\|.` to `\\(?:[^({]\\|[({]` because I think the `.` was just an optimization. And since the two alternatives are now mutually exclusive, swap them: \\(?:[^({]\\|.[^\n$#})]+?[})]\\) => \\(?:[({][^\n$#})]+?[})]\\|[^({]\\) - Now the regexp has become: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({][^\n$#})]+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Make the nested construction explicit, so it's a bit more manageable: (letrec ((elems-re (lambda (n &optional outer) (if (< n 1) "[^\n$#})]+?" (concat "\\(?:\\$\\(?:" "[({]" (funcall elems-re (- n 1)) "[})]" "\\|[^({]\\)" "\\|[^\n$#" (if outer ":=" ")}") "]\\)+?"))))) (concat ;; Allow for two nested levels $(v1:$(v2:$(v3:a=b)=c)=d) "^\\(" (funcall elems-re 3 'outer) "\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)")) - Disallow TABs in the outer case by replacing ":=" with "\t:=" (that's one of the TABs you added in your version of the patch). This is still not quite right, since AFAIK TABs are allowed to appear outside of $(...) as long as they're not at BOL, but I think it's better than what we've had so far (and the regexp still has several other limitations anyway). Pushed to `master`. Stefan ------------=_1741573026-4241-11 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at submit) by debbugs.gnu.org; 16 Jun 2019 14:28:59 +0000 Received: from localhost ([127.0.0.1]:41228 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hcW9T-0000Op-Ka for submit@debbugs.gnu.org; Sun, 16 Jun 2019 10:28:59 -0400 Received: from lists.gnu.org ([209.51.188.17]:38523) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hcW9S-0000Oh-GP for submit@debbugs.gnu.org; Sun, 16 Jun 2019 10:28:59 -0400 Received: from eggs.gnu.org ([2001:470:142:3::10]:36296) by lists.gnu.org with esmtp (Exim 4.86_2) (envelope-from ) id 1hcW9R-00058C-CT for bug-gnu-emacs@gnu.org; Sun, 16 Jun 2019 10:28:58 -0400 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=0.8 required=5.0 tests=BAYES_50,FROM_EXCESS_BASE64, RCVD_IN_DNSWL_NONE,URIBL_BLOCKED autolearn=disabled version=3.3.2 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1hcW9Q-0002Gs-8k for bug-gnu-emacs@gnu.org; Sun, 16 Jun 2019 10:28:57 -0400 Received: from fossa.birch.relay.mailchannels.net ([23.83.209.62]:7787) by eggs.gnu.org with esmtps (TLS1.0:DHE_RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1hcW9O-00021m-Q5 for bug-gnu-emacs@gnu.org; Sun, 16 Jun 2019 10:28:56 -0400 X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id DFDF050152F for ; Sun, 16 Jun 2019 14:28:42 +0000 (UTC) Received: from pdx1-sub0-mail-a76.g.dreamhost.com (100-96-4-95.trex.outbound.svc.cluster.local [100.96.4.95]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id 5C6B25014CF for ; Sun, 16 Jun 2019 14:28:42 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from pdx1-sub0-mail-a76.g.dreamhost.com ([TEMPUNAVAIL]. [64.90.62.162]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384) by 0.0.0.0:2500 (trex/5.17.2); Sun, 16 Jun 2019 14:28:42 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|jidanni@jidanni.org X-MailChannels-Auth-Id: dreamhost X-Imminent-White: 7b0a8e4e276e9f79_1560695322657_1488063031 X-MC-Loop-Signature: 1560695322657:905505759 X-MC-Ingress-Time: 1560695322657 Received: from pdx1-sub0-mail-a76.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a76.g.dreamhost.com (Postfix) with ESMTP id 6576E80714 for ; Sun, 16 Jun 2019 07:28:38 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=jidanni.org; h=from:to :subject:date:message-id:mime-version:content-type; s= jidanni.org; bh=2wx2X6zc7ZHAIHv6QX9WPsYrfW0=; b=DPf0yT2lYNmyySnE WBTHP0iUBbWPNGCtjfIkciJ5TSfRwVANBNpwkoSAIL87w+2uU8Vx1mD2j52Nr6Af xFNnFr3C4gIdS81zHqnQpAv8FLcRXGTZ4boA9Vas2ajq7GY4pM+XJMBuhPpfteVO qJj2jlFVImdw/egPOFsQMw9uuiM= Received: from jidanni.org (114-41-25-125.dynamic-ip.hinet.net [114.41.25.125]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: jidanni@jidanni.org) by pdx1-sub0-mail-a76.g.dreamhost.com (Postfix) with ESMTPSA id E103780719 for ; Sun, 16 Jun 2019 07:28:37 -0700 (PDT) X-DH-BACKEND: pdx1-sub0-mail-a76 From: =?utf-8?B?56mN5Li55bC8?= Dan Jacobson To: bug-gnu-emacs@gnu.org Subject: GNUmakefile mode colors vs. colons in shell lines Date: Sun, 16 Jun 2019 22:28:34 +0800 Message-ID: <87tvcpfvu5.5.fsf@jidanni.org> MIME-Version: 1.0 Content-Type: text/plain X-VR-OUT-STATUS: OK X-VR-OUT-SCORE: 0 X-VR-OUT-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduuddrudeihedgkeduucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgdpffftgfetoffjqffuvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvffufffkgggtsehttdertddttdejnecuhfhrohhmpejnnjjnucffrghnucflrggtohgsshhonhcuoehjihgurghnnhhisehjihgurghnnhhirdhorhhgqeenucfkphepuddugedrgedurddvhedruddvheenucfrrghrrghmpehmohguvgepshhmthhppdhhvghlohepjhhiuggrnhhnihdrohhrghdpihhnvghtpeduudegrdeguddrvdehrdduvdehpdhrvghtuhhrnhdqphgrthhhpeeprehuthhfqdekreeureehiehmpfehnfhiheehsgevkeerpecuffgrnhculfgrtghosghsohhnuceojhhiuggrnhhnihesjhhiuggrnhhnihdrohhrgheqpdhmrghilhhfrhhomhepjhhiuggrnhhnihesjhhiuggrnhhnihdrohhrghdpnhhrtghpthhtohepsghughdqghhnuhdqvghmrggtshesghhnuhdrohhrghenucevlhhushhtvghrufhiiigvpedt X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Received-From: 23.83.209.62 X-Spam-Score: -1.4 (-) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.4 (--) The colors on the second stanza are all messed up until near the end. $ cat Makefile bla: ho hum scp: set -x -- $$(find * -type f -cmin -$${min-111}); for i do $${TEST+echo} scp $$i $J:$J/$$i; done $ emacs Makefile emacs-version "26.1" ------------=_1741573026-4241-11-- From unknown Sat Aug 09 01:12:08 2025 MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) X-Loop: help-debbugs@gnu.org From: help-debbugs@gnu.org (GNU bug Tracking System) To: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson Subject: bug#37934: closed (Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets) Message-ID: References: <87ftjfybku.5.fsf@jidanni.org> X-Gnu-PR-Message: