From unknown Sun Aug 17 22:01:40 2025 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 X-Mailer: MIME-tools 5.509 (Entity 5.509) Content-Type: text/plain; charset=utf-8 From: bug#76132 <76132@debbugs.gnu.org> To: bug#76132 <76132@debbugs.gnu.org> Subject: Status: Clojure-style auto-gensyms for macros Reply-To: bug#76132 <76132@debbugs.gnu.org> Date: Mon, 18 Aug 2025 05:01:40 +0000 retitle 76132 Clojure-style auto-gensyms for macros reassign 76132 emacs submitter 76132 Tassilo Horn severity 76132 wishlist tag 76132 patch thanks From debbugs-submit-bounces@debbugs.gnu.org Fri Feb 07 16:12:31 2025 Received: (at submit) by debbugs.gnu.org; 7 Feb 2025 21:12:31 +0000 Received: from localhost ([127.0.0.1]:36924 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tgVeJ-0005fT-9a for submit@debbugs.gnu.org; Fri, 07 Feb 2025 16:12:31 -0500 Received: from lists.gnu.org ([2001:470:142::17]:58806) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tgVeG-0005fC-7f for submit@debbugs.gnu.org; Fri, 07 Feb 2025 16:12:30 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tgVe8-0000BL-IL for bug-gnu-emacs@gnu.org; Fri, 07 Feb 2025 16:12:22 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tgVe8-0003S8-8w for bug-gnu-emacs@gnu.org; Fri, 07 Feb 2025 16:12:20 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-Version:Date:Subject:To:From:in-reply-to: references; bh=abdukFb36Sw/O5w57CsldPuKonLsWEE7C4RP6eR8xE8=; b=Lj1bzdAlXKNxPh YNOLQqwMIGsIZf8OrHEttAVOo5CsBEUpuzDn9tko+VbA9yfBs/eIu7FJaQG3EffvC9e+Gb/yUq3b0 C2MPTY8J99OOKDswKIyTa8JfPhQr0/rLaqv7Jvc/5RCyPL+E0LWfoQidkT9X7EEF89AV3bwyPKZKH YdGrOtrLbsRspcAl/CZ1biatsUEZT3yGxL7vIPt3FNVKKf8A1DL4kvNXm5D+JegIohKX4YKbKTjgn +5j3M4fVS2Iicmcq1Uzld+ACLyT582v++2RXpVEt+yqKhSr2SUVVm1pWPPurab3ETlZ+jQzEzKz3p HI1yYKoU8rfTVR7nABxQ==; X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdeftdeffecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecunecujfgurhephffvuf gffffkgggtsehmtderredtredtnecuhfhrohhmpefvrghsshhilhhoucfjohhrnhcuoeht shguhhesghhnuhdrohhrgheqnecuggftrfgrthhtvghrnhepjeekvdeuhffhkedthefhve ehieduffefheegfeehgeeuueehgfektdefudejhfeunecuvehluhhsthgvrhfuihiivgep tdenucfrrghrrghmpehmrghilhhfrhhomhepthhhohhrnhdomhgvshhmthhprghuthhhph gvrhhsohhnrghlihhthidqkeeijeefkeejkeegqdeifeehvdelkedqthhsughhpeepghhn uhdrohhrghesfhgrshhtmhgrihhlrdhfmhdpnhgspghrtghpthhtohepuddpmhhouggvpe hsmhhtphhouhhtpdhrtghpthhtohepsghughdqghhnuhdqvghmrggtshesghhnuhdrohhr gh X-ME-Proxy: Feedback-ID: ib2b94485:Fastmail From: Tassilo Horn To: bug-gnu-emacs@gnu.org Subject: Clojure-style auto-gensyms for macros User-Agent: mu4e 1.12.8; emacs 31.0.50 X-Debbugs-Cc: Date: Fri, 07 Feb 2025 22:12:14 +0100 Message-ID: <871pw98no1.fsf@gnu.org> MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="=-=-=" X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --=-=-= Content-Type: text/plain Tags: patch Hi all, in a recent bug report the topic macro hygiene came up, i.e., that a macro which introduces local bindings in its expansion better uses uninterned symbols for those in order not to clash with code passed as macro arguments which are spliced into the expansion. Clojure has a very convenient feature to make that easy. While you can write such macros traditionally like (defmacro foo [x y] (let [xv (gensym "x") yv (gensym "y")] `(let [,xv ,x ,yv ,y] (do-stuff (* ,xv ,xv) (* ,yv ,yv))))) you can also write much more concise and convenient (defmacro foo [x y] `(let [xv# ,x yv# ,y] (do-stuff (* xv# xv#) (* yv# yv#)))) where each symbol ending in # will be replaced by a unique gensymed symbol (per name). The expansion of the two macros is the same. Would there be interest in adding something like that to Elisp? I've attached a proof-of-concept implementation where the feature is provided by a macro with-uninterned-symbols [1] which you simply wrap around your backquoted form. [1] In Clojure, it's a feature of the reader triggered by backquote. In GNU Emacs 31.0.50 (build 1, x86_64-pc-linux-gnu, GTK+ Version 3.24.48, cairo version 1.18.2) of 2025-02-07 built on thinkpad-t440p Repository revision: 1751739152149608d28853782ce53b0b9a749bb2 Repository branch: master System Description: Arch Linux Configured using: 'configure --without-native-compilation --with-modules --with-pgtk' --=-=-= Content-Type: text/patch Content-Disposition: attachment; filename=clojure-macro.el ;; -*- lexical-binding: t; -*- (defun with-uninterned-symbols--helper (form symbol-map) (cond ;; A symbol foo$ must be replaced with an uninterned symbol. Record the ;; foo$ -> #:foo mapping in symbol-map for reuse. ((and (symbolp form) (string-match "\\(.*\\)[$]$" (symbol-name form))) (or (gethash form symbol-map) (let ((s (make-symbol (match-string 1 (symbol-name form))))) (puthash form s symbol-map) s))) ;; For lists and vectors, recurse into each element. ((or (listp form) (vectorp form)) (let ((new-form (mapcar (lambda (c) (with-uninterned-symbols--helper c symbol-map)) form))) (if (vectorp form) (apply #'vector new-form) new-form))) ;; For conses, recurse into car and cdr. ((consp form) (cons (with-uninterned-symbols--helper (car form)) (with-uninterned-symbols--helper (cdr form)))) (t form))) (defmacro with-uninterned-symbols (form) "Helper macro for defining the expansion of a macro. Takes a FORM and replaces all symbols whose name ends with $ with uninterned symbols, one uninterned symbol per name." (with-uninterned-symbols--helper form (make-hash-table :test #'eq :size 16))) (defmacro th/test (x y) (with-uninterned-symbols `(let ((foo$ ,x) (bar$ ,y)) (list :args `(,foo$ . ,bar$) :add (+ foo$ bar$) :sub (- foo$ bar$) :mul (* foo$ bar$) :div (/ foo$ bar$))))) (th/test 1.0 2.0) ;;=> (:args (1.0 . 2.0) :add 3.0 :sub -1.0 :mul 2.0 :div 0.5) ;;=> Expansion is: ;; (let ((#:foo 1.0) (#:bar 2.0)) ;; (list :args `(,#:foo \, #:bar) ;; :add (+ #:foo #:bar) ;; :sub (- #:foo #:bar) ;; :mul (* #:foo #:bar) ;; :div (/ #:foo #:bar))) --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Fri Feb 07 17:25:20 2025 Received: (at 76132) by debbugs.gnu.org; 7 Feb 2025 22:25:20 +0000 Received: from localhost ([127.0.0.1]:37148 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tgWmm-00015G-Bw for submit@debbugs.gnu.org; Fri, 07 Feb 2025 17:25:20 -0500 Received: from mx0a-00069f02.pphosted.com ([205.220.165.32]:9320) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tgWmi-000150-Qn for 76132@debbugs.gnu.org; Fri, 07 Feb 2025 17:25:18 -0500 Received: from pps.filterd (m0246627.ppops.net [127.0.0.1]) by mx0b-00069f02.pphosted.com (8.18.1.2/8.18.1.2) with ESMTP id 517LfqAY007996; Fri, 7 Feb 2025 22:25:15 GMT DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=oracle.com; h= content-transfer-encoding:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to; s= corp-2023-11-20; bh=TtFT6Nqn5ojZHsbaVNhNYvryQA1PthrEE8iZDTctePI=; b= XTVlLmjvTIIN7KChBFMPZkY8Gy673wPjoMsxZHfVXDo2aPijJHGmyvfjerAeDIWr B0UNCNXz5IesSb2mLqQgeBCG7Wm2uW/LRU5ePIu/k11qaHxbN9VYWi/R1sQG+YyA 5vxcECEhFI/wAFfF4o/z19eoDLpUY5q5TM2F5nlpkOY1kH/WF4s0MZQzBDLQIA2W YJrDfzy4hiKt/EIB6b8pemYKB/KSVrhM7FCWgexrhIY9t851FPvvnmOzDy2skVND h3u5EsqSysnemZZt3meD9ccVgPw9CN1lKBI5AvB96qkUULRbocXr4QiHWNDEQZnn gafJYIcAWhQfpvwIwIO5vw== Received: from iadpaimrmta02.imrmtpd1.prodappiadaev1.oraclevcn.com (iadpaimrmta02.appoci.oracle.com [147.154.18.20]) by mx0b-00069f02.pphosted.com (PPS) with ESMTPS id 44nqb18d9x-1 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=OK); Fri, 07 Feb 2025 22:25:15 +0000 (GMT) Received: from pps.filterd (iadpaimrmta02.imrmtpd1.prodappiadaev1.oraclevcn.com [127.0.0.1]) by iadpaimrmta02.imrmtpd1.prodappiadaev1.oraclevcn.com (8.18.1.2/8.18.1.2) with ESMTP id 517KsBlC027891; Fri, 7 Feb 2025 22:25:13 GMT Received: from nam11-co1-obe.outbound.protection.outlook.com (mail-co1nam11lp2174.outbound.protection.outlook.com [104.47.56.174]) by iadpaimrmta02.imrmtpd1.prodappiadaev1.oraclevcn.com (PPS) with ESMTPS id 44j8p7tmnb-1 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=OK); Fri, 07 Feb 2025 22:25:13 +0000 ARC-Seal: i=1; a=rsa-sha256; s=arcselector10001; d=microsoft.com; cv=none; b=Q0+CB0cZ21ANT/1NUVOlNsMgBV/L6cwVlaKBxTF5mk2QHnIuOC0dc6DP3kNr0wHywzvAQjbU7x01tOygw68tYkFcCayBGuOYTBhUS6QkGW/j6YLkoQtQc2Rhv6uH+QIdjTTZ7tnQ8s+1t1hEgmP36bUGRwY3LFpq6w3hIf4hDRUg6VvVES/l+Hi01evENP5faWVjNj1m7Wh4u8Quh6+RmVYQMRx4LJP4HzHFW13u+HUNg32ll0SfV1igrybb0HWiLXVv4SczQGH1r9dOuU9zyjOBZk6idf9Svt4Z/uXi9uSlG5h2fINSQJ4HUHN15GBp27wwIXvA8+q1Pnys31y8Ig== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector10001; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1; bh=TtFT6Nqn5ojZHsbaVNhNYvryQA1PthrEE8iZDTctePI=; b=hPJWBZ9C72T+qi6p1Ap7wNukP+Jajnr4fJoYxaXBl+WB3P/Zyd9iwoXYaKWx+DRLQAJQaBj9YeqLRE2MSzgw6kAwvDTBJRUURJFOvP56RPyOops9ivMcFLKHHYfMOeFpeg2ORt1/c3bliTtRNfFiFElivQBYSpvegxip79bj0MOOdTQS+NSS/cIPYvdl2ipo4an7/0gCbye+Jr1heZub/SjLeH43FXg4CILx5HYQyoofK8YNUs6s9Kdg4fqox9hubQEpb7EJQbjpHmWuVZ2cGfkpaJYrAlTenEv+nOKInTk+BxzIDYgAxJyj52NpDRZgPkaWYDRq2mGXI+xDiJH8tQ== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=oracle.com; dmarc=pass action=none header.from=oracle.com; dkim=pass header.d=oracle.com; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=oracle.onmicrosoft.com; s=selector2-oracle-onmicrosoft-com; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=TtFT6Nqn5ojZHsbaVNhNYvryQA1PthrEE8iZDTctePI=; b=kgfGUVtxppxVSmTLoWrC8KQnjzCuUg0JG8mhxr1mt0ahvcyOmTOi7kRmQ1C8Qgq8pt+mJDmUUq/2IlZTmkQZYfRbv8IoXetONT3bwEqfV87o23iNbfje00zk9vK6e7dTSNExZbWw3Be4+wQad7iSpQqNRBTAATQcVjViz3bdn9s= Received: from DS7PR10MB5232.namprd10.prod.outlook.com (2603:10b6:5:3aa::24) by BLAPR10MB5027.namprd10.prod.outlook.com (2603:10b6:208:333::15) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.8422.10; Fri, 7 Feb 2025 22:25:10 +0000 Received: from DS7PR10MB5232.namprd10.prod.outlook.com ([fe80::8303:658f:14f8:2324]) by DS7PR10MB5232.namprd10.prod.outlook.com ([fe80::8303:658f:14f8:2324%4]) with mapi id 15.20.8422.012; Fri, 7 Feb 2025 22:25:10 +0000 From: Drew Adams To: Tassilo Horn , "76132@debbugs.gnu.org" <76132@debbugs.gnu.org> Subject: RE: [External] : bug#76132: Clojure-style auto-gensyms for macros Thread-Topic: [External] : bug#76132: Clojure-style auto-gensyms for macros Thread-Index: AQHbeaUtleJhfuFs5EqJDXFAdMhtmbM8YbGw Date: Fri, 7 Feb 2025 22:25:10 +0000 Message-ID: References: <871pw98no1.fsf@gnu.org> In-Reply-To: <871pw98no1.fsf@gnu.org> Accept-Language: en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: x-ms-publictraffictype: Email x-ms-traffictypediagnostic: DS7PR10MB5232:EE_|BLAPR10MB5027:EE_ x-ms-office365-filtering-correlation-id: 17ecb53b-6481-430b-fff2-08dd47c648e2 x-ms-exchange-senderadcheck: 1 x-ms-exchange-antispam-relay: 0 x-microsoft-antispam: BCL:0; ARA:13230040|376014|366016|1800799024|38070700018; x-microsoft-antispam-message-info: =?iso-8859-1?Q?ZfGbKYPfFagSaGpmhs5SbkTsSABUDFEn2SOLq5yzDdFlr+SdBYrCV5/eII?= =?iso-8859-1?Q?n0GV0a/wanglEeAoN25T6sZINGT93j2byrOYVtYoRxjzNVO25zjb7tBlfl?= =?iso-8859-1?Q?jVyDLsG5pnbj00dk5bo4y+5xnPR/8PxdViuXW5g28vbamoNrO93XKe9HVh?= =?iso-8859-1?Q?k3lIZyPtKXxVDHlY3dKX0Z+pkCmoLkljdu9XdS05vxWLyQbOzx/rmfjogJ?= =?iso-8859-1?Q?QWpId9/JC6NCgWkgcMFKqFaC5FBSJB6FGIXarf8LJQ91KCrJlbNBBzFXIa?= =?iso-8859-1?Q?lHrOzd+t4higEB6CG+nRzqYuZrFifRoPiLbu4SfxD6nYGUooBtaq4ZfZcA?= =?iso-8859-1?Q?E44YOVtLQMZbDsi+eFOneUGa1ZJLJHbBUcsrE3ewZuhjYJpgKF1NOBeLvO?= =?iso-8859-1?Q?5YrJueT+uTcoB/RG5ZjvMTwnoDOwyT1uuUuxO1neEj8j27wr0tb5bYJ0eO?= =?iso-8859-1?Q?rPGPfpbM4dJjkKQwJdPai1iSLrFZOjaqcWGTx2b6GTlWSbs3cjSDOPxvPU?= =?iso-8859-1?Q?etuVUNWpHFnZ4x+bQxXhEX7uDpIIJ/z4WjPYaQSmNgBq51UZmvlNcH0Nle?= =?iso-8859-1?Q?/g1XpmWO+SVDlDA0GmdllEavZxLO/94OBmwCDVXo0wFUwmjsfoUq9l8eoE?= =?iso-8859-1?Q?QxWJWbRn5eYSi0gLrsGQtEAejBSgxOb9fOv8NMWabnqcR8wEPrI+2qocFr?= =?iso-8859-1?Q?fVLv+KF5NXVUDxGUxuXBJXQkJgw1RLltPjziM41Se2jo83fCXTkGvzF+4t?= =?iso-8859-1?Q?gAdCeHqvyJbUURvDIwRLZ0bUjB2++K3U1qvh/G+wsREu9KZP7edMIjRPBX?= =?iso-8859-1?Q?xFPfw6AWw2dX7rCcPoXQ7SR2nuR5hiMg33LsbN4uQMPrRXqnkcx4IAF6X3?= =?iso-8859-1?Q?q0MnDEMcBlogcdmjhY9cFaSwxcEvpcZUGlU+UBMNMblohoa0tIACsGjnTf?= =?iso-8859-1?Q?jjYMzjjOic4tTM8WB4IuVNUpJ98qFN5vj6A5UZE+/2kysLw+gk3cT0qhEL?= =?iso-8859-1?Q?C9ZyNO3pFBcgQgerm1trmv41Y0chPTm4WQvMpDnXam+KH4t0DF9VKvnrS/?= =?iso-8859-1?Q?aTh2j7Sr++J+NfFBbW9Do0cViCqMAKtEokMsP/xPKmhcJUw0ir0ltDbycc?= =?iso-8859-1?Q?DdleyCbZ04DPcw6MCf1wggqPeN4QHwSlVAqFUIpPHA3N3CFTg1gxjYEVr4?= =?iso-8859-1?Q?oeyr7LDq7uiy4GvsANp6J9+q7rLOrckUhoAMv74/5gii4/dSl0fBe7Hwow?= =?iso-8859-1?Q?36VTkhHwJFk2or+wFgWxAKqu8pwT4KOOXGrcTvxgrEDzm5oWYP41fUcSX1?= =?iso-8859-1?Q?7pj2aS04N+4rRPhyM4VpyCpL35y6C8crxIFly+7UQp9IrXmxd1Achhgrz+?= =?iso-8859-1?Q?UGc3zVrvghGlVV6i+0wrwkYDd+8/z+WNFO4PSH42hO7ynVFsm0WDIEgnY6?= =?iso-8859-1?Q?BSeAmD+OlFI8IzJUW39ApxuilsAe/b77OUTeCMnK0yYal6xyySlNJ8En+G?= =?iso-8859-1?Q?2vIG+a2VKgFh41AxbKhCkI?= x-forefront-antispam-report: CIP:255.255.255.255; CTRY:; LANG:en; SCL:1; SRV:; IPV:NLI; SFV:NSPM; H:DS7PR10MB5232.namprd10.prod.outlook.com; PTR:; CAT:NONE; SFS:(13230040)(376014)(366016)(1800799024)(38070700018); DIR:OUT; SFP:1101; x-ms-exchange-antispam-messagedata-chunkcount: 1 x-ms-exchange-antispam-messagedata-0: =?iso-8859-1?Q?Ma/NnByxNylOr2hY5ApeO25T2fTtbrxCXMJYlivM/HlOKouC2wnuE3nIkC?= =?iso-8859-1?Q?mfCk3Wpv/dXTH3083h7cVLfTfT9EDGbdoIijbgh/IHjhTRqg3/o4DpPf0O?= =?iso-8859-1?Q?A0IW6DrCKbkpD5yeNUsTZJqB6xMs4nc+SrOJQ7O/hetkziY6+Dxc90fxLA?= =?iso-8859-1?Q?WH3abTCdYy6mnc8sIz1pq0vRB+YKl8RhyqRHaVck1XaPc+C1jU850YjZEp?= =?iso-8859-1?Q?GL8cU5xOv0NN0/pDQ8rNTMRaA6p8ISoxNd9q9qXbZSpmZn3fLIE6VdT7Av?= =?iso-8859-1?Q?vCPiUb5BzsIiv9It3Mx3oTcc4fFC/pE1MGHSbk0NpdNEDxOIIt3yheMBxW?= =?iso-8859-1?Q?txHmHa2G9Iy8Oe7+9fqcB8v3d4FWHu4BPIYR/yEWZB+jYxhZZ9Kgsz8s/m?= =?iso-8859-1?Q?6L+eulo6pZ7VdKvd8KXQ+eLGRBkdKMY2a1MnyHSz0dR+74eIRVPolqeaDM?= =?iso-8859-1?Q?aZnRjyHMC4bNx5A8XsbhG8emuwmU8FH94DpAMSKiEOgCZJQ/vsFPwsPjNF?= =?iso-8859-1?Q?c8FaDyR7C9pO0RGjUj9JRbtSY92h5xgerbOBoc74d53IauKu7g1A2I2Vwn?= =?iso-8859-1?Q?zUUR+kt2rg7+Z0DLLEXpdtmTvzNffVbO9c3nJwGlNTTYG5oBLwxDw5Kjv1?= =?iso-8859-1?Q?KibzXGhUxMvhDiirOLg80kesI5j4e/2xKX0sZdoClZgdq/xvISYCriuzET?= =?iso-8859-1?Q?NjpmR6ntFiCVt4KazvZqjywOC2a5aqSa0cXfcVXj8iy26wlIdIRBR85Lvc?= =?iso-8859-1?Q?Vg9dx0zOhRgOJBu8IgNxL0nMEpMg7MvTpQ2G7HohGVrIrOHjtnzXmxmKnX?= =?iso-8859-1?Q?RjyLF5lhHLgvmbmu60witYF1d0lixzVHVztO1ywhmv7mAn4LQB8vajPLae?= =?iso-8859-1?Q?iYaNu0uSauz6v52m6qSqlDSXQJACuyOou3JJS0uZ/BkpaifLk9NkIBJfz1?= =?iso-8859-1?Q?WDLyiKdOcYnfTJ3X+zw0WAHKH2TkQ0xOV6TeQz8OuKvK9lT1TTMRpyUadU?= =?iso-8859-1?Q?T850CNxhtcUmm0Ild9vZ5C3SITBZbQ9JiUk1DMD5VxdcZDd5IrO75iPbzd?= =?iso-8859-1?Q?tSHYqeqwvOI1OQxvTYHAZyQ7EUZy1btSePAb4+aarfRR8xJA8zd+61/Yh8?= =?iso-8859-1?Q?1zP3NX3OT6AIA0fDGNG2ih/h23Kp1BuI85u4HjLWJ12CP1HBlAa14x7lVy?= =?iso-8859-1?Q?1mePbraRWmjvDCV2cW/o3t3mvEjPKbcslemtWLzoswCvfOgwv/1zJgl0zK?= =?iso-8859-1?Q?vqS61w+1875poY7ba137kCERKAUpVxjRaCd4zyzuPDFvG7/si0p2EaaLnP?= =?iso-8859-1?Q?GTi0W0tYbz96MIJeiuQFb5Ts4nGbUGl0O0uleRa1x3JJ/xkeJFimqSQeHa?= =?iso-8859-1?Q?RugXgfBhC9sCEkJ8cZB8aVs+PUFDnNmT2zfxoGyhDvhhC4PAvrY7aqcxTR?= =?iso-8859-1?Q?G8xJGN7JjpUJ5TKqBdD6LKR4rtZYrGOWTjyPI2Zw4duQapbIsQvECQMb5U?= =?iso-8859-1?Q?vJyafniTRUsBDgpSAe7BI3EXE9an0U/G/KqDTkDjToQMXS2A4OFlB4s/Nr?= =?iso-8859-1?Q?v6W2o6PIOvoI8ti96RwyNF0SLn/ycRS0cixhOroV9moXL3SBaG7t3UmeVg?= =?iso-8859-1?Q?Zvf35LXX1OtbpvrxP52XLkCDdtn8pE5MZb?= Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 X-MS-Exchange-AntiSpam-ExternalHop-MessageData-ChunkCount: 1 X-MS-Exchange-AntiSpam-ExternalHop-MessageData-0: 5kLmvaBa83/kLN65kMs7cbEOGtEPToEWaA8+am6GJpCeXstTqygN2KfKr82V39LS7HmYLQcqTIlT/5vLN0ro0PtMK1JHI1ProCMomEmIG6RoZ6qSRL+AbUzn3FfQaENdm/aFIuENzyXjsoyHQg2tqjoldqn+kIX2D6k9mrC/baB2LCGyaYCoZS6Pph+mOgu8aenFBM1yQ1O8AjKPIvyanPdteGAAKJPFs90aR/zCbuVJJ3gqChAOvq5E0ojHXPJnKd12gWzVIGXOUZCn9QSFgoE8NedjJ40d5ktJgHiqhLHZY165ZfF/WPHpdhz04u+n5aNSu6HiHRlHIAqC+ALTeA5KAUuDVLjDH8M0ZZIdCmLJnUFB1EPGOXCsMnt2GZArJTwoyqc7hnti2g8sQmxT6ZuRgfB7ijndboS0AD151lJJYb3CPMQmIZ3LDozAAM7Igtb3y9hUkYKHCPHgYxTRYQnAtbhx3imnEyFkfkJ4nCDS9yGxpLL46yH/HtxP//5lFWAKcOGPpPIszKkmIEE680z+0tPETTKRweoaFGxxe9BYWyD7drz5q7SKBG2MZBFA5ncEk2WK0QTNRRGnB+bbmtKuqWbmzb52h+P7xGIFIfE= X-OriginatorOrg: oracle.com X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-AuthSource: DS7PR10MB5232.namprd10.prod.outlook.com X-MS-Exchange-CrossTenant-Network-Message-Id: 17ecb53b-6481-430b-fff2-08dd47c648e2 X-MS-Exchange-CrossTenant-originalarrivaltime: 07 Feb 2025 22:25:10.8120 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: 4e2c6054-71cb-48f1-bd6c-3a9705aca71b X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: AKZwzZraLnXwWB42HpFEpJvfKieJIA2WPMB/KKipiWLr5GGOOPtl3Kmnt6fvI4uHBEFdXzM4wUUBH0MCkV7hBw== X-MS-Exchange-Transport-CrossTenantHeadersStamped: BLAPR10MB5027 X-Proofpoint-Virus-Version: vendor=baseguard engine=ICAP:2.0.293,Aquarius:18.0.1057,Hydra:6.0.680,FMLib:17.12.68.34 definitions=2025-02-07_10,2025-02-07_03,2024-11-22_01 X-Proofpoint-Spam-Details: rule=notspam policy=default score=0 bulkscore=0 phishscore=0 suspectscore=0 adultscore=0 mlxscore=0 spamscore=0 malwarescore=0 mlxlogscore=835 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.12.0-2501170000 definitions=main-2502070169 X-Proofpoint-GUID: zDEzwP6weniPLX8JTi7vYIp2jFrIVBsG X-Proofpoint-ORIG-GUID: zDEzwP6weniPLX8JTi7vYIp2jFrIVBsG X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 76132 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) > Clojure has a very convenient feature to make that easy. While you can > write such macros traditionally like >=20 > (defmacro foo [x y] > (let [xv (gensym "x") > yv (gensym "y")] > `(let [,xv ,x > ,yv ,y] > (do-stuff (* ,xv ,xv) (* ,yv ,yv))))) >=20 > you can also write much more concise and convenient > > you can also write much more concise and convenient >=20 > (defmacro foo [x y] > `(let [xv# ,x > yv# ,y] > (do-stuff (* xv# xv#) (* yv# yv#)))) >=20 > where each symbol ending in # will be replaced > by a unique gensymed symbol (per name). > Would there be interest in adding something > like that to Elisp? So you could no longer let-bind a variable whose name ends in `#', to get a normal let binding? (Admittedly, you need to write that as `\#' in the source code.) Doesn't sound like an improvement, to me. A priori, I'm not in favor of limiting the names you can use for variables. That would be especially pernicious with let bindings of dynamic ("special") variables. If it were limited to lexical variables it wouldn't be so bad. We should be able to bind dynamic vars whose names end with `#'. (Again though, admittedly the `#' chars need to be escaped in source code: `\#'.) The clich=E9 of handling this kind of thing in macros with gensym is pretty standard (it may even be the main use of gensym). Yes, it can be error prone, but it's not really harder to use gensym than it is to add `#' to var names. And the body is IMO clearer without the added `#'s and subtracted commas. There might be some other way to provide such a shortcut, without removing the _general_ possibility of naming let variables with `#' at the end. A new variety (yet another?) of `let' perhaps, that does what you suggest. I'll note too that Common Lisp doesn't bother with such things either. And people have been writing Lisp macros with Common Lisp and its ancestors for many, many moon. From debbugs-submit-bounces@debbugs.gnu.org Fri Feb 07 22:28:18 2025 Received: (at 76132) by debbugs.gnu.org; 8 Feb 2025 03:28:18 +0000 Received: from localhost ([127.0.0.1]:37672 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tgbVx-00072t-RY for submit@debbugs.gnu.org; Fri, 07 Feb 2025 22:28:18 -0500 Received: from mout02.posteo.de ([185.67.36.66]:36511) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tgbVt-00072X-Mr for 76132@debbugs.gnu.org; Fri, 07 Feb 2025 22:28:15 -0500 Received: from submission (posteo.de [185.67.36.169]) by mout02.posteo.de (Postfix) with ESMTPS id E4D91240101 for <76132@debbugs.gnu.org>; Sat, 8 Feb 2025 04:28:06 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=posteo.net; s=2017; t=1738985286; bh=ZP39dtWO2ew5ulI/NQPXW2uQ1sAhw5oNDT9qYSl20R8=; h=From:To:Cc:Subject:Date:Message-ID:MIME-Version:Content-Type: Autocrypt:OpenPGP:From; b=A9C13aaIUNyEPNeMVVKepReZAWJGBRWhcpIaxOOnoPUz+kNI0B+M9m1o1r+bYmgtK bFwaFGHTqR+2GSx8HNqZNOG+FofjIvGspBZ70IshyaBLQGgK694eOTUBYdP40un0Xk ytglcblaO5JF+2mhT0fumpvBDu5d+tfG4lFvKGDkPZh68lxVU7AyK8sju4kXfCILup AILznylnJ1QmmF/VkW7cXcKVvMkPZfLd4xRnDbMjv1fIFHaKzRa8RdLU4VsUtAEkV9 yKaqmFotgsGfcbJFDi0iTmrDbdcbHu+IjtOJgy6uySnhNT8talapi4qeF1gkNXRoV/ nJH9k3vNQ72UQ== Received: from customer (localhost [127.0.0.1]) by submission (posteo.de) with ESMTPSA id 4Yqbrg3PvYz6tm8; Sat, 8 Feb 2025 04:28:03 +0100 (CET) From: Thierry Volpiatto To: Tassilo Horn Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: <871pw98no1.fsf@gnu.org> (Tassilo Horn's message of "Fri, 07 Feb 2025 22:12:14 +0100") References: <871pw98no1.fsf@gnu.org> Date: Sat, 08 Feb 2025 03:27:57 +0000 Message-ID: <87msexjete.fsf@posteo.net> MIME-Version: 1.0 Content-Type: text/plain Autocrypt: addr=thievol@posteo.net; prefer-encrypt=mutual; keydata=xsDNBF8ylcIBDADG+hy+zR6L4/vbdDDZuSaMmSrU3A5QZJpeBCvxTr7MpzzruZbhLPW1K3R6N2MA edi8Y+C8o27FVRIjpdbaKMGu9je7JV/TbUQYo3SOwCK1vM4LUn4V6ZLzSYkuiEt4eyMoiDdyvN0p kcK6P9x9DCetcEVszXzQg+yzCVrQ2hXWDXWT4M18EC3wtO7RHPouMqGiwBFhBAYErCqFWFxQHkfb tG/4yGyJ58rglb65O3qijjMWvYwcWZun9/7qm8Z4/4mHopmo2zgU+OrptnLSZfkZGz3Y7Uf452xQ GVq0Fv75NPvQru7y+DYVhuVXXyAmGxt+vf4rIiixMBbhKEPjcxEPAa2LTzex2IsTZR+QVG9uDnqC WcgaOEQ58fzXNvNhtwwF/Rgio2XWAJVdmFWS59/k9W58CIUSNKBMZh2XeGdEmtHvDtCxW3z6FJha 36RzOM3fMNNiAGdFZJA84gcdloJR+sHCDTTPT3784fjr+V8An7sI581NGFzkRQqPvEQCZbUAEQEA Ac0SdGhpZXZvbEBwb3N0ZW8ubmV0wsEOBBMBCgA4AhsDBQsJCAcCBhUKCQgLAgQWAgMBAh4BAheA FiEEI9twfRN7r3nig/xwDsVtFB0W75MFAmL3HCoACgkQDsVtFB0W75OVEAv/f6XxmtIFz08fUb8h Bp/zJP6IC4/rhhh+0GMRIRzLN8DK0jV8JCzYdFHiRJOy2lNIOpmrrCmjRRxferc2G42+ePFIsslx hU46VSz1Z83NwIG3mpdYNV5WUTUdgzxExHTNTFCd7NKv0nlHKQaAtdXm5bYnSHsnL7cx8z7lukA/ EsJocE+GD7QXnsrdlicvdobI0TEN4l73221a72oCvHfYLCVsB6YsNJ5ZGkA1zSjzln5uLAgZ/2r/ aqlao/AlSZkAk6+hvK0RyAZ/YR4YRZxO8Fsd0gWgFkanRfKfufJ1V0OHZg7yszi3q/hRzS+rZtJ0 OuzDlh/dyQkxVkZb9vis/+HnGDJrBE5MsmJLcy2Sy3uUnio0fq8q9CrZbudvd1DajlZxPzTm0csP eUk45QEgbhEU7MfyAX/mkKxjHajz2cMcHKIap1BqEgJl4BKFeLMcBZ4O1p9ivwtf1Ht2JTp5lOi0 ItPfhQ4DP8LZ1ZIkN5Kg9v0cyw9meRzAuuR0V2GtzsDNBF8ylcIBDADnIDHEkmk4lUwTlOhwb2yj UfmGPnpH3MCCHkjM9H/P1gTHxFWtwFVPcNMCwXWvKSBTF2dZXKERD0yzG06zT53ZMN7EIIeuY6m4 R8IcMvpohciisWxbFoB4ZY117tVSeqjo946itgbpdeESKl9a8dpn7ytZMyYxPdojlQAqxeAJ8444 raESh1oTKXb64hlk4l2pSRlrLgjpJBo8asAfZndaxIUKhw68tV8sqeZh9P6cGtHbUELKVJqefNV7 V7jF5wf3xvRG6Ces3kSKXalLfs+vrVaoOjQeWrc0AtwFWHmt9JLfKrqF+Q2Q7jUidboWmazQM56E SJFPpPHmWq8k6DHspsFHOforLouTHJL1556IPne7IV2BGfWc0+xLxalZ8F5F+vnPF/OkrC1CD5iC KTjXKa2iZbcYdYQAiL6P8Ac8CgN6EkhpbxRtzrEgChuNGevdi/G/GHG4Zqrh6YFwIa/NHq2aVaFq 5C1yNTMJd1FRjRzs5JPPlJKpYDnNx+MSp7UAEQEAAcLA9gQYAQoAIAIbDBYhBCPbcH0Te6954oP8 cA7FbRQdFu+TBQJi9x1ZAAoJEA7FbRQdFu+To6QMAIcvUSiFwCIggxkmYy3ZY0QAMLmIPga8DNPM XbfSOBDb2KLGBd+FAA8p2GExpul4r6kOYnGogtojByHmVgrd30/3ZURTM8Vj51wwD05viMZccQHl Wd9J/qZIvhBJlJWYnwVxh+2Kg4/hkx7SGc7JJS5GS37+PFQOJHPGMxc+fe4Ty2FdjIOVf3P1Hov9 K6yBI7Af66qqcL3aKJ4jJidRYN8sMaKOqEu4rcSpTxp8/3Ddbs9HezUgXeUzOLJMcEYFlvCyC8ZS l/QDZmpobKbxZ1JAqZM8lnmcZYSV7OsWnxJIYDV1gH5LTLj7bGswXaB4B+qkckihWkRZixu8q1IK 0c/xwUzyF092uFRM/sQKrSmnwA1+hQiiIuEl4XVz5li0/TmMta3ijUM7GNbl2IjioTRxWWecwad1 mNHvKTcXPsKDAbHFdLvQzurnroBHQV0jSPNLTP5Suo7RnLbehfg5INpGjToCUlrd2qQqgXW7h5qZ TgUq5UmBc7YZ0JYWQgPTbQ== OpenPGP: url=https://posteo.de/keys/thievol@posteo.net.asc; preference=encrypt X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Tassilo Horn writes: > Tags: patch > > Hi all, > > in a recent bug report the topic macro hygiene came up, i.e., that a > macro which introduces local bindings in its expansion better uses > uninterned symbols for those in order not to clash with code passed as > macro arguments which are spliced into the expansion. > > Clojure has a very convenient feature to make that easy. While you can > write such macros traditionally like > > (defmacro foo [x y] > (let [xv (gensym "x") > yv (gensym "y")] > `(let [,xv ,x > ,yv ,y] > (do-stuff (* ,xv ,xv) (* ,yv ,yv))))) > > you can also write much more concise and convenient > > (defmacro foo [x y] > `(let [xv# ,x > yv# ,y] > (do-stuff (* xv# xv#) (* yv# yv#)))) Don't we have cl-with-gensyms which is very convenient as well? In Helm we have helm-with-gensyms which is the same (Thanks Michael ;-)) > where each symbol ending in # will be replaced by a unique gensymed > symbol (per name). The expansion of the two macros is the same. > > Would there be interest in adding something like that to Elisp? > > I've attached a proof-of-concept implementation where the feature is > provided by a macro with-uninterned-symbols [1] which you simply wrap > around your backquoted form. > > [1] In Clojure, it's a feature of the reader triggered by backquote. > > In GNU Emacs 31.0.50 (build 1, x86_64-pc-linux-gnu, GTK+ Version > 3.24.48, cairo version 1.18.2) of 2025-02-07 built on thinkpad-t440p > Repository revision: 1751739152149608d28853782ce53b0b9a749bb2 > Repository branch: master > System Description: Arch Linux > > Configured using: > 'configure --without-native-compilation --with-modules --with-pgtk' > > -- Thierry From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 08 02:08:00 2025 Received: (at 76132) by debbugs.gnu.org; 8 Feb 2025 07:08:00 +0000 Received: from localhost ([127.0.0.1]:38089 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tgewa-00047n-5x for submit@debbugs.gnu.org; Sat, 08 Feb 2025 02:08:00 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:56700) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tgewX-00047Q-09 for 76132@debbugs.gnu.org; Sat, 08 Feb 2025 02:07:58 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tgewR-0003fn-DA; Sat, 08 Feb 2025 02:07:51 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-Version:Date:References:In-Reply-To:Subject:To: From; bh=MDWBbeEui74fNMAMWvCY5pGujO1KIRDk9zAfkW6R6Eg=; b=HHw+tD5W9RRC/Bv6Acuy vUhX4jJd11kJ7KQFB+4tGMK2V8Ij6O/B9mnbz1xtuq+IwJMnkbcgC69AtsmKhrD2ca7m7jiw7Qylk GS3lyNNcfotByoz2L/XnhzPlQxjDnDSdvnUB4bz+ctJmKhcO5k6n4yG5a2usV+gPzyNKJ6OzLLZDd h24MVJYwoC3Bh53jiSakuuW7V47267f/HS93tGQg8+N5y5xjvWnvzUuU4la7LzQMdYS7zsJL1FiOh aPu/PSF4URNnhq2fWM+0GmNwgCuJqNy3IcEwaGTbx2nBrBIPfGA2mk0Bn2MSpR9J+fV3FQhUBchN6 N7P4w4OokX0iLA==; X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdefudehhecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefhvfevufgjfhgffffkgggtsehttdertddtredt necuhfhrohhmpefvrghsshhilhhoucfjohhrnhcuoehtshguhhesghhnuhdrohhrgheqne cuggftrfgrthhtvghrnhepleduvdegfeduvdejkeefteelgeetgfevhefhueffueffgeeh gfeufefgvdffgedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilh hfrhhomhepthhhohhrnhdomhgvshhmthhprghuthhhphgvrhhsohhnrghlihhthidqkeei jeefkeejkeegqdeifeehvdelkedqthhsughhpeepghhnuhdrohhrghesfhgrshhtmhgrih hlrdhfmhdpnhgspghrtghpthhtohepvddpmhhouggvpehsmhhtphhouhhtpdhrtghpthht ohepjeeiudefvdesuggvsggsuhhgshdrghhnuhdrohhrghdprhgtphhtthhopegurhgvfi drrggurghmshesohhrrggtlhgvrdgtohhm X-ME-Proxy: Feedback-ID: ib2b94485:Fastmail From: Tassilo Horn To: Drew Adams Subject: Re: [External] : bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: References: <871pw98no1.fsf@gnu.org> User-Agent: mu4e 1.12.8; emacs 31.0.50 Date: Sat, 08 Feb 2025 08:07:46 +0100 Message-ID: <87o6zchq2l.fsf@gnu.