they-closed 37934 X-Gnu-PR-Package: emacs X-Gnu-PR-Keywords: confirmed patch Reply-To: 37934@debbugs.gnu.org Date: Mon, 10 Mar 2025 02:17:06 +0000 Content-Type: multipart/mixed; boundary="----------=_1741573026-4241-13" This is a multi-part message in MIME format... ------------=_1741573026-4241-13 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="utf-8" Your bug report #76759: makefile colors messed up by :// which was filed against the emacs package, has been closed. The explanation is attached below, along with your original report. If you require more details, please reply to 37934@debbugs.gnu.org. --=20 76759: https://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D76759 GNU Bug Tracking System Contact help-debbugs@gnu.org with problems ------------=_1741573026-4241-13 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at 76759-done) by debbugs.gnu.org; 10 Mar 2025 02:16:13 +0000 Received: from localhost ([127.0.0.1]:35280 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1trSgf-00014U-DE for submit@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:13 -0400 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:30555) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1trSgc-000147-IU for 76759-done@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:11 -0400 Received: from pmg1.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 00DB810004C; Sun, 9 Mar 2025 22:08:07 -0400 (EDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1741572486; bh=2gCWTxzhV3+OS7BQrbQBBvR/ao+UvJRf4YW3uB49t5s=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=gQ4POv+A3bjs7tLlosoDYKpH1CNnJ212j89toN8fapJ74W6Bf6Ubs5iG6nHevRa0d eRgvFCleL2MtvSXEzchignOVG+5ly2gblJL4b3XG9jZNoFY/8TU3fvgaqZpP67ztiv BlEa+sNPuWRRRI63JZ+7TgGjcYWvZoeHCRmQDP52jAumhyQz0NUMGqrTu+TykVBaHK SAdgFhjiqoLgw+fWToYWwFA83gl8DbfCEUd30QsI9FRc9lhpHqFXofCCOOgobi9a1A ePI5hm4HkSmGkC+bFVIcsXr456TCMGQxO2Q0nCjKltzqQrDSFRgavibbhy/j+gRfsF nLBj5Wn1elc4Q== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 474DC100034; Sun, 9 Mar 2025 22:08:06 -0400 (EDT) Received: from alfajor (unknown [104.247.242.5]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 047521204EE; Sun, 9 Mar 2025 22:08:05 -0400 (EDT) From: Stefan Monnier To: Jostein =?windows-1252?Q?Kj=F8nigsen?= Subject: Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets In-Reply-To: <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Message-ID: References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Date: Sun, 09 Mar 2025 22:08:04 -0400 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.299 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76759-done Cc: "Dr. Arne Babenhauserheide" , "Ergus via Emacs development discussions." , Mauro Aranda , 76759-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > Any news on this one? Looks OK, tho I think it's a bit more strict than necessary: the TABs we need to avoid can be only at the beginning of the line, so not inside the $(...). So it's only one of the [^...] that needs the \t. Here's what I did: - Start from the current monster: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[})]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Change the `\\(?:[^({]\\|.` to `\\(?:[^({]\\|[({]` because I think the `.` was just an optimization. And since the two alternatives are now mutually exclusive, swap them: \\(?:[^({]\\|.[^\n$#})]+?[})]\\) => \\(?:[({][^\n$#})]+?[})]\\|[^({]\\) - Now the regexp has become: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({][^\n$#})]+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Make the nested construction explicit, so it's a bit more manageable: (letrec ((elems-re (lambda (n &optional outer) (if (< n 1) "[^\n$#})]+?" (concat "\\(?:\\$\\(?:" "[({]" (funcall elems-re (- n 1)) "[})]" "\\|[^({]\\)" "\\|[^\n$#" (if outer ":=" ")}") "]\\)+?"))))) (concat ;; Allow for two nested levels $(v1:$(v2:$(v3:a=b)=c)=d) "^\\(" (funcall elems-re 3 'outer) "\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)")) - Disallow TABs in the outer case by replacing ":=" with "\t:=" (that's one of the TABs you added in your version of the patch). This is still not quite right, since AFAIK TABs are allowed to appear outside of $(...) as long as they're not at BOL, but I think it's better than what we've had so far (and the regexp still has several other limitations anyway). Pushed to `master`. Stefan ------------=_1741573026-4241-13 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at submit) by debbugs.gnu.org; 26 Oct 2019 14:06:20 +0000 Received: from localhost ([127.0.0.1]:41309 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iOMhw-0006ys-HW for submit@debbugs.gnu.org; Sat, 26 Oct 2019 10:06:20 -0400 Received: from lists.gnu.org ([209.51.188.17]:54693) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iOMhr-0006yf-Ch for submit@debbugs.gnu.org; Sat, 26 Oct 2019 10:06:19 -0400 Received: from eggs.gnu.org ([2001:470:142:3::10]:46716) by lists.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1iOMhn-00076J-Be for bug-gnu-emacs@gnu.org; Sat, 26 Oct 2019 10:06:13 -0400 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=0.8 required=5.0 tests=BAYES_50,RCVD_IN_DNSWL_NONE, URIBL_BLOCKED autolearn=disabled version=3.3.2 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1iOMhl-0001Nh-Hs for bug-gnu-emacs@gnu.org; Sat, 26 Oct 2019 10:06:10 -0400 Received: from crocodile.birch.relay.mailchannels.net ([23.83.209.45]:57805) by eggs.gnu.org with esmtps (TLS1.0:DHE_RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1iOMhk-0001LX-Hi for bug-gnu-emacs@gnu.org; Sat, 26 Oct 2019 10:06:09 -0400 X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id DA8A26A0F55 for ; Sat, 26 Oct 2019 14:06:03 +0000 (UTC) Received: from pdx1-sub0-mail-a3.g.dreamhost.com (100-96-85-194.trex.outbound.svc.cluster.local [100.96.85.194]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id 667456A10CF for ; Sat, 26 Oct 2019 14:06:03 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from pdx1-sub0-mail-a3.g.dreamhost.com ([TEMPUNAVAIL]. [64.90.62.162]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384) by 0.0.0.0:2500 (trex/5.18.5); Sat, 26 Oct 2019 14:06:03 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|jidanni@jidanni.org X-MailChannels-Auth-Id: dreamhost X-Stretch-Harmony: 6b5f749c78d9e7a7_1572098763621_2823664003 X-MC-Loop-Signature: 1572098763621:3076014183 X-MC-Ingress-Time: 1572098763620 Received: from pdx1-sub0-mail-a3.