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: "76132@debbugs.gnu.org" <76132@debbugs.gnu.org> X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Drew Adams writes: >> (defmacro foo [x y] >> `(let [xv# ,x >> yv# ,y] >> (do-stuff (* xv# xv#) (* yv# yv#)))) >> >> where each symbol ending in # will be replaced >> by a unique gensymed symbol (per name). >> Would there be interest in adding something >> like that to Elisp? > > So you could no longer let-bind a variable > whose name ends in `#', to get a normal let > binding? (Admittedly, you need to write that > as `\#' in the source code.) No, have you looked at the file I attached? You will see the feature is implemented by a macro itself, so if you don't like it, don't use it. > Doesn't sound like an improvement, to me. > A priori, I'm not in favor of limiting the > names you can use for variables. > > That would be especially pernicious with let > bindings of dynamic ("special") variables. How many special variables are there ending in # (or actually $ which I use in my example)? Bye, Tassilo From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 08 02:16:10 2025 Received: (at 76132) by debbugs.gnu.org; 8 Feb 2025 07:16:10 +0000 Received: from localhost ([127.0.0.1]:38111 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tgf4T-0004Z3-OQ for submit@debbugs.gnu.org; Sat, 08 Feb 2025 02:16:10 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:56890) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tgf4Q-0004YW-J7 for 76132@debbugs.gnu.org; Sat, 08 Feb 2025 02:16:07 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tgf4J-0005Dp-KB; Sat, 08 Feb 2025 02:15:59 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-Version:Date:References:In-Reply-To:Subject:To: From; bh=G+/C23wQip+6AUZTkmnosj9qx72G1PCx/OnjXz2fZWI=; b=XZVofTB1oGMHMOZc7ZLt KuikXQcXSu10gKwxVI/x7Md9SueFjZJtwPrK96komtolculsI5qPPOKFgHMgsx61t+/ZCXS6EoHw8 qD5GzG+KCV69zq3I2kekP9/RtGEMvTgIHBxE6QkwYzD1ERNgdWD9DlT5vge5H+D0JSb/mhR+A0CEm l8rmkmwKZdse9o0tXMCOgXvAeVrBmfppUKO+0vq58tnAoRioEWtTA/b+OVQRj2/PpoaRKTyBuh1x9 YPhXuSRmavxdOO+6Q0obf3aYanITe5T/OU/fp2DAIsKvQofX48+HVoqLOhTgDMdpXb+OQOTuTTCgK 1Svh1CgXEfYF3Q==; X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdefudehjecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefhvfevufgjfhgffffkgggtsehttdertddtredt necuhfhrohhmpefvrghsshhilhhoucfjohhrnhcuoehtshguhhesghhnuhdrohhrgheqne cuggftrfgrthhtvghrnhepleduvdegfeduvdejkeefteelgeetgfevhefhueffueffgeeh gfeufefgvdffgedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilh hfrhhomhepthhhohhrnhdomhgvshhmthhprghuthhhphgvrhhsohhnrghlihhthidqkeei jeefkeejkeegqdeifeehvdelkedqthhsughhpeepghhnuhdrohhrghesfhgrshhtmhgrih hlrdhfmhdpnhgspghrtghpthhtohepvddpmhhouggvpehsmhhtphhouhhtpdhrtghpthht ohepjeeiudefvdesuggvsggsuhhgshdrghhnuhdrohhrghdprhgtphhtthhopehthhhivg hvohhlsehpohhsthgvohdrnhgvth X-ME-Proxy: Feedback-ID: ib2b94485:Fastmail From: Tassilo Horn To: Thierry Volpiatto Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: <87msexjete.fsf@posteo.net> References: <871pw98no1.fsf@gnu.org> <87msexjete.fsf@posteo.net> User-Agent: mu4e 1.12.8; emacs 31.0.50 Date: Sat, 08 Feb 2025 08:15:55 +0100 Message-ID: <87ikpkhpp0.fsf@gnu.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Thierry Volpiatto writes: Hi Thierry, >> you can also write much more concise and convenient >> >> (defmacro foo [x y] >> `(let [xv# ,x >> yv# ,y] >> (do-stuff (* xv# xv#) (* yv# yv#)))) > > Don't we have cl-with-gensyms which is very convenient as well? Ah, I didn't know. Well, cl-with-gensyms is basically just a let which binds the given names to new gensyms. Then you have to use them as you did before, e.g., splice them in the expansion `(... ,v1 ,v2). My variant infers and replaces the symbols itself by a naming convention ("ending with $" in my example file). Bye, Tassilo From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 08 02:55:13 2025 Received: (at 76132) by debbugs.gnu.org; 8 Feb 2025 07:55:14 +0000 Received: from localhost ([127.0.0.1]:38192 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tgfgH-0006XH-A5 for submit@debbugs.gnu.org; Sat, 08 Feb 2025 02:55:13 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:51672) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tgfgD-0006RU-GG for 76132@debbugs.gnu.org; Sat, 08 Feb 2025 02:55:11 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tgfg7-0001bg-8v; Sat, 08 Feb 2025 02:55:03 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=References:Subject:In-Reply-To:To:From:Date: mime-version; bh=AZh0vX2Hy5tn3sIzUDoE2kBPfjSAJPzLSEZA1ZkVEO0=; b=bw8fnw/nvEn/ hjlMarmeWNGxDro86f/qWR7mYJ1fVmh+L/V3WOa1wLw1LF0qldt4eORZe3/5hFXv2VGHlWzaGYUcV jpc9didcDkQukoSjHeYI42aAb57b5fb84yrO9p/OOOrh4/jJoGJJlT97I4e3doDYA21QFptn19XmW 4gEdeEmXicOUPL3YBumRLWVHn1DfGmEaQsMIqneR+0b5Gvjv9Xf0bFLSCVkIt8Ttkta1JfpekGFju KKPrZ9W9tdxK93jFY531mo2gj1SsHFQ6XAR6OEuMCQWLkzlU3DL42CRxiKzjxvZa2b8xYS6DopIYP LhdqKSm6eq+skcJ2mXOARw==; Date: Sat, 08 Feb 2025 09:54:59 +0200 Message-Id: <86h65450rw.fsf@gnu.org> From: Eli Zaretskii To: Tassilo Horn , Stefan Monnier In-Reply-To: <871pw98no1.fsf@gnu.org> (message from Tassilo Horn on Fri, 07 Feb 2025 22:12:14 +0100) Subject: Re: bug#76132: Clojure-style auto-gensyms for macros References: <871pw98no1.fsf@gnu.org> X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > From: Tassilo Horn > Date: Fri, 07 Feb 2025 22:12:14 +0100 > > in a recent bug report the topic macro hygiene came up, i.e., that a > macro which introduces local bindings in its expansion better uses > uninterned symbols for those in order not to clash with code passed as > macro arguments which are spliced into the expansion. > > Clojure has a very convenient feature to make that easy. While you can > write such macros traditionally like > > (defmacro foo [x y] > (let [xv (gensym "x") > yv (gensym "y")] > `(let [,xv ,x > ,yv ,y] > (do-stuff (* ,xv ,xv) (* ,yv ,yv))))) > > you can also write much more concise and convenient > > (defmacro foo [x y] > `(let [xv# ,x > yv# ,y] > (do-stuff (* xv# xv#) (* yv# yv#)))) > > where each symbol ending in # will be replaced by a unique gensymed > symbol (per name). The expansion of the two macros is the same. > > Would there be interest in adding something like that to Elisp? I'm very hesitant to extend the Emacs Lisp language with such features, when this can be had for a price of a simple function call. We have enough magic names and punctuation characters already, and they get in the way of code readability. Stefan, WDYT? From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 08 03:29:18 2025 Received: (at 76132) by debbugs.gnu.org; 8 Feb 2025 08:29:18 +0000 Received: from localhost ([127.0.0.1]:38280 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tggDF-00084C-Pk for submit@debbugs.gnu.org; Sat, 08 Feb 2025 03:29:18 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:34084) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tggDD-00083x-4p for 76132@debbugs.gnu.org; Sat, 08 Feb 2025 03:29:16 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tggD7-0004YM-7n; Sat, 08 Feb 2025 03:29:09 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-Version:Date:References:In-Reply-To:Subject:To: From; bh=MiSIrO9g2oR31OW0cLp+rnj++3hdEDzWXvAqUpzGPkw=; b=XIRbmr31NNq4wDuRZWeF UfzRZdrItujk/z6A9SQ0JjJvULosZQ/JpX7xnh4x9UrKbmqkbHMOZ4L2LHtV+Dr0xTf4cHUkGuIHO DazCERTlKU4ZEsbxQB28sMJeyDFaKoNetZqFZDeKVbH63WBL4fZtxPvSjzr3GHOqMFH5Nd8R4hu7k VgI87kuOcsnf0SPgNKER2I9cMwskvJNHatKaJYsTE7PVcRh1l2TmkhoIWR+3pA5bNuog6BoPqQAPq x6F8dnI/KjS98/oj/BgWU4bHfUZz4M1BL/vGmwosYYihvhfb9tKHNOsLy2Z0GTH2/re9kLzhZmJPv jhGPVhVQfeSsJA==; X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdefudejudcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefhvfevufgjfhgffffkgggtsehttdertddtredt necuhfhrohhmpefvrghsshhilhhoucfjohhrnhcuoehtshguhhesghhnuhdrohhrgheqne cuggftrfgrthhtvghrnhepleduvdegfeduvdejkeefteelgeetgfevhefhueffueffgeeh gfeufefgvdffgedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilh hfrhhomhepthhhohhrnhdomhgvshhmthhprghuthhhphgvrhhsohhnrghlihhthidqkeei jeefkeejkeegqdeifeehvdelkedqthhsughhpeepghhnuhdrohhrghesfhgrshhtmhgrih hlrdhfmhdpnhgspghrtghpthhtohepfedpmhhouggvpehsmhhtphhouhhtpdhrtghpthht ohepjeeiudefvdesuggvsggsuhhgshdrghhnuhdrohhrghdprhgtphhtthhopehmohhnnh hivghrsehirhhordhumhhonhhtrhgvrghlrdgtrgdprhgtphhtthhopegvlhhiiiesghhn uhdrohhrgh X-ME-Proxy: Feedback-ID: ib2b94485:Fastmail From: Tassilo Horn To: Eli Zaretskii Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: <86h65450rw.fsf@gnu.org> References: <871pw98no1.fsf@gnu.org> <86h65450rw.fsf@gnu.org> User-Agent: mu4e 1.12.8; emacs 31.0.50 Date: Sat, 08 Feb 2025 09:29:04 +0100 Message-ID: <87msewhmb3.fsf@gnu.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org, Stefan Monnier X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Eli Zaretskii writes: >> Would there be interest in adding something like that to Elisp? > > I'm very hesitant to extend the Emacs Lisp language with such > features, when this can be had for a price of a simple function call. > We have enough magic names and punctuation characters already, and > they get in the way of code readability. In my opinion, readability is the key point of the feature. With the regular "declare the locals you need to introduce beforehand and then splice them into the expansion" approach, the distinction between locals and spliced-in macro args gets lost. With the suggested with-uninterned-symbols macro, it's clear that foo$ is a local defined in the expansion while ,foo is something from "the outside". I'm not booked on the $-suffix, though. It's just easy to type, stands out a bit and usually isn't used in the wild. Bye, Tassilo From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 08 08:02:38 2025 Received: (at 76132) by debbugs.gnu.org; 8 Feb 2025 13:02:38 +0000 Received: from localhost ([127.0.0.1]:39106 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tgkTl-0008Jt-KF for submit@debbugs.gnu.org; Sat, 08 Feb 2025 08:02:38 -0500 Received: from mail-ua1-x933.google.com ([2607:f8b0:4864:20::933]:59803) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.84_2) (envelope-from ) id 1tgkTj-0008Je-Ge for 76132@debbugs.gnu.org; Sat, 08 Feb 2025 08:02:36 -0500 Received: by mail-ua1-x933.google.com with SMTP id a1e0cc1a2514c-86714f41f5bso192584241.3 for <76132@debbugs.gnu.org>; Sat, 08 Feb 2025 05:02:35 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1739019750; x=1739624550; darn=debbugs.gnu.org; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:from:to:cc:subject:date:message-id:reply-to; bh=2Ad8/+CmB7QVzgaFtLBNoWE3fw/zoNWxkYS5M2sxT20=; b=fP3oWHkZkoJyXzUuJ6rvb15p5NfMe58chAo4fE0kBdSAsJvlhNETv9lcI9aUZDdWGe xtrHyKeR6kmJq3Hj6Es4EUpw1HQICqGFfW0gzmcAg4roH4qilP+cfY+EXQG7jlDDpCxE puzkc7QyXB/hrWSJsVs8ym0jOb/kNQjx8mpAhlnLY9oD/NNLahZA8DKneqYfqRYhRhwv Q9o6MGnuAQY+Zm0SnxyyNUXWju5c2QhtgEprzVLNx58fsgpIJVyP0HBMtE6bK+bijR8j hD4iU/tMfNR2+hg1r/US8+PeqG+Id7QoeygD6yS2Hp4jpwdstVeMF1+4IficEnDje2Mw wQ4A== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1739019750; x=1739624550; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:x-gm-message-state:from:to:cc:subject:date:message-id :reply-to; bh=2Ad8/+CmB7QVzgaFtLBNoWE3fw/zoNWxkYS5M2sxT20=; b=jgcEzVEHt13mrufXIJN8DaLMFnDIQDeSyxjPtMnQMv8PzPJNnnj5ASZuorIdplH38I 648Hi34Um2EmkxiRrFbbCSbL9RpOaUTOxL4A7U0ZIlYK62iXboMsPWd95h39EB9Kn+b8 3KnJB1AZAypQImPLfQYZ1S4WRSGbLIVsZuO8zKMc7Ec679aJKu+6AbDzj7QmgAsrtkhk ZKOtEdVe2IrK5oqJWtQllrOtPQ11SQim5TMEvDAOBumjtqgGP6hlDZ+3Zb/lgjo/1+o6 tElPPRsMWUkAcoMILAskRsLcbTYLSx/BAs+GEafQHKEdySzQAbhdjS8jZU2Dv4bRCnvL 5M7w== X-Forwarded-Encrypted: i=1; AJvYcCXiqrYzRm28RzaWqevfEFzqd1a3L7iJau9zx2eduXcEjAVdHPxl7J7x437+Wd8Cm6u8XuCtew==@debbugs.gnu.org X-Gm-Message-State: AOJu0YyXH2fKeHXp7rstxPTRHG2pAjTCPzMU2eJsA0udCqbvr2Px4TP8 VgEvTSE0gJQGaPoQavfR8yN15IVUdOpeIy3KnuhC4qDI8D2swK8Lvn1LatWW0adWJLMVIhpcZ9/ KZVSilXkD0wp5FtkRrVlMSuQIefg= X-Gm-Gg: ASbGncuYdOKZg0lFAnsQ0fnfJKdcGV0EpIL4trlfC4iFEOeByg1/9Fh1rr6lPS6E58V ttaBBgv129HGWBf8q390pimBujk9RBAZBo2ViMlDWRam/MlLTgJj00nAK7qiU8dxMWUUklD/y X-Google-Smtp-Source: AGHT+IHw4ekwub1BFe1ugLcLwC0aHB9Ez60tNUNg2N2quJKXnTF+VIgUj0lwtLgFTB8d3ozjO7qd+zHOI9If0Orz1xQ= X-Received: by 2002:a05:6122:c99:b0:518:97c2:f21a with SMTP id 71dfb90a1353d-51f2e2428f9mr5906674e0c.6.1739019749785; Sat, 08 Feb 2025 05:02:29 -0800 (PST) MIME-Version: 1.0 References: <871pw98no1.fsf@gnu.org> <86h65450rw.fsf@gnu.org> <87msewhmb3.fsf@gnu.org> In-Reply-To: <87msewhmb3.fsf@gnu.org> From: Ship Mints Date: Sat, 8 Feb 2025 08:02:18 -0500 X-Gm-Features: AWEUYZmw0K9JJOb7PZG88QhtKkD6Q6mf6BhZ0U5Qw483jrN2ohcFI6y1bwZA0AM Message-ID: Subject: Re: bug#76132: Clojure-style auto-gensyms for macros To: Tassilo Horn Content-Type: multipart/alternative; boundary="000000000000718458062da11671" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 76132 Cc: Eli Zaretskii , 76132@debbugs.gnu.org, Stefan Monnier X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --000000000000718458062da11671 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable I've seen many unhygienic macros (found the hard way) and written some myself out of laziness. It's a nice idea to encourage safer lazy macro writing. I prefer a hat ^ prefix as it is easier to read, rather than a dollar $ suffix which seems muddled to my eye. I found no evidence of symbols with a ^ prefix in the Emacs code base or in the elpa packages I use so would risk less conflict than $ which I have seen around. I'd highlight these hat-prefixed symbols in some nice new font-lock face. (defmacro sm/test (x y) (with-uninterned-symbols `(let ((^foo ,x) (^bar ,y)) (list :args `(,^foo . ,^bar) :add (+ ^foo ^bar) :sub (- ^foo ^bar) :mul (* ^foo ^bar) :div (/ ^foo ^bar))))) -Stephane On Sat, Feb 8, 2025 at 3:30=E2=80=AFAM Tassilo Horn wrote: > Eli Zaretskii writes: > > >> Would there be interest in adding something like that to Elisp? > > > > I'm very hesitant to extend the Emacs Lisp language with such > > features, when this can be had for a price of a simple function call. > > We have enough magic names and punctuation characters already, and > > they get in the way of code readability. > > In my opinion, readability is the key point of the feature. With the > regular "declare the locals you need to introduce beforehand and then > splice them into the expansion" approach, the distinction between locals > and spliced-in macro args gets lost. With the suggested > with-uninterned-symbols macro, it's clear that foo$ is a local defined > in the expansion while ,foo is something from "the outside". > > I'm not booked on the $-suffix, though. It's just easy to type, stands > out a bit and usually isn't used in the wild. > > Bye, > Tassilo > > > > --000000000000718458062da11671 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
I've seen many unhygienic macros (found the hard way) and written so= me myself out of laziness. It's a nice idea to encourage safer lazy mac= ro writing.