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a3.g.dreamhost.com (Postfix) with ESMTP id 1C61C91853 for ; Sat, 26 Oct 2019 07:05:58 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=jidanni.org; h=from:to :subject:date:message-id:mime-version:content-type; s= jidanni.org; bh=5EXkGH1XJBKhtbhZ0FxqkRPCejA=; b=ia0e+NlLvuF7Xqfs obStH5r1wcLETK0xK0vQklVVhBjk2mhK18OrMpbp+VR6cLnPAkfIygjIu/3U8sn2 N1QQ9hqdGhCzcX5f1q/fDPfBSWqxU9pTKMpH78HiPl4F7CDOch+vkhQq9MQPd4Nd 7tnNeOPxfe6FzMciD9Tuo7md+ts= Received: from jidanni.org (1-170-81-123.dynamic-ip.hinet.net [1.170.81.123]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: jidanni@jidanni.org) by pdx1-sub0-mail-a3.g.dreamhost.com (Postfix) with ESMTPSA id 92A2D91851 for ; Sat, 26 Oct 2019 07:05:57 -0700 (PDT) X-DH-BACKEND: pdx1-sub0-mail-a3 From: =?utf-8?B?56mN5Li55bC8?= Dan Jacobson To: bug-gnu-emacs@gnu.org Subject: makefile colors messed up by :// Date: Sat, 26 Oct 2019 19:45:37 +0800 Message-ID: <87ftjfybku.5.fsf@jidanni.org> MIME-Version: 1.0 Content-Type: text/plain X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] [fuzzy] X-Received-From: 23.83.209.45 X-Spam-Score: -1.4 (-) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.4 (--) $ cat makefile x: echo This line is the correct color. echo This line is not. Because it contains the string file:// in it. $ emacs -nw -Q makefile emacs-version "26.3" ------------=_1741573026-4241-13-- From unknown Sat Aug 09 01:12:08 2025 MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) X-Loop: help-debbugs@gnu.org From: help-debbugs@gnu.org (GNU bug Tracking System) To: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson Subject: bug#45037: closed (Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets) Message-ID: References: <87eek65pwk.5.fsf@jidanni.org> X-Gnu-PR-Message: they-closed 45037 X-Gnu-PR-Package: emacs X-Gnu-PR-Keywords: confirmed patch Reply-To: 45037@debbugs.gnu.org Date: Mon, 10 Mar 2025 02:17:07 +0000 Content-Type: multipart/mixed; boundary="----------=_1741573027-4241-15" This is a multi-part message in MIME format... ------------=_1741573027-4241-15 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="utf-8" Your bug report #76759: Makefiles ...: gets wrong color which was filed against the emacs package, has been closed. The explanation is attached below, along with your original report. If you require more details, please reply to 45037@debbugs.gnu.org. --=20 76759: https://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D76759 GNU Bug Tracking System Contact help-debbugs@gnu.org with problems ------------=_1741573027-4241-15 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at 76759-done) by debbugs.gnu.org; 10 Mar 2025 02:16:13 +0000 Received: from localhost ([127.0.0.1]:35280 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1trSgf-00014U-DE for submit@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:13 -0400 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:30555) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1trSgc-000147-IU for 76759-done@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:11 -0400 Received: from pmg1.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 00DB810004C; Sun, 9 Mar 2025 22:08:07 -0400 (EDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1741572486; bh=2gCWTxzhV3+OS7BQrbQBBvR/ao+UvJRf4YW3uB49t5s=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=gQ4POv+A3bjs7tLlosoDYKpH1CNnJ212j89toN8fapJ74W6Bf6Ubs5iG6nHevRa0d eRgvFCleL2MtvSXEzchignOVG+5ly2gblJL4b3XG9jZNoFY/8TU3fvgaqZpP67ztiv BlEa+sNPuWRRRI63JZ+7TgGjcYWvZoeHCRmQDP52jAumhyQz0NUMGqrTu+TykVBaHK SAdgFhjiqoLgw+fWToYWwFA83gl8DbfCEUd30QsI9FRc9lhpHqFXofCCOOgobi9a1A ePI5hm4HkSmGkC+bFVIcsXr456TCMGQxO2Q0nCjKltzqQrDSFRgavibbhy/j+gRfsF nLBj5Wn1elc4Q== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 474DC100034; Sun, 9 Mar 2025 22:08:06 -0400 (EDT) Received: from alfajor (unknown [104.247.242.5]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 047521204EE; Sun, 9 Mar 2025 22:08:05 -0400 (EDT) From: Stefan Monnier To: Jostein =?windows-1252?Q?Kj=F8nigsen?= Subject: Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets In-Reply-To: <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Message-ID: References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Date: Sun, 09 Mar 2025 22:08:04 -0400 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.299 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76759-done Cc: "Dr. Arne Babenhauserheide" , "Ergus via Emacs development discussions." , Mauro Aranda , 76759-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > Any news on this one? Looks OK, tho I think it's a bit more strict than necessary: the TABs we need to avoid can be only at the beginning of the line, so not inside the $(...). So it's only one of the [^...] that needs the \t. Here's what I did: - Start from the current monster: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[})]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Change the `\\(?:[^({]\\|.` to `\\(?:[^({]\\|[({]` because I think the `.` was just an optimization. And since the two alternatives are now mutually exclusive, swap them: \\(?:[^({]\\|.[^\n$#})]+?[})]\\) => \\(?:[({][^\n$#})]+?[})]\\|[^({]\\) - Now the regexp has become: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({][^\n$#})]+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Make the nested construction explicit, so it's a bit more manageable: (letrec ((elems-re (lambda (n &optional outer) (if (< n 1) "[^\n$#})]+?" (concat "\\(?:\\$\\(?:" "[({]" (funcall elems-re (- n 1)) "[})]" "\\|[^({]\\)" "\\|[^\n$#" (if outer ":=" ")}") "]\\)+?"))))) (concat ;; Allow for two nested levels $(v1:$(v2:$(v3:a=b)=c)=d) "^\\(" (funcall elems-re 3 'outer) "\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)")) - Disallow TABs in the outer case by replacing ":=" with "\t:=" (that's one of the TABs you added in your version of the patch). This is still not quite right, since AFAIK TABs are allowed to appear outside of $(...) as long as they're not at BOL, but I think it's better than what we've had so far (and the regexp still has several other limitations anyway). Pushed to `master`. Stefan ------------=_1741573027-4241-15 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at submit) by debbugs.gnu.org; 4 Dec 2020 01:25:18 +0000 Received: from localhost ([127.0.0.1]:42276 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1kkzqY-0004XG-FY for submit@debbugs.gnu.org; Thu, 03 Dec 2020 20:25:18 -0500 Received: from lists.gnu.org ([209.51.188.17]:33026) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1kkzqX-0004X7-Fm for submit@debbugs.gnu.org; Thu, 03 Dec 2020 20:25:17 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:48990) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1kkzqX-0005a3-7h for bug-gnu-emacs@gnu.org; Thu, 03 Dec 2020 20:25:17 -0500 Received: from purple.birch.relay.mailchannels.net ([23.83.209.150]:59678) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1kkzqU-0001yv-5I for bug-gnu-emacs@gnu.org; Thu, 03 Dec 2020 20:25:16 -0500 X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id 6564B48035F for ; Fri, 4 Dec 2020 01:25:10 +0000 (UTC) Received: from pdx1-sub0-mail-a38.g.dreamhost.com (100-100-138-63.trex.outbound.svc.cluster.local [100.100.138.63]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id 04D7848138D for ; Fri, 4 Dec 2020 01:25:10 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from pdx1-sub0-mail-a38.g.dreamhost.com (pop.dreamhost.com [64.90.62.162]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384) by 0.0.0.0:2500 (trex/5.18.11); Fri, 04 Dec 2020 01:25:10 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|jidanni@jidanni.org X-MailChannels-Auth-Id: dreamhost X-Obese-Language: 6705e24f3e7cbb07_1607045110235_89385780 X-MC-Loop-Signature: 1607045110235:437198381 X-MC-Ingress-Time: 1607045110235 Received: from pdx1-sub0-mail-a38.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a38.g.dreamhost.com (Postfix) with ESMTP id AC6DC7E677 for ; Thu, 3 Dec 2020 17:25:09 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=jidanni.org; h=from:to :subject:date:message-id:mime-version:content-type; s= jidanni.org; bh=iJnbl4AtUEfc8TVJZvhfQgSrCk4=; b=CsD/qhWwHrR0BnT7 O62DW/xDhqgqg+BAbKA/SVcYDoIn13lX7x1JFFazvdWXWFbQUQN6U0+khAltmj54 vaot9bKsW5FmeXTL3YOOWbriA5JKx9mctHMmC4G5+dZdPPNtbI9naLYCLsKbOF51 QcahYouqyf5evIalvl+rvxJ2E/s= Received: from jidanni.org (114-46-61-217.dynamic-ip.hinet.net [114.46.61.217]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: jidanni@jidanni.org) by pdx1-sub0-mail-a38.g.dreamhost.com (Postfix) with ESMTPSA id 0BFE585A8B for ; Thu, 3 Dec 2020 17:25:09 -0800 (PST) X-DH-BACKEND: pdx1-sub0-mail-a38 From: =?utf-8?B?56mN5Li55bC8?= Dan Jacobson To: bug-gnu-emacs@gnu.org Subject: Makefiles ...: gets wrong color Date: Fri, 04 Dec 2020 09:19:23 +0800 Message-ID: <87eek65pwk.5.fsf@jidanni.org> MIME-Version: 1.0 Content-Type: text/plain Received-SPF: pass client-ip=23.83.209.150; envelope-from=jidanni@jidanni.org; helo=purple.birch.relay.mailchannels.net X-Spam_score_int: -20 X-Spam_score: -2.1 X-Spam_bar: -- X-Spam_report: (-2.1 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, RCVD_IN_DNSWL_NONE=-0.0001, RCVD_IN_MSPIKE_H2=-0.001, SPF_HELO_NONE=0.001, SPF_PASS=-0.001 autolearn=ham autolearn_force=no X-Spam_action: no action X-Spam-Score: -1.4 (-) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.4 (--) $ cat Makefile u: for u in ha jia fen ping; do echo -n $$u:; \ units --one-line --compact $m $$u; done $ emacs -nw -Q Makefile The 'for' line is in the wrong color. Probably triggered by the colon near the end. But there is a tab at the front of the line! So it should know better. emacs-version "27.1" ------------=_1741573027-4241-15-- From unknown Sat Aug 09 01:12:08 2025 MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) X-Loop: help-debbugs@gnu.org From: help-debbugs@gnu.org (GNU bug Tracking System) To: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson Subject: bug#46052: closed (Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets) Message-ID: References: <87tur914qj.5.fsf@jidanni.org> X-Gnu-PR-Message: they-closed 46052 X-Gnu-PR-Package: emacs X-Gnu-PR-Keywords: confirmed patch Reply-To: 46052@debbugs.gnu.org Date: Mon, 10 Mar 2025 02:17:07 +0000 Content-Type: multipart/mixed; boundary="----------=_1741573027-4241-17" This is a multi-part message in MIME format... ------------=_1741573027-4241-17 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="utf-8" Your bug report #76759: Colons fooling GNUmakefile mode which was filed against the emacs package, has been closed. The explanation is attached below, along with your original report. If you require more details, please reply to 46052@debbugs.gnu.org. --=20 76759: https://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D76759 GNU Bug Tracking System Contact help-debbugs@gnu.org with problems ------------=_1741573027-4241-17 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at 76759-done) by debbugs.gnu.org; 10 Mar 2025 02:16:13 +0000 Received: from localhost ([127.0.0.1]:35280 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1trSgf-00014U-DE for submit@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:13 -0400 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:30555) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1trSgc-000147-IU for 76759-done@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:11 -0400 Received: from pmg1.