I= prefer a hat ^ prefix as it is easier to read, rather than a dollar $ suff= ix which seems muddled to=C2=A0my eye.

I found no evidence of symbols with a ^ prefix i= n the Emacs code base or in the elpa packages I use so would risk less conf= lict than $ which I have seen around. I'd highlight these hat-prefixed= =C2=A0symbols in some nice new font-lock face.

(defmacro sm/test (x y)
=C2=A0 (with-= uninterned-symbols
=C2=A0 =C2=A0`(let ((^foo ,x)
=C2=A0 =C2=A0 =C2=A0= =C2=A0 =C2=A0 (^bar ,y))
=C2=A0 =C2=A0 =C2=A0 (list :args `(,^foo . ,^b= ar)
=C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 :add =C2=A0 (+ ^foo ^bar)<= br>=C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 :sub =C2=A0 (- ^foo ^bar)
= =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 :mul =C2=A0 (* ^foo ^bar)
=C2= =A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 :div =C2=A0 (/ ^foo ^bar)))))

<= div class=3D"gmail_default" style=3D"font-family:monospace">-Stephane
=

On Sat, Feb 8, 2025 at 3:30=E2=80=AFAM Tassilo Horn &= lt;tsdh@gnu.org> wrote:
Eli Zaretskii <eliz@gnu.org> writes:

>> Would there be interest in adding something like that to Elisp? >
> I'm very hesitant to extend the Emacs Lisp language with such
> features, when this can be had for a price of a simple function call.<= br> > We have enough magic names and punctuation characters already, and
> they get in the way of code readability.

In my opinion, readability is the key point of the feature.=C2=A0 With the<= br> regular "declare the locals you need to introduce beforehand and then<= br> splice them into the expansion" approach, the distinction between loca= ls
and spliced-in macro args gets lost.=C2=A0 With the suggested
with-uninterned-symbols macro, it's clear that foo$ is a local defined<= br> in the expansion while ,foo is something from "the outside".

I'm not booked on the $-suffix, though.=C2=A0 It's just easy to typ= e, stands
out a bit and usually isn't used in the wild.

Bye,
Tassilo



--000000000000718458062da11671-- From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 08 10:29:21 2025 Received: (at 76132) by debbugs.gnu.org; 8 Feb 2025 15:29:21 +0000 Received: from localhost ([127.0.0.1]:41065 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tgmll-0001yH-6K for submit@debbugs.gnu.org; Sat, 08 Feb 2025 10:29:21 -0500 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:44425) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tgmlh-0001xz-K5 for 76132@debbugs.gnu.org; Sat, 08 Feb 2025 10:29:19 -0500 Received: from pmg2.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg2.iro.umontreal.ca (Proxmox) with ESMTP id 95B31809E5; Sat, 8 Feb 2025 10:29:10 -0500 (EST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1739028549; bh=CnypsmLxgxPjzpMNI17bzVAj5+BmWe1/YxadC0CZWzM=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=HKpxlAdSPkMkPj3rvLo0EReVkiwRuxGBFLBVzy0f3UDwyZ2r0+4pZjnWxSH5o9fXt 9SdG2JW0ml4iaDwxD1QWyBgB1v5C/ewk26LbKVetHakrBXVCkXf+K88a2e+cqV4dqE Rra83LrWee7m53yzcji+VIjmwfbcILlZPC4WCksu3io03CKcrrOUURVKhpNnzconh4 qFqC6Z5qYq/lDAzpbIiSio5+FJnojCpwZDFNYp0fzn4Fc50oM0pISEjOhhgem1F4yG lqgkq/lUQAIvutGRfBK8/UJbR+VXxOrb9loi6taYi/flOJHRoeYyGP1MxWKsXTzBde xRtcpwmjGpOXw== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg2.iro.umontreal.ca (Proxmox) with ESMTP id 9C81480191; Sat, 8 Feb 2025 10:29:09 -0500 (EST) Received: from pastel (104-195-232-86.cpe.teksavvy.com [104.195.232.86]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 370E7120480; Sat, 8 Feb 2025 10:29:09 -0500 (EST) From: Stefan Monnier To: Tassilo Horn Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: <871pw98no1.fsf@gnu.org> (Tassilo Horn's message of "Fri, 07 Feb 2025 22:12:14 +0100") Message-ID: References: <871pw98no1.fsf@gnu.org> Date: Sat, 08 Feb 2025 10:29:07 -0500 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.042 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > Clojure has a very convenient feature to make that easy. While you can > write such macros traditionally like > > (defmacro foo [x y] > (let [xv (gensym "x") > yv (gensym "y")] > `(let [,xv ,x > ,yv ,y] > (do-stuff (* ,xv ,xv) (* ,yv ,yv))))) > > you can also write much more concise and convenient > > (defmacro foo [x y] > `(let [xv# ,x > yv# ,y] > (do-stuff (* xv# xv#) (* yv# yv#)))) IIUC the two versions above aren't quite equivalent. The Clojure version seems to behave similarly to the macro you propose, which behaves more like: (let [xv (gensym "x") yv (gensym "y")] (defmacro foo [x y] `(let [,xv ,x ,yv ,y] (do-stuff (* ,xv ,xv) (* ,yv ,yv))))) in the sense that the same uninterned symbols will be used for every expansion. This is usually fine, but can still result in name capture in some weird corner cases (tho I must admit I can't even remember what those corner cases are). > I'm very hesitant to extend the Emacs Lisp language with such > features, when this can be had for a price of a simple function call. > We have enough magic names and punctuation characters already, and > they get in the way of code readability. To the extent that it's all implemented within a normal macro (i.e. doesn't touch things like the reader or the `macroexp.el` code), I'm not too bothered. It could even live in a separate package if we don't want it in core. Stefan From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 08 11:13:07 2025 Received: (at 76132) by debbugs.gnu.org; 8 Feb 2025 16:13:07 +0000 Received: from localhost ([127.0.0.1]:41123 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tgnS7-00072p-4V for submit@debbugs.gnu.org; Sat, 08 Feb 2025 11:13:07 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:54514) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tgnS3-00072H-Mw for 76132@debbugs.gnu.org; Sat, 08 Feb 2025 11:13:04 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tgnRx-00021e-1V; Sat, 08 Feb 2025 11:12:57 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-Version:Date:References:In-Reply-To:Subject:To: From; bh=gBTgWYNKF8zyXDGJFoxXOGmoIwgeLHgkxU+DnnPPg34=; b=SEtcuu1WXlKQ+rnTQPpz gi7c4nwmA0go0+Ho4Age6np5UkJ8PodqtJBj2/EOlOuETaJyEdYRc/eSQo4zkqVnK60lui1Y3Kahp X1gI3adQbfOFLP95GyulYcIBp6tq2okVUO1EKr08o4B4aXsZpmbr8HbUa+fkbIG2S7qK19JF5DKHx wCIcpE2AoKGVHp7IBWGyNKzGT52Npr8nW0eoEdv5C3Qdnx5I2r/vCaA1aFD7WfBpplGURq534j9X3 gaISBh1yH2Ujcukl5Gh2mZ9fj3sYB4OpVs294upHhqDTJ/n9kMaygjiODeVLrfsQdFZq9ix2g3dNQ W+SNJ5qSU0gnWw==; X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdefvdeiiecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefhvfevufgjfhgffffkgggtsehttdertddtredt necuhfhrohhmpefvrghsshhilhhoucfjohhrnhcuoehtshguhhesghhnuhdrohhrgheqne cuggftrfgrthhtvghrnhepleduvdegfeduvdejkeefteelgeetgfevhefhueffueffgeeh gfeufefgvdffgedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilh hfrhhomhepthhhohhrnhdomhgvshhmthhprghuthhhphgvrhhsohhnrghlihhthidqkeei jeefkeejkeegqdeifeehvdelkedqthhsughhpeepghhnuhdrohhrghesfhgrshhtmhgrih hlrdhfmhdpnhgspghrtghpthhtohepvddpmhhouggvpehsmhhtphhouhhtpdhrtghpthht ohepjeeiudefvdesuggvsggsuhhgshdrghhnuhdrohhrghdprhgtphhtthhopehmohhnnh hivghrsehirhhordhumhhonhhtrhgvrghlrdgtrg X-ME-Proxy: Feedback-ID: ib2b94485:Fastmail From: Tassilo Horn To: Stefan Monnier Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: References: <871pw98no1.fsf@gnu.org> User-Agent: mu4e 1.12.8; emacs 31.0.50 Date: Sat, 08 Feb 2025 17:12:00 +0100 Message-ID: <87ikpkmn5b.fsf@gnu.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Stefan Monnier writes: >> Clojure has a very convenient feature to make that easy. While you >> can write such macros traditionally like >> >> (defmacro foo [x y] >> (let [xv (gensym "x") >> yv (gensym "y")] >> `(let [,xv ,x >> ,yv ,y] >> (do-stuff (* ,xv ,xv) (* ,yv ,yv))))) >> >> you can also write much more concise and convenient >> >> (defmacro foo [x y] >> `(let [xv# ,x >> yv# ,y] >> (do-stuff (* xv# xv#) (* yv# yv#)))) > > IIUC the two versions above aren't quite equivalent. > The Clojure version seems to behave similarly to the macro you > propose, which behaves more like: > > (let [xv (gensym "x") > yv (gensym "y")] > (defmacro foo [x y] > `(let [,xv ,x > ,yv ,y] > (do-stuff (* ,xv ,xv) (* ,yv ,yv))))) > > in the sense that the same uninterned symbols will be used for every > expansion. This is usually fine, but can still result in name capture > in some weird corner cases (tho I must admit I can't even remember > what those corner cases are). Why? I would expect that it's one set of uninterned symbols per expansion. I first tried implementing it with an alist instead of a hash-table and didn't think about the fact that my alist function arg is just a pointer to the head of the list so that when popping back from a recursive call where I pushed onto the list (that is, to its head), the new entry got lost. With that failing approach, every foo$ occurrence was substituted with a separate (make-symbol "foo"), so although the exansion looked correct, every #:foo in there was distinct from all other #:foo-s. Doesn't that contradict your statement? Oh, and obviously you made me curious about those weird corner cases. Please elaborate! ;-) Bye, Tassilo From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 09 03:33:10 2025 Received: (at 76132) by debbugs.gnu.org; 9 Feb 2025 08:33:10 +0000 Received: from localhost ([127.0.0.1]:43002 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1th2kX-0004nG-OT for submit@debbugs.gnu.org; Sun, 09 Feb 2025 03:33:10 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:43042) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1th2kU-0004mr-Kk for 76132@debbugs.gnu.org; Sun, 09 Feb 2025 03:33:08 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1th2kO-0001Es-PI; Sun, 09 Feb 2025 03:33:00 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-Version:Date:References:In-Reply-To:Subject:To: From; bh=LUcbkETBqD2ltCnYSaE8DAoDENky3NGKelhPZX1eqkI=; b=IqSiEo5mlDA0r4q6AJQO OVr0r0u3UsQjKEaq/LAmAIMT218/uw9fgs5ie7KXBu5i/aOpdoBbri2X0NSV+GVnAhqwNnhMUPa2c 2uNf+Pkh8gQOGNOCTT09awvZPw0clVrABetiTrPYFOkLsFL6tUK5yJQtscRB9oC+clt2eiDndT7Xg pHEqs71k22przYMVf/c0libR3SzJ4/rIqmXwq46MTBdH2UXpP793uA/M0FLx5F7hZegP/jriIhww4 WWjFUCWhYMXRHYesqpPPeSQPYjypekK9KrblQw2XzxN/wDhHmbEikVvb4Rqnv7r8Y6RGamKLoTkc4 EwGTAsl8nxeolA==; X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdefgeeiiecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefhvfevufgjfhgffffkgggtsehttdertddtredt necuhfhrohhmpefvrghsshhilhhoucfjohhrnhcuoehtshguhhesghhnuhdrohhrgheqne cuggftrfgrthhtvghrnhepleduvdegfeduvdejkeefteelgeetgfevhefhueffueffgeeh gfeufefgvdffgedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilh hfrhhomhepthhhohhrnhdomhgvshhmthhprghuthhhphgvrhhsohhnrghlihhthidqkeei jeefkeejkeegqdeifeehvdelkedqthhsughhpeepghhnuhdrohhrghesfhgrshhtmhgrih hlrdhfmhdpnhgspghrtghpthhtohepgedpmhhouggvpehsmhhtphhouhhtpdhrtghpthht ohepmhhonhhnihgvrhesihhrohdruhhmohhnthhrvggrlhdrtggrpdhrtghpthhtohepje eiudefvdesuggvsggsuhhgshdrghhnuhdrohhrghdprhgtphhtthhopegvlhhiiiesghhn uhdrohhrghdprhgtphhtthhopehshhhiphhmihhnthhssehgmhgrihhlrdgtohhm X-ME-Proxy: Feedback-ID: ib2b94485:Fastmail From: Tassilo Horn To: Ship Mints Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: References: <871pw98no1.fsf@gnu.org> <86h65450rw.fsf@gnu.org> <87msewhmb3.fsf@gnu.org> User-Agent: mu4e 1.12.8; emacs 31.0.50 Date: Sun, 09 Feb 2025 09:32:54 +0100 Message-ID: <87ed07cybt.fsf@gnu.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: Eli Zaretskii , 76132@debbugs.gnu.org, Stefan Monnier X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Ship Mints writes: > I prefer a hat ^ prefix as it is easier to read, rather than a dollar > $ suffix which seems muddled to my eye. I don't mind what character to use (the macro could even take it as an argument) but I'd prefer using a suffix simply because there's already the special prefix _ indicating to the byte-compiler that this variable is not used intentionally. You might want to use that capability when your macro expands to a function which needs to have a certain signature but your implementation doesn't use all arguments, for example. Bye, Tassilo From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 09 04:22:26 2025 Received: (at 76132) by debbugs.gnu.org; 9 Feb 2025 09:22:26 +0000 Received: from localhost ([127.0.0.1]:43114 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1th3WD-00076L-Se for submit@debbugs.gnu.org; Sun, 09 Feb 2025 04:22:26 -0500 Received: from mail-vk1-xa2c.google.com ([2607:f8b0:4864:20::a2c]:53551) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.84_2) (envelope-from ) id 1th3WA-000760-F8 for 76132@debbugs.gnu.org; Sun, 09 Feb 2025 04:22:23 -0500 Received: by mail-vk1-xa2c.google.com with SMTP id 71dfb90a1353d-5203d852d68so22653e0c.3 for <76132@debbugs.gnu.org>; Sun, 09 Feb 2025 01:22:22 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1739092936; x=1739697736; darn=debbugs.gnu.org; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:from:to:cc:subject:date:message-id:reply-to; bh=Ztyq4et44PotHPBIe6S3Kx3VFcAba0inq+vlRxMooiI=; b=mI6YY3lnq8BNhhzTiWM6Rcfg0hPw37kLkIytPeHmfrRC3CwlBONlQOhTAbLruBo5L4 B/h8J8IutjHTlr0cpv1vemkVR+fGR03RCMpcw/lpdNOckgAF1RB4WNoZRbWG+9suGpPX 1vziD+1DOzHKQ+VEJXmdiGdeH2Rh9NFH/Y1BPPxbri72kz+GbI8DDvqmxVteDAXiuWQs 7HNNFvYqan46oYel6U9v82I4xM3gxXyoTn6ZvIR+a2kneNCJXModVkNuDApNZ9EEHqdJ RcJK/4z0ROwy0wadJwluzyfrRtoxb1an+YGT6pb1oAOIbDJj3l3R6LYDzRydxxL1sTSa Kdrw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1739092936; x=1739697736; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:x-gm-message-state:from:to:cc:subject:date:message-id :reply-to; bh=Ztyq4et44PotHPBIe6S3Kx3VFcAba0inq+vlRxMooiI=; b=Nf/JTgOvV7NdBnBzXJD4FQ3927wH3STBJOBjRXB/2GWUq47trgLlhH0ZgT7DT+KWFX uc1s843Ty6C/HNbv8Wrh0VQclUlcxMTOKkgCiKqhfT45ztT720ULTyp6Xt3Qz/xNZiuH m1ehYSqAV9SQqcbMEAuOJZaeNMEavKbY/y43YPgdnfClL5F35KDmThbgo8J7kdVFwgwE VutuSWKeptyxKn8yaUaDdMe011dSkzoqlZxlM4nX6JQ7glx106klHi1z/MKx+mMwtjV2 fh/qN0zlPyL0qxEC3fyGXfIoAtDvN1nPSG+dLfPEdn6XWAmrtOtZI5ME9SJINiWWHBl4 lZWg== X-Forwarded-Encrypted: i=1; AJvYcCV28NAfxtpjKIX1Oj0OOxTMl3z7f3lqCriPgL1E7nHlaxRoP72QjIeA1xgqoB7DvZOnxS4ung==@debbugs.gnu.org X-Gm-Message-State: AOJu0Yz7TpmlNBy3GpX611uqHWgjlKnYh4pLBmF61zCGfrnslGJsl5eQ US3LA/VnfKSD7f8S78ZIKLqKHpAw6f6KU2Vdxe0bI2gxkmMKNbKzCNU9IchEf0rZDpY/tt7fGcq v6pSqct+tuNH4RzEkubXYL7FxoMc= X-Gm-Gg: ASbGnctSKXgUDoOXKTBmebvOdSUA9kx0ExUoN53m6SCMRNBW7plnzQyQJbhMTHTGkRI 4rENbUP9vHZoZiOoWqMkWe5cTh86PxNSlXiBiEXSJ7+32tRhtuIw39mpMQ+5Jbc2BLE+ojrQ1 X-Google-Smtp-Source: AGHT+IHDtdPK+IUWoSXMg5+/XE0/mPaYMGJkGFCNQFp470EAz0G9JFOveRVgtntVGiNQ8jQla/7UiNWWCR09u16/r1s= X-Received: by 2002:a05:6122:2191:b0:51b:b750:8303 with SMTP id 71dfb90a1353d-51f2e2d6a17mr6973315e0c.11.1739092936538; Sun, 09 Feb 2025 01:22:16 -0800 (PST) MIME-Version: 1.0 References: <871pw98no1.fsf@gnu.org> <86h65450rw.fsf@gnu.org> <87msewhmb3.fsf@gnu.org> <87ed07cybt.fsf@gnu.org> In-Reply-To: <87ed07cybt.fsf@gnu.org> From: Ship Mints Date: Sun, 9 Feb 2025 04:22:05 -0500 X-Gm-Features: AWEUYZnZrQfJfun6W1xhEino_RkflWcFl1du98mzhDzX_UHXTLAcr5sUiLmc_L8 Message-ID: Subject: Re: bug#76132: Clojure-style auto-gensyms for macros To: Tassilo Horn Content-Type: multipart/alternative; boundary="000000000000b6c0fe062db22057" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 76132 Cc: Eli Zaretskii , 76132@debbugs.gnu.org, Stefan Monnier X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --000000000000b6c0fe062db22057 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Good point on _. A suffix works. ^ suggests the mnemonic "it comes from above." (defmacro sm/test (x y) (with-uninterned-symbols `(let ((foo^ ,x) (bar^ ,y)) (list :args `(,foo^ . ,bar^) :add (+ foo^ bar^) :sub (- foo^ bar^) :mul (* foo^ bar^) :div (/ foo^ bar^))))) On Sun, Feb 9, 2025 at 3:33=E2=80=AFAM Tassilo Horn wrote: > Ship Mints writes: > > > I prefer a hat ^ prefix as it is easier to read, rather than a dollar > > $ suffix which seems muddled to my eye. > > I don't mind what character to use (the macro could even take it as an > argument) but I'd prefer using a suffix simply because there's already > the special prefix _ indicating to the byte-compiler that this variable > is not used intentionally. You might want to use that capability when > your macro expands to a function which needs to have a certain signature > but your implementation doesn't use all arguments, for example. > > Bye, > Tassilo > --000000000000b6c0fe062db22057 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
Good point on _. A suffix works. ^ suggests the mnemonic "it comes = from above."

(defmacro sm/test (x y)
=C2=A0 (with-uninterned-symbols
=C2=A0 = =C2=A0`(let ((foo^ ,x)
=C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 (bar^ ,y))
= =C2=A0 =C2=A0 =C2=A0 (list :args `(,foo^ . ,bar^)
=C2=A0 =C2=A0 =C2=A0 = =C2=A0 =C2=A0 =C2=A0 :add =C2=A0 (+ foo^ bar^)
=C2=A0 =C2=A0 =C2=A0 =C2= =A0 =C2=A0 =C2=A0 :sub =C2=A0 (- foo^ bar^)
=C2=A0 =C2=A0 =C2=A0 =C2=A0 = =C2=A0 =C2=A0 :mul =C2=A0 (* foo^ bar^)
=C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2= =A0 =C2=A0 :div =C2=A0 (/ foo^ bar^)))))

On = Sun, Feb 9, 2025 at 3:33=E2=80=AFAM Tassilo Horn <tsdh@gnu.org> wrote:
Ship Mints <shipmints@gmail.com> writes:

> I prefer a hat ^ prefix as it is easier to read, rather than a dollar<= br> > $ suffix which seems muddled to my eye.

I don't mind what character to use (the macro could even take it as an<= br> argument) but I'd prefer using a suffix simply because there's alre= ady
the special prefix _ indicating to the byte-compiler that this variable
is not used intentionally.=C2=A0 You might want to use that capability when=
your macro expands to a function which needs to have a certain signature but your implementation doesn't use all arguments, for example.