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 00DB810004C; Sun, 9 Mar 2025 22:08:07 -0400 (EDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1741572486; bh=2gCWTxzhV3+OS7BQrbQBBvR/ao+UvJRf4YW3uB49t5s=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=gQ4POv+A3bjs7tLlosoDYKpH1CNnJ212j89toN8fapJ74W6Bf6Ubs5iG6nHevRa0d eRgvFCleL2MtvSXEzchignOVG+5ly2gblJL4b3XG9jZNoFY/8TU3fvgaqZpP67ztiv BlEa+sNPuWRRRI63JZ+7TgGjcYWvZoeHCRmQDP52jAumhyQz0NUMGqrTu+TykVBaHK SAdgFhjiqoLgw+fWToYWwFA83gl8DbfCEUd30QsI9FRc9lhpHqFXofCCOOgobi9a1A ePI5hm4HkSmGkC+bFVIcsXr456TCMGQxO2Q0nCjKltzqQrDSFRgavibbhy/j+gRfsF nLBj5Wn1elc4Q== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 474DC100034; Sun, 9 Mar 2025 22:08:06 -0400 (EDT) Received: from alfajor (unknown [104.247.242.5]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 047521204EE; Sun, 9 Mar 2025 22:08:05 -0400 (EDT) From: Stefan Monnier To: Jostein =?windows-1252?Q?Kj=F8nigsen?= Subject: Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets In-Reply-To: <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Message-ID: References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Date: Sun, 09 Mar 2025 22:08:04 -0400 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.299 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76759-done Cc: "Dr. Arne Babenhauserheide" , "Ergus via Emacs development discussions." , Mauro Aranda , 76759-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > Any news on this one? Looks OK, tho I think it's a bit more strict than necessary: the TABs we need to avoid can be only at the beginning of the line, so not inside the $(...). So it's only one of the [^...] that needs the \t. Here's what I did: - Start from the current monster: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[})]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Change the `\\(?:[^({]\\|.` to `\\(?:[^({]\\|[({]` because I think the `.` was just an optimization. And since the two alternatives are now mutually exclusive, swap them: \\(?:[^({]\\|.[^\n$#})]+?[})]\\) => \\(?:[({][^\n$#})]+?[})]\\|[^({]\\) - Now the regexp has become: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({][^\n$#})]+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Make the nested construction explicit, so it's a bit more manageable: (letrec ((elems-re (lambda (n &optional outer) (if (< n 1) "[^\n$#})]+?" (concat "\\(?:\\$\\(?:" "[({]" (funcall elems-re (- n 1)) "[})]" "\\|[^({]\\)" "\\|[^\n$#" (if outer ":=" ")}") "]\\)+?"))))) (concat ;; Allow for two nested levels $(v1:$(v2:$(v3:a=b)=c)=d) "^\\(" (funcall elems-re 3 'outer) "\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)")) - Disallow TABs in the outer case by replacing ":=" with "\t:=" (that's one of the TABs you added in your version of the patch). This is still not quite right, since AFAIK TABs are allowed to appear outside of $(...) as long as they're not at BOL, but I think it's better than what we've had so far (and the regexp still has several other limitations anyway). Pushed to `master`. Stefan ------------=_1741573027-4241-17 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at submit) by debbugs.gnu.org; 23 Jan 2021 12:00:48 +0000 Received: from localhost ([127.0.0.1]:33785 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1l3Hay-0006VX-9H for submit@debbugs.gnu.org; Sat, 23 Jan 2021 07:00:48 -0500 Received: from lists.gnu.org ([209.51.188.17]:42740) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1l3Haw-0006VO-MR for submit@debbugs.gnu.org; Sat, 23 Jan 2021 07:00:46 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:35590) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1l3Hau-0008MR-SK for bug-gnu-emacs@gnu.org; Sat, 23 Jan 2021 07:00:46 -0500 Received: from donkey.elm.relay.mailchannels.net ([23.83.212.49]:6000) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1l3Haq-00057b-OW for bug-gnu-emacs@gnu.org; Sat, 23 Jan 2021 07:00:43 -0500 X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id D9545102683 for ; Sat, 23 Jan 2021 12:00:36 +0000 (UTC) Received: from pdx1-sub0-mail-a9.g.dreamhost.com (100-105-161-48.trex.outbound.svc.cluster.local [100.105.161.48]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id 6C4EE102588 for ; Sat, 23 Jan 2021 12:00:36 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from pdx1-sub0-mail-a9.g.dreamhost.com (pop.dreamhost.com [64.90.62.162]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384) by 100.105.161.48 (trex/6.0.2); Sat, 23 Jan 2021 12:00:36 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|jidanni@jidanni.org X-MailChannels-Auth-Id: dreamhost X-Vacuous-Eight: 361645e4146a0a89_1611403236697_1573771922 X-MC-Loop-Signature: 1611403236696:1317489288 X-MC-Ingress-Time: 1611403236696 Received: from pdx1-sub0-mail-a9.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a9.g.dreamhost.com (Postfix) with ESMTP id 0086B7EFAE for ; Sat, 23 Jan 2021 04:00:35 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=jidanni.org; h=from:to :subject:date:message-id:mime-version:content-type; s= jidanni.org; bh=/vx1Gqs0dk1fqWWJnVSn3N7AQrg=; b=RJOBnKZTjJdoQAec k2xT2mrEmv+TtHHyZO5GNgKX5wsf/SGx3rrKNFZcRWAA55PNF9INk4gd39UD4w9R yHaWIREeAtjQe7qqIPFITu8KefJh0GM/J8v717F14VbGsTifZErjC0Ljbj9Pv+Ld 3pAcX6ZBF1ldbRRnS8sD8dIXcUE= Received: from jidanni.org (1-170-82-17.dynamic-ip.hinet.net [1.170.82.17]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: jidanni@jidanni.org) by pdx1-sub0-mail-a9.g.dreamhost.com (Postfix) with ESMTPSA id A4E607EFAA for ; Sat, 23 Jan 2021 04:00:35 -0800 (PST) X-DH-BACKEND: pdx1-sub0-mail-a9 From: =?utf-8?B?56mN5Li55bC8?