Bye,
Tassilo
--000000000000b6c0fe062db22057-- From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 09 04:51:53 2025 Received: (at 76132) by debbugs.gnu.org; 9 Feb 2025 09:51:53 +0000 Received: from localhost ([127.0.0.1]:43178 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1th3yj-00007Q-8h for submit@debbugs.gnu.org; Sun, 09 Feb 2025 04:51:53 -0500 Received: from sendmail.purelymail.com ([34.202.193.197]:57892) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1th3yg-000079-8w for 76132@debbugs.gnu.org; Sun, 09 Feb 2025 04:51:51 -0500 DKIM-Signature: a=rsa-sha256; b=gwtb2WQPD+fTqRS3JCYBMAdX5I1Y5KxorIrKaHeeO7vfuTy56HT2EUeqIgeNDWB4bp7aLOR7iynS1nAd8DdVodTwmceGhQIib6pL4z15nT4MaZwbQIwUNWpPQRQsAdvMHN5QMtsUY7Q5ioav9x7OsJU6HsdHlcih5PB4Vqt6WD0D0J4Ck6oWCglTGMIOxxfdUn0pET3ILMpQ0mSCeo94h9oPLVeCCQ/RXIW1VU3RMPWH3Wha3XDwOhJ9SNGiXpy0r8RT5YPKCro1+3BTS8WPELP+Xxj5cHLZAbFYoo9nwn1ZlKIhldYYyBGVUvO/rMmmUziHFAB846n7hDgxsaZpiA==; s=purelymail2; d=spwhitton.name; v=1; bh=O4jD8T/O1EtXIghFBsJY/mZ1zk74qoH5MUp4TYbHXDk=; h=Received:Received:From:To:Subject:Date; DKIM-Signature: a=rsa-sha256; b=UGQ79okZHHN3BA8LiAAK+lKLcbVHv4X4vSBgZjLv/Z5ASoNqDapPPJZGYMbGUXkBwG5AWw9X6XtK95sUKfViDZqChKey9n/v8aADGbBcXKsNehvE7ZQfPcQXMRo9/Z6059JNRqb8jRwiOMZAjKvW8pHVLjmQSnEuZyyPGDmIraT67f4AdTxIvAxlam3McZSkwY+XRc3LQ5kL4vZV+crJhUkXgv7gZ0F+drAjLdrGEH6W34YyjqCMbS0FVd4s/F+sJNKyibL5fdZXFEfDL3mnjb4QHq2++2wbnDSSz7I/hfbM3qneN9JuxiBQhH735G3VPa6qLHd+cCMRUAwGiBBF/A==; s=purelymail2; d=purelymail.com; v=1; bh=O4jD8T/O1EtXIghFBsJY/mZ1zk74qoH5MUp4TYbHXDk=; h=Feedback-ID:Received:Received:From:To:Subject:Date; Feedback-ID: 20115:3760:null:purelymail X-Pm-Original-To: 76132@debbugs.gnu.org Received: by smtp.purelymail.com (Purelymail SMTP) with ESMTPSA id 641021296; (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384); Sun, 09 Feb 2025 09:51:41 +0000 (UTC) Received: by melete.silentflame.com (Postfix, from userid 1000) id 04CEE7E93DD; Sun, 9 Feb 2025 09:51:38 +0000 (GMT) From: Sean Whitton To: Eli Zaretskii , Tassilo Horn , Stefan Monnier , 76132@debbugs.gnu.org Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: <86h65450rw.fsf@gnu.org> (Eli Zaretskii's message of "Sat, 08 Feb 2025 09:54:59 +0200") References: <871pw98no1.fsf@gnu.org> <86h65450rw.fsf@gnu.org> Date: Sun, 09 Feb 2025 09:51:38 +0000 Message-ID: <878qqfxx79.fsf@melete.silentflame.com> User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 76132 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hello, On Sat 08 Feb 2025 at 09:54am +02, Eli Zaretskii wrote: > I'm very hesitant to extend the Emacs Lisp language with such > features, when this can be had for a price of a simple function call. > We have enough magic names and punctuation characters already, and > they get in the way of code readability. Yeah. I think we should not add this for the similar reasons to how we don't have reader macros: Lisp is an almost syntax-free language, and there are advantages to that. Any step away from that cuts deeply into the advantages, and the corresonding benefits of the new syntax are often very minor. cl-with-gensyms is only slightly more typing, and is more trad Lisp style. -- Sean Whitton From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 09 07:51:50 2025 Received: (at 76132) by debbugs.gnu.org; 9 Feb 2025 12:51:50 +0000 Received: from localhost ([127.0.0.1]:43520 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1th6ms-0003Lz-2Y for submit@debbugs.gnu.org; Sun, 09 Feb 2025 07:51:50 -0500 Received: from mail-ed1-x532.google.com ([2a00:1450:4864:20::532]:53570) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.84_2) (envelope-from ) id 1th6mo-0003Lg-LC for 76132@debbugs.gnu.org; Sun, 09 Feb 2025 07:51:48 -0500 Received: by mail-ed1-x532.google.com with SMTP id 4fb4d7f45d1cf-5de5a8a96abso2135720a12.3 for <76132@debbugs.gnu.org>; Sun, 09 Feb 2025 04:51:46 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1739105500; x=1739710300; darn=debbugs.gnu.org; h=to:subject:message-id:date:mime-version:references:in-reply-to:from :from:to:cc:subject:date:message-id:reply-to; bh=wRSm1PCOzNf3LDq8EJSdQUQ38V84OSODTivMf2mdME8=; b=Vo+wCRSr/ExOWs0bpqaKDCcbj5yE1Rgw+jJ2MFRrFvufncHDBhNNSONZJq/8ognXTZ /IWxmjP82yNJ6TvSMNEpbHXs7mb5dCIoMV+OdaN6yOg3LM6hvH9XYky2GKegjUvM7UiV p+lU6Aw+71ifEBEjErNgNdeUObeo6Q7OYicgyYN1wHyleLTgkvail1LZJpBNar/IoSRB UQ3VS54znRLjnWUjl9ZOZt4I8uBiksTSv+FiasPROPxsiGZI2vrNUExLD2Bcu9JPvIWJ Z9Qf4SH7RkI9Akr5j9ZXZem8UxPUmm9MRTkgkPR3jky63ByLvqerRk5K75FgtMlNmzL6 twhA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1739105500; x=1739710300; h=to:subject:message-id:date:mime-version:references:in-reply-to:from :x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=wRSm1PCOzNf3LDq8EJSdQUQ38V84OSODTivMf2mdME8=; b=wfMXNnmjnvo+XRkBW/wROyk9Z/g5/0LNPI7CKqZLG8JKy9cKUT/gO4GseN8P5Adi1N LNdkgVt9lDHx07KHyHYOGpp/ucoCEqa/waOePS0nnqYcA2XrFTRwiAR5/zd8Yi7bMX7P F4FiIP0656ZaXpJ1RwB/6G+291yVOG01ER1VMmFzXQr8FSFbkBXFTTDxFm1pHCpauQKp WK25K2Y6lEJO5Rn9Hzi0G+8YW10uwEjzsNcEafGWgk+t1sznMbkSARs6NWuaCNYLvQqu ms8sLvLzq3MgwLcBY0sn8CKcLvVO4IaX8WpjDY9FsxSVQnMoU+fbBvFU00gGIQxSVdF/ 7Qfg== X-Forwarded-Encrypted: i=1; AJvYcCUKVrQSjLH5z1FB6S0XKfSw5G3J6j9j5jK7bUpKiiWI+WAJPvgEVOXFNqwqQFzr5MDMrZrWIw==@debbugs.gnu.org X-Gm-Message-State: AOJu0YwEBkB2G6iM5UGKno5KEQRjlhHDuO+aUDYmapriL08D19pp5Rkt uptvpkbWsbXBgDM3cF8bPetZNSiO9FRUAzmg2mISxCa9h0Va0UjuKuM4TwTrtrmxylE50i7ePvO 5+/qHgBmvMmbxBSKk2hP4s7oOREo= X-Gm-Gg: ASbGncu36kp49yHfvgK73Y8zG2JyprrzkAWY/FbIXpBuQ1qhn7hoxiTqpEPtg7YdzbF e7LF2Ybc01lQpGYkqsiNIo+XJBFnHsWXPjs1JryFcRgSOSmhAenTzHeSO/2tpVaq4b/z6ZnQo17 o= X-Google-Smtp-Source: AGHT+IH3jqnorutqr0mnlpYRTIM7Fa+L5cf2cem76qQB8s2BfJ5ngr6y85/04USzsNgdwqEjhGkgf29b6U+DXBOmdMM= X-Received: by 2002:a05:6402:358f:b0:5dc:8f03:bb5b with SMTP id 4fb4d7f45d1cf-5de44fe944emr24648633a12.5.1739105500102; Sun, 09 Feb 2025 04:51:40 -0800 (PST) Received: from 753933720722 named unknown by gmailapi.google.com with HTTPREST; Sun, 9 Feb 2025 07:51:39 -0500 From: Stefan Kangas In-Reply-To: <878qqfxx79.fsf@melete.silentflame.com> References: <871pw98no1.fsf@gnu.org> <86h65450rw.fsf@gnu.org> <878qqfxx79.fsf@melete.silentflame.com> MIME-Version: 1.0 Date: Sun, 9 Feb 2025 07:51:39 -0500 X-Gm-Features: AWEUYZndqBZXIlRJyJgvXy5wrmwiuR_GuBgc8ljb8Z6BPbT5pFAF3yhT5GUkNN4 Message-ID: Subject: Re: bug#76132: Clojure-style auto-gensyms for macros To: Sean Whitton , Eli Zaretskii , Tassilo Horn , Stefan Monnier , 76132@debbugs.gnu.org Content-Type: text/plain; charset="UTF-8" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 76132 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Sean Whitton writes: > On Sat 08 Feb 2025 at 09:54am +02, Eli Zaretskii wrote: > >> I'm very hesitant to extend the Emacs Lisp language with such >> features, when this can be had for a price of a simple function call. >> We have enough magic names and punctuation characters already, and >> they get in the way of code readability. > > Yeah. I think we should not add this for the similar reasons to how we > don't have reader macros: Lisp is an almost syntax-free language, and > there are advantages to that. > > Any step away from that cuts deeply into the advantages, and the > corresonding benefits of the new syntax are often very minor. > > cl-with-gensyms is only slightly more typing, and is more trad Lisp > style. I'd tend to agree, FWIW. From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 09 18:35:10 2025 Received: (at 76132) by debbugs.gnu.org; 9 Feb 2025 23:35:10 +0000 Received: from localhost ([127.0.0.1]:46880 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1thGpR-0006mu-UE for submit@debbugs.gnu.org; Sun, 09 Feb 2025 18:35:10 -0500 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:51002) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1thGpQ-0006ha-8z for 76132@debbugs.gnu.org; Sun, 09 Feb 2025 18:35:08 -0500 Received: from pmg2.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg2.iro.umontreal.ca (Proxmox) with ESMTP id C8C28800CB; Sun, 9 Feb 2025 18:35:01 -0500 (EST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1739144096; bh=uIqPtljE/Lp9WsVlHwnnLYgSrBVygX2Qd5OlP3ursF8=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=GY+UTSczp16qfwBMxjxD9oV9M5UPPIHLggJohvfzEQCgqOahfOW18avh0PSbbPOJy 3EmtTxgMSSVaMAhN3mBFG7W2BOXaer8VQl8rZZFRr7H94gcYD5X1BIN4vWkADRX1st n8UlmG0wiNSilwU3cRFpjLq0gBu16Teankdk6Bc0KDm+g6KlY4RJC6VegotdAUCyNC 7DjW9m83WgArXhWtP9peUxo8QJMMnjS1+TNSBoP/TI7CF59jHJCghM0CEBA6Cis/6S uhz8jNDdiTskbSp+Tlf2mX8awBleLw+RuWnQkRagoMeI373mf0QqeHUNbHJLfH1/cQ pDW83/TlkimNQ== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg2.iro.umontreal.ca (Proxmox) with ESMTP id BF493801B7; Sun, 9 Feb 2025 18:34:56 -0500 (EST) Received: from alfajor (104-195-232-86.cpe.teksavvy.com [104.195.232.86]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 9455712015E; Sun, 9 Feb 2025 18:34:56 -0500 (EST) From: Stefan Monnier To: Tassilo Horn Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: <87ikpkmn5b.fsf@gnu.org> (Tassilo Horn's message of "Sat, 08 Feb 2025 17:12:00 +0100") Message-ID: References: <871pw98no1.fsf@gnu.org> <87ikpkmn5b.fsf@gnu.org> Date: Sun, 09 Feb 2025 18:34:55 -0500 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.044 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > Why? I'd ask the author of the code. > I would expect that it's one set of uninterned symbols per expansion. Try: (defmacro my-foo (exp) (with-uninterned-symbols `(let ((x$ 6)) (+ x$ ,exp)))) and then check (equal (macroexpand '(my-foo r)) (macroexpand '(my-foo r))) [ Admittedly, this all depends on when `with-uninterned-symbols` is macro-expanded, but in most cases it will be macro-expanded once and for all when the macro is defined. ] > Doesn't that contradict your statement? Apparently not. =F0=9F=99=82 > Oh, and obviously you made me curious about those weird corner cases. > Please elaborate! ;-) I wish I could. I'm starting to wonder if I dreamed it. The best I could come up with is: (defmacro my-countref-let (var form &rest body) (with-uninterned-symbols `(let ((x$ ,form) (count$ 0)) (cl-symbol-macrolet ((,var (progn (cl-incf count$) x$))) (unwind-protect (progn ,@body) (message "%S ref'd %d times" ',var count$)))))) where (my-countref-let v1 67 (my-countref-let v2 89 (+ v1 v2))) will say that `v2` was referenced twice and `v1` zero times (at least if that macro is byte-compiled). Stefan From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 10 02:37:33 2025 Received: (at 76132) by debbugs.gnu.org; 10 Feb 2025 07:37:34 +0000 Received: from localhost ([127.0.0.1]:47860 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1thOMH-00022R-FD for submit@debbugs.gnu.org; Mon, 10 Feb 2025 02:37:33 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:45430) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1thOME-00022B-U3 for 76132@debbugs.gnu.org; Mon, 10 Feb 2025 02:37:31 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1thOM9-0003wF-2a; Mon, 10 Feb 2025 02:37:25 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-Version:Date:References:In-Reply-To:Subject:To: From; bh=3dTk0jOMTaixicfJcmVczBzerUI7PgshYJ+3jD5R6wk=; b=neoFwXIM5NwD7FSAJygP y66DzLM89kqZENmIc5gez3u9W/CWfMcJkmth00BTswPupHMWrHAZGD4zvIMLheLJ4TCFILE4kfYGH op3QqTff32s6ooXjOTawN3oO+s21nFnACM21CRiqV/LuOlXs9RHmPX+IBELzb+dVDs5RVfP6A0TyA 5dPPcEqzkUs/RY4qG4suxcfTpvkz+kKZZEkBMmO1aKkGLcmo1FyckobfZsJw4ZB6X2C7Sdr18YV8W MjgUGcjjvW2xJmWAtQdB/q5bLGu4KzvcjQX06OGnXv8OSh4WfimM8ScV4mmZv/f/JMVg2iHFxQXA9 9FDiudCZbFdWxA==; X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdefjeegkecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefhvfevufgjfhgffffkgggtsehttdertddtredt necuhfhrohhmpefvrghsshhilhhoucfjohhrnhcuoehtshguhhesghhnuhdrohhrgheqne cuggftrfgrthhtvghrnhepleduvdegfeduvdejkeefteelgeetgfevhefhueffueffgeeh gfeufefgvdffgedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilh hfrhhomhepthhhohhrnhdomhgvshhmthhprghuthhhphgvrhhsohhnrghlihhthidqkeei jeefkeejkeegqdeifeehvdelkedqthhsughhpeepghhnuhdrohhrghesfhgrshhtmhgrih hlrdhfmhdpnhgspghrtghpthhtohepvddpmhhouggvpehsmhhtphhouhhtpdhrtghpthht ohepjeeiudefvdesuggvsggsuhhgshdrghhnuhdrohhrghdprhgtphhtthhopehmohhnnh hivghrsehirhhordhumhhonhhtrhgvrghlrdgtrg X-ME-Proxy: Feedback-ID: ib2b94485:Fastmail From: Tassilo Horn To: Stefan Monnier Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: References: <871pw98no1.fsf@gnu.org> <87ikpkmn5b.fsf@gnu.org> User-Agent: mu4e 1.12.8; emacs 31.0.50 Date: Mon, 10 Feb 2025 08:36:54 +0100 Message-ID: <87y0yegsix.fsf@gnu.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Stefan Monnier writes: Hi Stefan, >> Why? > > I'd ask the author of the code. ;-) >> I would expect that it's one set of uninterned symbols per expansion. > > Try: > > (defmacro my-foo (exp) > (with-uninterned-symbols > `(let ((x$ 6)) > (+ x$ ,exp)))) > > and then check (equal (macroexpand '(my-foo r)) (macroexpand '(my-foo r))) That's shocking! :-| > [ Admittedly, this all depends on when `with-uninterned-symbols` is > macro-expanded, but in most cases it will be macro-expanded once and > for all when the macro is defined. ] Well, my naive assumption about macro expansion is that it's done lazily from inside-out. In that case, I would assume the macro works as I intended. Also nesting should be no problem, because when the outer with-uninterned-symbols is expanded, any inner with-uninterned-symbols has already been expanded so its own xs $ have been replaced with #:xs. I guess you are talking about eager macro expansion, right? I have no clue how that works and the docs don't tell either. Does it mean the macro is expanded once its defmacro form is reached and the resulting code is just inserted at its usages? But if that's the case, how are the macro arguments injected in the code at the right places? And furthermore, why does (defmacro th/my-foo (exp) (let ((x (make-symbol "x"))) `(let ((,x 6)) (+ ,x ,exp)))) not exhibit the exactly same problem? I guess it's because "the machine" knows that every ,foo needs to be once-per-expansion, right? Or maybe this dependency disables eager macro expansion for this macro altoghether? Is there a way to fix my macro? Maybe to define it so that it would result in something like (let-alist (collect-$-vars exp) ;; Now build a replacement for exp which uses ,.x accesses in place ;; of x$, e.g., this: `(let ((,.x 6)) (+ ,.x ,exp))) such that there's a "dependency" of the expansion to an expression that's evaluated at expansion time which in turn depends on exp? >> Oh, and obviously you made me curious about those weird corner cases. >> Please elaborate! ;-) > > I wish I could. I'm starting to wonder if I dreamed it. > The best I could come up with is: > > (defmacro my-countref-let (var form &rest body) > (with-uninterned-symbols > `(let ((x$ ,form) > (count$ 0)) > (cl-symbol-macrolet ((,var (progn (cl-incf count$) x$))) > (unwind-protect > (progn ,@body) > (message "%S ref'd %d times" ',var count$)))))) > > where (my-countref-let v1 67 (my-countref-let v2 89 (+ v1 v2))) will > say that `v2` was referenced twice and `v1` zero times (at least if > that macro is byte-compiled). Jesus Christ! ;-) Bye, Tassilo From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 10 09:21:15 2025 Received: (at 76132) by debbugs.gnu.org; 10 Feb 2025 14:21:16 +0000 Received: from localhost ([127.0.0.1]:49764 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1thUex-0002Hi-ED for submit@debbugs.gnu.org; Mon, 10 Feb 2025 09:21:15 -0500 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:41669) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1thUet-0002HQ-Ir for 76132@debbugs.gnu.org; Mon, 10 Feb 2025 09:21:13 -0500 Received: from pmg2.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg2.iro.umontreal.ca (Proxmox) with ESMTP id B706B8078F; Mon, 10 Feb 2025 09:21:04 -0500 (EST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1739197263; bh=RUg+mxBFqwXBG9FPwUmMy+EGkdpnbSJnXWBpbGLPR9U=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=PoB+tGbbNAY14MIH2aeCLF6zH+I2mqgbWqKMIVWtmtb95ajB8f4ISpISQx71YIorl WY74Mfo1zupMhkbt7zmETS8TuULYT0Tle5DBiHXOEBAdElc99oVrK3VsXK8faWcS0w vSDCREIoEMK2Lh8c5HsKsQhzY0AAjQlbFGKE912atXa+MwnX8y8e1qr24cZu4DXyET 13iCIzU6NDVLh6HW02k9Xj5yk2RYj0OyuHHQKoTr9q1TtaSUx5oAM6MW+3vDeSE0uT HjA9CI0vZNQrvGt3xLAK/1RZlI8I8L/mun8eQNPV6YsvKM2fLkzfjPpwMeGpq7TjEB SOfsD2vwrOggA== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg2.iro.umontreal.ca (Proxmox) with ESMTP id E1A64800CB; Mon, 10 Feb 2025 09:21:03 -0500 (EST) Received: from alfajor (104-195-232-86.cpe.teksavvy.com [104.195.232.86]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id B94131203DA; Mon, 10 Feb 2025 09:21:03 -0500 (EST) From: Stefan Monnier To: Tassilo Horn Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: <87y0yegsix.fsf@gnu.org> (Tassilo Horn's message of "Mon, 10 Feb 2025 08:36:54 +0100") Message-ID: References: <871pw98no1.fsf@gnu.org> <87ikpkmn5b.fsf@gnu.org> <87y0yegsix.fsf@gnu.org> Date: Mon, 10 Feb 2025 09:21:03 -0500 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.044 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) >> [ Admittedly, this all depends on when `with-uninterned-symbols` is >> macro-expanded, but in most cases it will be macro-expanded once and >> for all when the macro is defined. ] > Well, my naive assumption about macro expansion is that it's done lazily > from inside-out. Interesting: that's impossible. Think about a case like: (dolist (push pushes) (message "%S" `(pop ,push))) how can the macro expander decide whether or not `(push pushes)` and `(pop ,push)` are calls to macros `push` and `pop` without first macro-expanding `dolist` and backquote? Similarly, we can't compile the above code without first expanding all the macros. > And furthermore, why does > > (defmacro th/my-foo (exp) > (let ((x (make-symbol "x"))) > `(let ((,x 6)) > (+ ,x ,exp)))) > > not exhibit the exactly same problem? Because the above code says explicitly that `make-symbol` is called every time a call to `th/my-foo` is expanded. Whereas in your version, the code says that `make-symbol` is called every time a call to `with-uninterned-symbols` is expanded, but that can happen either when we define `my-foo` or when "use" my-foo (depending on whether the macroexpansion is done lazily or eagerly, and it can't be done lazily if we compile the macro). > Is there a way to fix my macro? I don't think so, in general. E.g. if you want to generate fresh new uninterned symbols every time the code is executed, then you can't compile something like (with-uninterned-symbols (let ((x$ 6)) (+ x$ exp))) since the name of the variable is not known until runtime (and will be different each time). I think to fix it, you have to fuse your macro with backquote, so users would write (defmacro my-other-foo (exp) (uninterned-backquote (let ((x$ 6)) (+ x$ ,exp)))) but of course you could still support the syntax (defmacro my-foo (exp) (with-uninterned-symbols `(let ((x$ 6)) (+ x$ ,exp)))) and simply have `with-uninterned-symbols` check that its argument is of the form `(...) and treat it as a use of `uninterned-backquote`. Stefan From debbugs-submit-bounces@debbugs.gnu.org Tue Feb 11 02:12:16 2025 Received: (at control) by debbugs.gnu.org; 11 Feb 2025 07:12:16 +0000 Received: from localhost ([127.0.0.1]:53871 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1thkRL-0007FT-RZ for submit@debbugs.gnu.org; Tue, 11 Feb 2025 02:12:16 -0500 Received: from mail-ed1-x533.google.com ([2a00:1450:4864:20::533]:50305) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.84_2) (envelope-from ) id 1thkRD-0007Dw-QA for control@debbugs.gnu.org; Tue, 11 Feb 2025 02:12:08 -0500 Received: by mail-ed1-x533.google.com with SMTP id 4fb4d7f45d1cf-5de7531434fso3712621a12.0 for ; Mon, 10 Feb 2025 23:12:07 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1739257922; x=1739862722; darn=debbugs.gnu.org; h=to:subject:message-id:date:mime-version:from:from:to:cc:subject :date:message-id:reply-to; bh=7Qq4XJnOtHD2ljcIfIpO0G+I5aQFUtgNFX4T5JkGte0=; b=j+77EmkFtsfNPsAyEZEzCcbTuKcdiwJqW2HK7GqnFAvyp5/WeV8cuB0j8+hl/WrfJN 7lH/liH9nwtS6oqZwHtE76/4drNlSLLpeUjN/boOb8NdsZmNbuN/gpzDzeyl4Rm7v+U7 RMqhCJ/mLIL5xn2773+AytVH9oiSSIPno4O1AGwy/rMsLk4KWzkhBHCdgA2o2xw32Yag PjWAZRqTPw4UtYkB56Kica6A5sNLdQAuHb8kFwmGF0FxUeuuvJu8vrRVjr1JEUGVwMtq Gbad1dzumBxYk2xmaGXU6ErT3qIiSaT8OpItkIk1YMq31wVr3SIjxQh7OSmTUgF1/Isl Jq9w== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1739257922; x=1739862722; h=to:subject:message-id:date:mime-version:from:x-gm-message-state :from:to:cc:subject:date:message-id:reply-to; bh=7Qq4XJnOtHD2ljcIfIpO0G+I5aQFUtgNFX4T5JkGte0=; b=fpYxXorLdP87/eL/6CkuGhAtmtwCQXYchaLlWhwe8Uf3Kwo9qjxyW1NlOLpxjLKato sDkSClzCsiy0q7LHTPOeUdLDdHDXNbzKEIbPX7mrXOO4K7F82OUDYvHXkpoqfeD3HUgr 4Kaj3QkYc6UkgtnDcFK4o3BUjNzaD9xJg9/ZlyOY4mqPdXopL1/hM6Oe+rexEWUvYzPo crDD7qf0mHrOAHzIYxGG6YavveLFVqYWwMObLdFQqnLAxOHsaa2aatE38PC4mSuk0Igq kPmXy+d4vM/xsH5dYTgnBDk7VhPDrI2ApXvEnhO0cIvV9G6j8nEWSOPVWHZo9TSL4ulo tKwA== X-Gm-Message-State: AOJu0YyEtCeyx+kZspvgb0Zx/r+ocrqz7PVbWEnDIf9MoK52HOyy3Hft T/wu91Xsd5WnjA2BN5UdiRPcRvN6FmhAkIbvHPD9/trAL2zmCSn6q9ctlZyEdr0xvF+6td2MpuL lrCMkPlTsamgkyct2ec1JbgluKemS1NFxsUo= X-Gm-Gg: ASbGncuwlVVaFTHVa2zWsfOlKKuEnUdvQqw/08SPxHR8ZPbLe9eeXXCvQh6vnmk5fkc y8lpkGjClFhgvhCHMkZhzoFrJSohuwd0wKY0Sk/ukCF90M54YAb29ULYMI8sMn8hXHAHGbEGV/w == X-Google-Smtp-Source: AGHT+IGtp5wWjBMmya1Vee9wLM+126XdhPGoi+NgB5dtpVnekq3LYJAHQchLpF+FM5O2H/ehLlUIpfWfoOlbR1JqEUk= X-Received: by 2002:a05:6402:1ecf:b0:5dc:1395:1d3a with SMTP id 4fb4d7f45d1cf-5de45040136mr16024302a12.1.1739257921434; Mon, 10 Feb 2025 23:12:01 -0800 (PST) Received: from 753933720722 named unknown by gmailapi.google.com with HTTPREST; Mon, 10 Feb 2025 23:12:01 -0800 From: Stefan Kangas MIME-Version: 1.0 Date: Mon, 10 Feb 2025 23:12:01 -0800 X-Gm-Features: AWEUYZlwgXsjR1BfzeOjKxOyNkZk5j0_XLqPkMMA8ZYxUPM3hLQRf-_bGU2EnwE Message-ID: Subject: control message for bug #76132 To: control@debbugs.gnu.org Content-Type: text/plain; charset="UTF-8" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: control X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) severity 76132 wishlist quit From debbugs-submit-bounces@debbugs.gnu.org Wed Feb 12 05:42:15 2025 Received: (at 76132) by debbugs.gnu.org; 12 Feb 2025 10:42:15 +0000 Received: from localhost ([127.0.0.1]:32867 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tiAC6-0000Yp-Ok for submit@debbugs.gnu.org; Wed, 12 Feb 2025 05:42:15 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:37980) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tiAC4-0000Yb-4g for 76132@debbugs.gnu.org; Wed, 12 Feb 2025 05:42:13 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tiABx-00038P-Ej; Wed, 12 Feb 2025 05:42:06 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=Date:References:Subject:In-Reply-To:To:From: mime-version; bh=dWd6oPKdMnXyyo5pTo3ddu2pqQXc5Jyx1M55O+tW+yA=; b=hJLd5TTnCXg6 S0JhtuXqVtDkEYHyXXmUREBrqgQEQ14V/W+RcMmtNl1rdNb/I5zbaxX+H/PUkJL3ouU61QibMdVxZ 6qqyZvTgPPgUuyDJt1LlPe2pYphGAXCg/gRM9VXMJSj5T8UZ3Lab31lu1RjErkDkJLAGftXWDaxjR AKRvHF3tlR4WeNlhlD07dnG3KfHvI6D3oGNWTd0gvAmPwhio+iZhmF8sww7fWgG9SnJrUxIDsuWxe kezP/xukJiiJRv3oVhKxdK6ZdvwSJDpjpiqQHVMLrJxay0RlelhekJZn+X3sN6MPVpTdGyxSv5/6V jn5YYUPkI/JfQwAijO3TMQ==; Received: from rms by fencepost.gnu.org with local (Exim 4.90_1) (envelope-from ) id 1tiABJ-0002Xs-N4; Wed, 12 Feb 2025 05:41:25 -0500 Content-Type: text/plain; charset=Utf-8 From: Richard Stallman To: Stefan Monnier In-Reply-To: (bug-gnu-emacs@gnu.org) Subject: Re: bug#76132: Clojure-style auto-gensyms for macros References: <871pw98no1.fsf@gnu.org> <87ikpkmn5b.fsf@gnu.org> Message-Id: Date: Wed, 12 Feb 2025 05:41:25 -0500 X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org, tsdh@gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: rms@gnu.org Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) [[[ To any NSA and FBI agents reading my email: please consider ]]] [[[ whether defending the US Constitution against all enemies, ]]] [[[ foreign or domestic, requires you to follow Snowden's example. ]]] > (defmacro my-foo (exp) > (with-uninterned-symbols > `(let ((x$ 6)) > (+ x$ ,exp)))) with-uninterned-symbols does not seem to exist in my checkout. Is it new? Proposed? I can guess from the example what it does. It is terribly un-Lispy. Let's use this syntax instead: (with-uninterned-symbols (x) `(let ((,x 6)) (+ ,x ,exp))) It adds just one list of variables to the overall syntactic complexity of the construct when used, and it adds nothing to the syntax of Lipp. We could use the name `with-gensyms', a shorter name. -- Dr Richard Stallman (https://stallman.org) Chief GNUisance of the GNU Project (https://gnu.org) Founder, Free Software Foundation (https://fsf.org) Internet Hall-of-Famer (https://internethalloffame.org) From debbugs-submit-bounces@debbugs.gnu.org Wed Feb 12 05:53:47 2025 Received: (at 76132) by debbugs.gnu.org; 12 Feb 2025 10:53:47 +0000 Received: from localhost ([127.0.0.1]:32887 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tiANG-00014Z-Qq for submit@debbugs.gnu.org; Wed, 12 Feb 2025 05:53:47 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:39780) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tiAND-00014G-VG for 76132@debbugs.gnu.org; Wed, 12 Feb 2025 05:53:45 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tiAN7-0005St-SH; Wed, 12 Feb 2025 05:53:37 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-Version:Date:References:In-Reply-To:Subject:To: From; bh=1/UqbkBUIlhMiNtPi1foQbRobvuxRrThEtsseejk/e0=; b=NUuDX+sMKLBzeWQwcPSL PLkSP1XAEiw8jlsjnLhSiB2Zu2HuiJDo0fFUXU+TJFd0V2yeuQ2fxIDy6mqkpQDhVR9J3jL4Yauyb q9jMafeOmihhiTIAajmC7Oct1ZE2G9/zBegibwiC2GKPaEOOCKLOtMzXh9hW7ylQWdPkLQHw5EFsS G4HaoswZkXhdDtrjwgOUpDxh35vwEjQ3jXmQyHtWWG7DqBCRpwNuVdcwMw1e1CnrwRYwYbGPvJNwv e3XkkbQK0nfnkXoofhdG1AiSapq5W3vtFJO6Pl58gH/giTtDb3u15y8qJ1Zwv5dSUqBEJFmfB61YM b6b1g+/luaRiIQ==; X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdegfeeilecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefhvfevufgjfhgffffkgggtsehttdertddtredt necuhfhrohhmpefvrghsshhilhhoucfjohhrnhcuoehtshguhhesghhnuhdrohhrgheqne cuggftrfgrthhtvghrnhepleduvdegfeduvdejkeefteelgeetgfevhefhueffueffgeeh gfeufefgvdffgedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilh hfrhhomhepthhhohhrnhdomhgvshhmthhprghuthhhphgvrhhsohhnrghlihhthidqkeei jeefkeejkeegqdeifeehvdelkedqthhsughhpeepghhnuhdrohhrghesfhgrshhtmhgrih hlrdhfmhdpnhgspghrtghpthhtohepfedpmhhouggvpehsmhhtphhouhhtpdhrtghpthht ohepjeeiudefvdesuggvsggsuhhgshdrghhnuhdrohhrghdprhgtphhtthhopehmohhnnh hivghrsehirhhordhumhhonhhtrhgvrghlrdgtrgdprhgtphhtthhopehrmhhssehgnhhu rdhorhhg X-ME-Proxy: Feedback-ID: ib2b94485:Fastmail From: Tassilo Horn To: Richard Stallman Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: References: <871pw98no1.fsf@gnu.org> <87ikpkmn5b.fsf@gnu.org> User-Agent: mu4e 1.12.8; emacs 31.0.50 Date: Wed, 12 Feb 2025 11:53:29 +0100 Message-ID: <87pljnzb6e.fsf@gnu.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org, Stefan Monnier X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Richard Stallman writes: Hi Richard, > [[[ To any NSA and FBI agents reading my email: please consider ]]] > [[[ whether defending the US Constitution against all enemies, ]]] > [[[ foreign or domestic, requires you to follow Snowden's example. ]]] > > > (defmacro my-foo (exp) > > (with-uninterned-symbols > > `(let ((x$ 6)) > > (+ x$ ,exp)))) > > with-uninterned-symbols does not seem to exist in my checkout. > Is it new? Proposed? Yes, I've proposed it but as it stands, it's already declined. That's totally acceptable for me given the details of eager macro expansion Stefan M. explained to me. > I can guess from the example what it does. It is terribly un-Lispy. > Let's use this syntax instead: > > (with-uninterned-symbols (x) > `(let ((,x 6)) > (+ ,x ,exp))) > > It adds just one list of variables to the overall syntactic complexity > of the construct when used, and it adds nothing to the syntax of Lipp. > > We could use the name `with-gensyms', a shorter name. That's already available, named cl-with-gensyms and defined in cl-macs.el. But truth to be told, that exhibits the very same problem that my proposed macro also has, i.e., that (equal (macroexpand '(cl-with-gensyms (x) `(+ ,x ,x))) (macroexpand '(cl-with-gensyms (x) `(+ ,x ,x)))) ;;=> t meaning that every expansion uses the very same uninterned symbol x, not one unique symbol x per expansion. As Stefan explained, that can lead to problems in certain (honestly quite uncommon) corner-cases. Bye, Tassilo From debbugs-submit-bounces@debbugs.gnu.org Wed Feb 12 08:56:02 2025 Received: (at 76132) by debbugs.gnu.org; 12 Feb 2025 13:56:02 +0000 Received: from localhost ([127.0.0.1]:33349 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tiDDe-0007oK-7U for submit@debbugs.gnu.org; Wed, 12 Feb 2025 08:56:02 -0500 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:23153) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tiDDb-0007no-B5 for 76132@debbugs.gnu.org; Wed, 12 Feb 2025 08:55:59 -0500 Received: from pmg2.