= Dan Jacobson To: bug-gnu-emacs@gnu.org Subject: Colons fooling GNUmakefile mode Date: Fri, 22 Jan 2021 21:27:32 +0800 Message-ID: <87tur914qj.5.fsf@jidanni.org> MIME-Version: 1.0 Content-Type: text/plain Received-SPF: pass client-ip=23.83.212.49; envelope-from=jidanni@jidanni.org; helo=donkey.elm.relay.mailchannels.net X-Spam_score_int: -9 X-Spam_score: -1.0 X-Spam_bar: - X-Spam_report: (-1.0 / 5.0 requ) BAYES_00=-1.9, DATE_IN_PAST_12_24=1.049, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, RCVD_IN_DNSWL_NONE=-0.0001, RCVD_IN_MSPIKE_H4=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_HELO_NONE=0.001, SPF_PASS=-0.001 autolearn=no autolearn_force=no X-Spam_action: no action X-Spam-Score: -0.6 (/) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.6 (-) Colons on lines 2 and 4 shouldn't change the line color: $ cat Makefile eee: set -x; $c 11999 3555; $c 11999 3355; : set -x; $c 9999 999; $c 9999 799; set -x; $c 8499 1606; $c 8499 599; : emacs-version "27.1". Perhaps already fixed. ------------=_1741573027-4241-17-- From unknown Sat Aug 09 01:12:08 2025 MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) X-Loop: help-debbugs@gnu.org From: help-debbugs@gnu.org (GNU bug Tracking System) To: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson Subject: bug#46221: closed (Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets) Message-ID: References: <87im7c8ujq.5.fsf@jidanni.org> X-Gnu-PR-Message: they-closed 46221 X-Gnu-PR-Package: emacs X-Gnu-PR-Keywords: confirmed patch Reply-To: 46221@debbugs.gnu.org Date: Mon, 10 Mar 2025 02:17:08 +0000 Content-Type: multipart/mixed; boundary="----------=_1741573028-4241-19" This is a multi-part message in MIME format... ------------=_1741573028-4241-19 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="utf-8" Your bug report #76759: GNUmakefile mode: second colons inside variables influence colors which was filed against the emacs package, has been closed. The explanation is attached below, along with your original report. If you require more details, please reply to 46221@debbugs.gnu.org. --=20 76759: https://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D76759 GNU Bug Tracking System Contact help-debbugs@gnu.org with problems ------------=_1741573028-4241-19 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at 76759-done) by debbugs.gnu.org; 10 Mar 2025 02:16:13 +0000 Received: from localhost ([127.0.0.1]:35280 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1trSgf-00014U-DE for submit@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:13 -0400 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:30555) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1trSgc-000147-IU for 76759-done@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:11 -0400 Received: from pmg1.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 00DB810004C; Sun, 9 Mar 2025 22:08:07 -0400 (EDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1741572486; bh=2gCWTxzhV3+OS7BQrbQBBvR/ao+UvJRf4YW3uB49t5s=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=gQ4POv+A3bjs7tLlosoDYKpH1CNnJ212j89toN8fapJ74W6Bf6Ubs5iG6nHevRa0d eRgvFCleL2MtvSXEzchignOVG+5ly2gblJL4b3XG9jZNoFY/8TU3fvgaqZpP67ztiv BlEa+sNPuWRRRI63JZ+7TgGjcYWvZoeHCRmQDP52jAumhyQz0NUMGqrTu+TykVBaHK SAdgFhjiqoLgw+fWToYWwFA83gl8DbfCEUd30QsI9FRc9lhpHqFXofCCOOgobi9a1A ePI5hm4HkSmGkC+bFVIcsXr456TCMGQxO2Q0nCjKltzqQrDSFRgavibbhy/j+gRfsF nLBj5Wn1elc4Q== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 474DC100034; Sun, 9 Mar 2025 22:08:06 -0400 (EDT) Received: from alfajor (unknown [104.247.242.5]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 047521204EE; Sun, 9 Mar 2025 22:08:05 -0400 (EDT) From: Stefan Monnier To: Jostein =?windows-1252?Q?Kj=F8nigsen?= Subject: Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets In-Reply-To: <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Message-ID: References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Date: Sun, 09 Mar 2025 22:08:04 -0400 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.299 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76759-done Cc: "Dr. Arne Babenhauserheide" , "Ergus via Emacs development discussions." , Mauro Aranda , 76759-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > Any news on this one? Looks OK, tho I think it's a bit more strict than necessary: the TABs we need to avoid can be only at the beginning of the line, so not inside the $(...). So it's only one of the [^...] that needs the \t. Here's what I did: - Start from the current monster: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[})]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Change the `\\(?:[^({]\\|.` to `\\(?:[^({]\\|[({]` because I think the `.` was just an optimization. And since the two alternatives are now mutually exclusive, swap them: \\(?:[^({]\\|.[^\n$#})]+?[})]\\) => \\(?:[({][^\n$#})]+?[})]\\|[^({]\\) - Now the regexp has become: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({][^\n$#})]+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Make the nested construction explicit, so it's a bit more manageable: (letrec ((elems-re (lambda (n &optional outer) (if (< n 1) "[^\n$#})]+?" (concat "\\(?:\\$\\(?:" "[({]" (funcall elems-re (- n 1)) "[})]" "\\|[^({]\\)" "\\|[^\n$#" (if outer ":=" ")}") "]\\)+?"))))) (concat ;; Allow for two nested levels $(v1:$(v2:$(v3:a=b)=c)=d) "^\\(" (funcall elems-re 3 'outer) "\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)")) - Disallow TABs in the outer case by replacing ":=" with "\t:=" (that's one of the TABs you added in your version of the patch). This is still not quite right, since AFAIK TABs are allowed to appear outside of $(...) as long as they're not at BOL, but I think it's better than what we've had so far (and the regexp still has several other limitations anyway). Pushed to `master`. Stefan ------------=_1741573028-4241-19 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at submit) by debbugs.gnu.org; 1 Feb 2021 01:07:54 +0000 Received: from localhost ([127.0.0.1]:58377 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1l6Nh4-0005bk-35 for submit@debbugs.gnu.org; Sun, 31 Jan 2021 20:07:54 -0500 Received: from lists.gnu.org ([209.51.188.17]:49830) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1l6Nh1-0005bc-Ba for submit@debbugs.gnu.org; Sun, 31 Jan 2021 20:07:53 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:43772) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1l6Nh1-0005Gj-69 for bug-gnu-emacs@gnu.org; Sun, 31 Jan 2021 20:07:51 -0500 Received: from cyan.elm.relay.mailchannels.net ([23.83.212.47]:64865) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1l6Ngw-0001KQ-Uu for bug-gnu-emacs@gnu.org; Sun, 31 Jan 2021 20:07:50 -0500 X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id 604581E38F6 for ; Mon, 1 Feb 2021 01:07:42 +0000 (UTC) Received: from pdx1-sub0-mail-a93.g.dreamhost.com (100-96-16-7.trex.outbound.svc.cluster.local [100.96.16.7]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id 2AF2A1E1AE3 for ; Mon, 1 Feb 2021 01:07:42 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from pdx1-sub0-mail-a93.g.dreamhost.com (pop.dreamhost.com [64.90.62.162]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384) by 100.96.16.7 (trex/6.0.2); Mon, 01 Feb 2021 01:07:42 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|jidanni@jidanni.org X-MailChannels-Auth-Id: dreamhost X-Thread-Well-Made: 1cbcfe676d872cbe_1612141662214_2037721723 X-MC-Loop-Signature: 1612141662214:1583983032 X-MC-Ingress-Time: 1612141662214 Received: from pdx1-sub0-mail-a93.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a93.g.dreamhost.com (Postfix) with ESMTP id DE0DF8608F for ; Sun, 31 Jan 2021 17:07:41 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=jidanni.org; h=from:to :subject:date:message-id:mime-version:content-type; s= jidanni.org; bh=n8WZmMA4qB+WNuSqz2kCK77DpBU=; b=csqptshBqJAx1gxw p7+mRkpcIguEKH4+6n8mrYXFcuZ5BXmYwmaAlZmc4rI7KCWX6GT17wgm00+F/zjd artoGJvAL0HJbLbBrEqPIVzU7XuD34MmXWYEC199c7+kKbWhPY+7LDmArOI+zpex iEtLfblP3VVU4Bs3ALJCzcKLc6Y= Received: from jidanni.org (114-46-61-14.dynamic-ip.hinet.net [114.46.61.14]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: jidanni@jidanni.org) by pdx1-sub0-mail-a93.g.dreamhost.com (Postfix) with ESMTPSA id A8B1386088 for ; Sun, 31 Jan 2021 17:07:41 -0800 (PST) X-DH-BACKEND: pdx1-sub0-mail-a93 From: =?utf-8?B?56mN5Li55bC8?= Dan Jacobson To: bug-gnu-emacs@gnu.org Subject: GNUmakefile mode: second colons inside variables influence colors Date: Mon, 01 Feb 2021 09:07:37 +0800 Message-ID: <87im7c8ujq.5.fsf@jidanni.org> MIME-Version: 1.0 Content-Type: text/plain Received-SPF: pass client-ip=23.83.212.47; envelope-from=jidanni@jidanni.org; helo=cyan.elm.relay.mailchannels.net X-Spam_score_int: -20 X-Spam_score: -2.1 X-Spam_bar: -- X-Spam_report: (-2.1 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, RCVD_IN_DNSWL_NONE=-0.0001, RCVD_IN_MSPIKE_H2=-0.001, SPF_HELO_NONE=0.001, SPF_PASS=-0.001 autolearn=ham autolearn_force=no X-Spam_action: no action X-Spam-Score: -1.4 (-) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.4 (--) $ cat Makefile S=q=author:jidanni+commenter:nibblesburg&type=issues #............................^Funny^colors^^^...... emacs-version "27.1" ------------=_1741573028-4241-19-- From unknown Sat Aug 09 01:12:08 2025 MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) X-Loop: help-debbugs@gnu.org From: help-debbugs@gnu.org (GNU bug Tracking System) To: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson Subject: bug#48052: closed (Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets) Message-ID: References: <877dkoa8ty.5.fsf@jidanni.org> X-Gnu-PR-Message: they-closed 48052 X-Gnu-PR-Package: emacs X-Gnu-PR-Keywords: confirmed patch Reply-To: 48052@debbugs.gnu.org Date: Mon, 10 Mar 2025 02:17:09 +0000 Content-Type: multipart/mixed; boundary="----------=_1741573029-4241-21" This is a multi-part message in MIME format... ------------=_1741573029-4241-21 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="utf-8" Your bug report #76759: GNU Makefile mode vs. https:// which was filed against the emacs package, has been closed. The explanation is attached below, along with your original report. If you require more details, please reply to 48052@debbugs.gnu.org. --=20 76759: https://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D76759 GNU Bug Tracking System Contact help-debbugs@gnu.org with problems ------------=_1741573029-4241-21 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at 76759-done) by debbugs.gnu.org; 10 Mar 2025 02:16:13 +0000 Received: from localhost ([127.0.0.1]:35280 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1trSgf-00014U-DE for submit@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:13 -0400 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:30555) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1trSgc-000147-IU for 76759-done@debbugs.gnu.org; Sun, 09 Mar 2025 22:16:11 -0400 Received: from pmg1.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 00DB810004C; Sun, 9 Mar 2025 22:08:07 -0400 (EDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1741572486; bh=2gCWTxzhV3+OS7BQrbQBBvR/ao+UvJRf4YW3uB49t5s=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=gQ4POv+A3bjs7tLlosoDYKpH1CNnJ212j89toN8fapJ74W6Bf6Ubs5iG6nHevRa0d eRgvFCleL2MtvSXEzchignOVG+5ly2gblJL4b3XG9jZNoFY/8TU3fvgaqZpP67ztiv BlEa+sNPuWRRRI63JZ+7TgGjcYWvZoeHCRmQDP52jAumhyQz0NUMGqrTu+TykVBaHK SAdgFhjiqoLgw+fWToYWwFA83gl8DbfCEUd30QsI9FRc9lhpHqFXofCCOOgobi9a1A ePI5hm4HkSmGkC+bFVIcsXr456TCMGQxO2Q0nCjKltzqQrDSFRgavibbhy/j+gRfsF nLBj5Wn1elc4Q== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg1.iro.umontreal.ca (Proxmox) with ESMTP id 474DC100034; Sun, 9 Mar 2025 22:08:06 -0400 (EDT) Received: from alfajor (unknown [104.247.242.5]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 047521204EE; Sun, 9 Mar 2025 22:08:05 -0400 (EDT) From: Stefan Monnier To: Jostein =?windows-1252?Q?Kj=F8nigsen?= Subject: Re: bug#76759: [PATCH] 31.0.50; makefile-mode: incorrectly highlights make-instructions as make targets In-Reply-To: <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Message-ID: References: <140fffe4-79a9-4bff-9148-9debd208e6fc@gmail.com> <86DE0998-C0C7-403E-88E9-4272DCCFB0FD@secure.kjonigsen.net> Date: Sun, 09 Mar 2025 22:08:04 -0400 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.299 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76759-done Cc: "Dr. Arne Babenhauserheide" , "Ergus via Emacs development discussions." , Mauro Aranda , 76759-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > Any news on this one? Looks OK, tho I think it's a bit more strict than necessary: the TABs we need to avoid can be only at the beginning of the line, so not inside the $(...). So it's only one of the [^...] that needs the \t. Here's what I did: - Start from the current monster: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[^({]\\|.[^\n$#})]+?[})]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Change the `\\(?:[^({]\\|.` to `\\(?:[^({]\\|[({]` because I think the `.` was just an optimization. And since the two alternatives are now mutually exclusive, swap them: \\(?:[^({]\\|.[^\n$#})]+?[})]\\) => \\(?:[({][^\n$#})]+?[})]\\|[^({]\\) - Now the regexp has become: "^\\(\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({]\\(?:\\$\\(?:[({][^\n$#})]+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#)}]\\)+?[})]\\|[^({]\\)\\|[^\n$#:=]\\)+?\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)" - Make the nested construction explicit, so it's a bit more manageable: (letrec ((elems-re (lambda (n &optional outer) (if (< n 1) "[^\n$#})]+?" (concat "\\(?:\\$\\(?:" "[({]" (funcall elems-re (- n 1)) "[})]" "\\|[^({]\\)" "\\|[^\n$#" (if outer ":=" ")}") "]\\)+?"))))) (concat ;; Allow for two nested levels $(v1:$(v2:$(v3:a=b)=c)=d) "^\\(" (funcall elems-re 3 'outer) "\\)\\(:\\)\\(?:[ \t]*$\\|[^=\n]\\(?:[^#\n]*?;[ \t]*\\(.+\\)\\)?\\)")) - Disallow TABs in the outer case by replacing ":=" with "\t:=" (that's one of the TABs you added in your version of the patch). This is still not quite right, since AFAIK TABs are allowed to appear outside of $(...) as long as they're not at BOL, but I think it's better than what we've had so far (and the regexp still has several other limitations anyway). Pushed to `master`. Stefan ------------=_1741573029-4241-21 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at submit) by debbugs.gnu.org; 27 Apr 2021 00:07:51 +0000 Received: from localhost ([127.0.0.1]:47520 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1lbBGY-0006XK-R8 for submit@debbugs.gnu.org; Mon, 26 Apr 2021 20:07:51 -0400 Received: from lists.gnu.org ([209.51.188.17]:59808) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1lbBGV-0006XC-UI for submit@debbugs.gnu.org; Mon, 26 Apr 2021 20:07:49 -0400 Received: from eggs.gnu.org ([2001:470:142:3::10]:43082) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1lbBGV-0002DK-M0 for bug-gnu-emacs@gnu.org; Mon, 26 Apr 2021 20:07:47 -0400 Received: from beige.elm.relay.mailchannels.net ([23.83.212.16]:33581) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1lbBGS-0008K3-I7 for bug-gnu-emacs@gnu.org; Mon, 26 Apr 2021 20:07:47 -0400 X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id B6924483091 for ; Tue, 27 Apr 2021 00:07:41 +0000 (UTC) Received: from pdx1-sub0-mail-a31.g.dreamhost.com (100-105-161-122.trex.outbound.svc.cluster.local [100.105.161.122]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id 8136F483065 for ; Tue, 27 Apr 2021 00:07:41 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|jidanni@jidanni.org Received: from pdx1-sub0-mail-a31.g.dreamhost.com (pop.dreamhost.com [64.90.62.162]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384) by 100.105.161.122 (trex/6.2.1); Tue, 27 Apr 2021 00:07:41 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|jidanni@jidanni.org X-MailChannels-Auth-Id: dreamhost X-Society-Cold: 0d279436406fc79d_1619482061573_2158240449 X-MC-Loop-Signature: 1619482061573:1301744130 X-MC-Ingress-Time: 1619482061573 Received: from pdx1-sub0-mail-a31.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a31.g.dreamhost.com (Postfix) with ESMTP id 42CAC86786 for ; Mon, 26 Apr 2021 17:07:41 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=jidanni.org; h=from:to :subject:date:message-id:mime-version:content-type; s= jidanni.org; bh=UQ2fmITpEmUUdZEY8f+wZit4t00=; b=qBPOH3czzgIsumZn FmkaxLXmjY3RuAzJAd3z9QxKNTSLCggmdvf4enEdmEDNf3UtVJQX7zJhBzPzMcm2 WPePwRrrjtnx0R0VyyHxji22DmiHHb4bY+Gaw2h7UVx8SULpc/tjXNjCg41paeL/ XUDFsFPIf5jMvjZHkQW0Kx2e0lo= Received: from jidanni.org (220-140-7-176.dynamic-ip.hinet.net [220.140.7.176]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: jidanni@jidanni.org) by pdx1-sub0-mail-a31.g.dreamhost.com (Postfix) with ESMTPSA id 0EE508623F for ; Mon, 26 Apr 2021 17:07:40 -0700 (PDT) X-DH-BACKEND: pdx1-sub0-mail-a31 From: =?utf-8?B?56mN5Li55bC8?= Dan Jacobson To: bug-gnu-emacs@gnu.org Subject: GNU Makefile mode vs. https:// Date: Tue, 27 Apr 2021 08:07:37 +0800 Message-ID: <877dkoa8ty.5.fsf@jidanni.org> MIME-Version: 1.0 Content-Type: text/plain Received-SPF: pass client-ip=23.83.212.16; envelope-from=jidanni@jidanni.org; helo=beige.elm.relay.mailchannels.net X-Spam_score_int: -20 X-Spam_score: -2.1 X-Spam_bar: -- X-Spam_report: (-2.1 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, RCVD_IN_DNSWL_NONE=-0.0001, RCVD_IN_MSPIKE_H2=-0.001, SPF_HELO_NONE=0.001, SPF_PASS=-0.001 autolearn=ham autolearn_force=no X-Spam_action: no action X-Spam-Score: -1.4 (-) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.4 (--) Weird colors of https... in GNU Makefile mode: Communication_Center: $B https://servicemessages.fidelity.com/ftgw/amtd/messageCenter activity: $B https://oltx.fidelity.com/ftgw/fbc/oftop/portfolio#activity/X00000 emacs-version "27.1" ------------=_1741573029-4241-21--