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg2.iro.umontreal.ca (Proxmox) with ESMTP id 38AE88092A; Wed, 12 Feb 2025 08:55:53 -0500 (EST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1739368552; bh=ib6RA0k9eXKRJrzxcQls1JfwFNeB9U81tloOr4oQigE=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=aWLqxsG2aa2tpfOeriukDrQL3wm8vZ8E9s0sIM68qtFR+ov86CSQRCnYFSGltb6dl 9G5enFUEJg6czMocJudxUZ5QI/bsTUH2JTMPmpcYxb4EOv23UXeN99+DJHcgZj9WPM WLVukyHpr+7xLg86lRX9DFY1TIU7dddBQ2uzhA0ZwmNKCOC9zws3wGtrAV+7NLK+/h DH/xECNMN+q/+YXVV+qPyQC0JCv/hCRS4p3a3jKdEydfRaZrDi20YN0muWrK4nAJOY NjvNLsMtncFJzGXV6K8n7F+oymKKX0xfvwLfzrtw4CO/r7jiryS5YTb55AZNh1osLs pwEeqvy5MeKyg== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg2.iro.umontreal.ca (Proxmox) with ESMTP id 7B23F80683; Wed, 12 Feb 2025 08:55:52 -0500 (EST) Received: from pastel (104-195-232-86.cpe.teksavvy.com [104.195.232.86]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 4E0CD1204F5; Wed, 12 Feb 2025 08:55:52 -0500 (EST) From: Stefan Monnier To: Tassilo Horn Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: <87pljnzb6e.fsf@gnu.org> (Tassilo Horn's message of "Wed, 12 Feb 2025 11:53:29 +0100") Message-ID: References: <871pw98no1.fsf@gnu.org> <87ikpkmn5b.fsf@gnu.org> <87pljnzb6e.fsf@gnu.org> Date: Wed, 12 Feb 2025 08:55:51 -0500 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.043 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org, Richard Stallman X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > (equal (macroexpand '(cl-with-gensyms (x) > `(+ ,x ,x))) > (macroexpand '(cl-with-gensyms (x) > `(+ ,x ,x)))) > ;;=> t That doesn't test what you think it does because (macroexpand '(cl-with-gensyms (x) `(+ ,x ,x))) does not return any uninterned symbols. It returns the code which *when executed* will generate a new uninterned symbol. Try (equal (eval (macroexpand '(cl-with-gensyms (x) `(+ ,x ,x)))) (eval (macroexpand '(cl-with-gensyms (x) `(+ ,x ,x))))) - Stefan From debbugs-submit-bounces@debbugs.gnu.org Wed Feb 12 09:02:23 2025 Received: (at 76132) by debbugs.gnu.org; 12 Feb 2025 14:02:24 +0000 Received: from localhost ([127.0.0.1]:33396 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tiDJn-00089a-J0 for submit@debbugs.gnu.org; Wed, 12 Feb 2025 09:02:23 -0500 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:55320) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tiDJl-00089J-MK for 76132@debbugs.gnu.org; Wed, 12 Feb 2025 09:02:21 -0500 Received: from pmg3.iro.umontreal.ca (localhost [127.0.0.1]) by pmg3.iro.umontreal.ca (Proxmox) with ESMTP id 25D33442245; Wed, 12 Feb 2025 09:02:16 -0500 (EST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1739368935; bh=UE1gFmUmz9rv6RJe9qGw4y3Sfi0Dw0C6NyuoIuIWyPU=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=FTUEYpS+fwh3R3NZ3GR2ECydz1bFZop8LbPFEE/AvDrHByPx0XtJ0SIJZjvJSv9on M7RpIMP0+1Vk+Pk5U2jLhmx3JrthcJgkIj/15iKXvzjjm4esskOchRmsExrLDuviv+ mR4ii0hnwvX0bwxchLlpeRlj3bN5iIyuJqTK0WGlJLGJr8NG0SgzIcK8EZF9Wy/YiK Nf2fs4S/7dRYRMxgdr4ZTw19Icd0DAB08D53pkH55x2KhrBbrN3qkQv6yI8Y2IKpxn 8U7DAS6CNS5q9jy7iuvmOwiGsDHya2XF3sVbkemM0IFyas3+pW3dcdxKf0XDR57j9L lhAxSygbMm1fA== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg3.iro.umontreal.ca (Proxmox) with ESMTP id 46292441CB7; Wed, 12 Feb 2025 09:02:15 -0500 (EST) Received: from pastel (104-195-232-86.cpe.teksavvy.com [104.195.232.86]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id 0F64B120371; Wed, 12 Feb 2025 09:02:15 -0500 (EST) From: Stefan Monnier To: Tassilo Horn Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: (Stefan Monnier's message of "Wed, 12 Feb 2025 08:55:51 -0500") Message-ID: References: <871pw98no1.fsf@gnu.org> <87ikpkmn5b.fsf@gnu.org> <87pljnzb6e.fsf@gnu.org> Date: Wed, 12 Feb 2025 09:02:14 -0500 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.018 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org, Richard Stallman X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > does not return any uninterned symbols. It returns the code which *when > executed* will generate a new uninterned symbol. Try > > (equal (eval (macroexpand '(cl-with-gensyms (x) > `(+ ,x ,x)))) > (eval (macroexpand '(cl-with-gensyms (x) > `(+ ,x ,x))))) Actually a more precise test would be: (let ((codegen (macroexpand-all '(cl-with-gensyms (x) `(+ ,x ,x))))) (equal (eval codegen t) (eval codegen t))) - Stefan From debbugs-submit-bounces@debbugs.gnu.org Wed Feb 12 09:19:49 2025 Received: (at 76132) by debbugs.gnu.org; 12 Feb 2025 14:19:49 +0000 Received: from localhost ([127.0.0.1]:33449 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tiDaf-0000Xp-7E for submit@debbugs.gnu.org; Wed, 12 Feb 2025 09:19:49 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:37910) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tiDac-0000XP-G3 for 76132@debbugs.gnu.org; Wed, 12 Feb 2025 09:19:47 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tiDaW-0002nw-5o; Wed, 12 Feb 2025 09:19:40 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-Version:Date:References:In-Reply-To:Subject:To: From; bh=zHsDzn6yAvKgrmHZBfTf9hfbyiWSk+OIowgSv4g3UB8=; b=BQxASCzX6hw09j/uUDrA 6C8NK0T8Kitc7BlwOQjwfp3Ri32XJsFOe0yvFUfRQzQ7hmbv8MkepXQkG5EuDNJRWYL5jQuMYnUxS BO9G65stx6rDM28D6brAAfRmG5UCe46sH8m/c/+B46IPXm/hEpqi1+yw2+ZAQCuP7RmJIW9tVdALD ePForyF6g/itpMXb1CFCh+fN8oM4Jj2L+BqxHF8WD6T8zCdi8LvFIbsBk2FhSRB+2qv4y9UqsISEB Z5YqjI/mxXEh6J+BrbqXQr59CnJ2/jMvbeXP+cipOjpD++3ArbxNXL4g1ilLJWLPGkd/MrRhC3oVU f8jbhU5E0bFugQ==; X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdeggedutdcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefhvfevufgjfhgffffkgggtsehttdertddtredt necuhfhrohhmpefvrghsshhilhhoucfjohhrnhcuoehtshguhhesghhnuhdrohhrgheqne cuggftrfgrthhtvghrnhepleduvdegfeduvdejkeefteelgeetgfevhefhueffueffgeeh gfeufefgvdffgedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilh hfrhhomhepthhhohhrnhdomhgvshhmthhprghuthhhphgvrhhsohhnrghlihhthidqkeei jeefkeejkeegqdeifeehvdelkedqthhsughhpeepghhnuhdrohhrghesfhgrshhtmhgrih hlrdhfmhdpnhgspghrtghpthhtohepfedpmhhouggvpehsmhhtphhouhhtpdhrtghpthht ohepjeeiudefvdesuggvsggsuhhgshdrghhnuhdrohhrghdprhgtphhtthhopehrmhhsse hgnhhurdhorhhgpdhrtghpthhtohepmhhonhhnihgvrhesihhrohdruhhmohhnthhrvggr lhdrtggr X-ME-Proxy: Feedback-ID: ib2b94485:Fastmail From: Tassilo Horn To: Stefan Monnier Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: References: <871pw98no1.fsf@gnu.org> <87ikpkmn5b.fsf@gnu.org> <87pljnzb6e.fsf@gnu.org> User-Agent: mu4e 1.12.8; emacs 31.0.50 Date: Wed, 12 Feb 2025 15:19:27 +0100 Message-ID: <87jz9vz1n4.fsf@gnu.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org, Richard Stallman X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Stefan Monnier writes: >> (equal (macroexpand '(cl-with-gensyms (x) >> `(+ ,x ,x))) >> (macroexpand '(cl-with-gensyms (x) >> `(+ ,x ,x)))) >> ;;=> t > > That doesn't test what you think it does because > > (macroexpand '(cl-with-gensyms (x) `(+ ,x ,x))) > > does not return any uninterned symbols. It returns the code which > *when executed* will generate a new uninterned symbol. Try > > (equal (eval (macroexpand '(cl-with-gensyms (x) > `(+ ,x ,x)))) > (eval (macroexpand '(cl-with-gensyms (x) > `(+ ,x ,x))))) Argh, indeed. Thanks, Tassilo From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 23 00:40:36 2025 Received: (at 76132) by debbugs.gnu.org; 23 Feb 2025 05:40:36 +0000 Received: from localhost ([127.0.0.1]:58846 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tm4jE-0001ZP-6i for submit@debbugs.gnu.org; Sun, 23 Feb 2025 00:40:36 -0500 Received: from mail-ed1-x532.google.com ([2a00:1450:4864:20::532]:56716) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.84_2) (envelope-from ) id 1tm4jB-0001Z6-9Q for 76132@debbugs.gnu.org; Sun, 23 Feb 2025 00:40:34 -0500 Received: by mail-ed1-x532.google.com with SMTP id 4fb4d7f45d1cf-5ded368fcd9so4771465a12.1 for <76132@debbugs.gnu.org>; Sat, 22 Feb 2025 21:40:33 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1740289227; x=1740894027; darn=debbugs.gnu.org; h=cc:to:subject:message-id:date:mime-version:references:in-reply-to :from:from:to:cc:subject:date:message-id:reply-to; bh=s7AhuSR3Q7cVhDiwIga0GpsJtKPFCg1Gr+SvckWqa3Y=; b=LGP2e6X1zuyBIu6HU9bbNhJFzStPSAL8TBj5/5Slyfyqzp0GzQn25Ja2NhdNa/CkhS YoU845u6ObFthqmqt2FOdN852JmnvJzCC/ph2I3a0UVheTHNo0z6EMZWbBXDTW0slA2y eNqOWwSysLbJSMWYAaO5S7cfDGvu1OEamIxU8gH4x/V1zTSctGKbSsGS/NjJ0v5XwFJ2 XuT5KMs8nhIbnI3unVfBWYs39kGAt79Th8EqZigFidaFxWvV+e2JE3ta/M0vpWh43S0o cns82vHTkg+YNxBlhrkGzwGCrO/05M7z0w3vn3UXCYDzqevsfFCCddNziDSRh7z6qO1k I9hQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1740289227; x=1740894027; h=cc:to:subject:message-id:date:mime-version:references:in-reply-to :from:x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=s7AhuSR3Q7cVhDiwIga0GpsJtKPFCg1Gr+SvckWqa3Y=; b=wgDBU+JpMQCRQrnY3F4B9TVAbBV3bXod4DCym9SLavPvsEyp7Ty+6R4blI3iU16jIw TaPN0z4fsCdzS0CbSAXrMJk0GBWDhSVBmFQUbty4ZtK58/NTPD5txtExeoowAleyVvCU nBDwXFfKVAZEcq5cv0xjJVcNnxTsc4kpP5mgb+cid+F4znp0xV9ZUEwkG2ax7Se9Wtig b8LjM5R5mtRZ4lyERFchEF5klOE/gd9fk9Zr208OXFpr+XXcaR4Rhoyv4/zGeJ8G1ZGW bYePAWSifPNPlPVd66usmIVfQxtBCFWmmMjO/8pkmL9Hm9T37pKud6NOgplJhD65/82E VgpA== X-Forwarded-Encrypted: i=1; AJvYcCXkbw/lBZo7vPY1+9QdPg3aClr3o6hJ90B1BOA1MyebIJcZvzY+zHVAg1IO/nyCNh76b4KQfw==@debbugs.gnu.org X-Gm-Message-State: AOJu0YxmRVfWRqKpe0h5584VUI/nzsdMKSpzWEFtYm3y5WggLJ9BHDUj /AOUyHkIdttNicNjmSiDGh+Ew6m2MbvFains1h/FlYzZmfmb8XgwpCZGDP8PpOO6OnG3raTCkY4 Nqorc0OTvqmJyobhZpJNGj+zfZlA= X-Gm-Gg: ASbGncvBvqVp7Uf1HoLEVaozJ3Q4buWgCld/i8tC7JzaxmsW3q60CWzPlMl5EiYDZW1 Pq8JI6+ow835I4mZlEt9I71nnH2OyTL8GlRaK2oI5tNC4nAuItzaIa5zLcyVW9HZ8iD1kupe96d jVsdq6hpmL X-Google-Smtp-Source: AGHT+IHc0zi6V8G8VLlLBzf3W5/WAdTDFPJqUMhfb98rxm/duUGUR/0oUY1NA3R8JHr5pwaot3vf15+QjfLbLDjFlmI= X-Received: by 2002:a05:6402:3554:b0:5dc:5a34:1296 with SMTP id 4fb4d7f45d1cf-5e0b70ef77dmr8683027a12.16.1740289227216; Sat, 22 Feb 2025 21:40:27 -0800 (PST) Received: from 753933720722 named unknown by gmailapi.google.com with HTTPREST; Sun, 23 Feb 2025 05:40:26 +0000 From: Stefan Kangas In-Reply-To: <87pljnzb6e.fsf@gnu.org> References: <871pw98no1.fsf@gnu.org> <87ikpkmn5b.fsf@gnu.org> <87pljnzb6e.fsf@gnu.org> MIME-Version: 1.0 Date: Sun, 23 Feb 2025 05:40:26 +0000 X-Gm-Features: AWEUYZlrufIKeGW8tcKqgUuLKMVAqdtqK_2fIvYOj1CBBoVUBzkB2sLyhhR1nf0 Message-ID: Subject: Re: bug#76132: Clojure-style auto-gensyms for macros To: Tassilo Horn Content-Type: text/plain; charset="UTF-8" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 76132 Cc: 76132@debbugs.gnu.org, Richard Stallman , Stefan Monnier X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Tassilo Horn writes: > Richard Stallman writes: > > Hi Richard, > >> [[[ To any NSA and FBI agents reading my email: please consider ]]] >> [[[ whether defending the US Constitution against all enemies, ]]] >> [[[ foreign or domestic, requires you to follow Snowden's example. ]]] >> >> > (defmacro my-foo (exp) >> > (with-uninterned-symbols >> > `(let ((x$ 6)) >> > (+ x$ ,exp)))) >> >> with-uninterned-symbols does not seem to exist in my checkout. >> Is it new? Proposed? > > Yes, I've proposed it but as it stands, it's already declined. That's > totally acceptable for me given the details of eager macro expansion > Stefan M. explained to me. > >> I can guess from the example what it does. It is terribly un-Lispy. >> Let's use this syntax instead: >> >> (with-uninterned-symbols (x) >> `(let ((,x 6)) >> (+ ,x ,exp))) >> >> It adds just one list of variables to the overall syntactic complexity >> of the construct when used, and it adds nothing to the syntax of Lipp. >> >> We could use the name `with-gensyms', a shorter name. > > That's already available, named cl-with-gensyms and defined in > cl-macs.el. But truth to be told, that exhibits the very same problem > that my proposed macro also has, i.e., that > > (equal (macroexpand '(cl-with-gensyms (x) > `(+ ,x ,x))) > (macroexpand '(cl-with-gensyms (x) > `(+ ,x ,x)))) > ;;=> t > > meaning that every expansion uses the very same uninterned symbol x, not > one unique symbol x per expansion. As Stefan explained, that can lead > to problems in certain (honestly quite uncommon) corner-cases. > > Bye, > Tassilo So what's the conclusion here? Should this bug be closed, or is there more left to discuss? From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 23 04:11:37 2025 Received: (at 76132-done) by debbugs.gnu.org; 23 Feb 2025 09:11:37 +0000 Received: from localhost ([127.0.0.1]:59283 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tm81R-0004ZU-Cr for submit@debbugs.gnu.org; Sun, 23 Feb 2025 04:11:37 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:36712) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tm81O-0004Z8-76 for 76132-done@debbugs.gnu.org; Sun, 23 Feb 2025 04:11:34 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1tm81I-0006XY-Md; Sun, 23 Feb 2025 04:11:28 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-Version:Date:References:In-Reply-To:Subject:To: From; bh=sdXTzLDK+31Zy9ht+noerBwEPzfAz7poK3KpbsGTHpY=; b=YIQzNc4k+nDgWHyWjtGe BrhxWwRomQlT56OAou50KUKp4RsUS3HgcVG9PHVCHBH04nXE0DZnRXStUkZHTjKPNzw6KsnpNsgeD 1cPgua1csNq4rV99wXn9Hble6WYkWF7zT68/Ob/v5T0MGdDWgvO+2apFiohY78VKlOuT8d8FMtcxI qprRs45L/A5KAPJlNmE6NRESkPJAgMLc/B2A7HteeWgFv8bvIe1wZ0tenFgI1X1ZdmY6vvyL/wzwU JwLIvMOLDVyzZ3cB0BBJkQhm7tIStx1OwhA0LEF78OlJGQ9K0qTFzeCk9eJLgokHzof7gWFLyNE0d CfXE+5mldnr6mw==; X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdejheegvdcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefhvfevufgjfhgffffkgggtsehttdertddtredt necuhfhrohhmpefvrghsshhilhhoucfjohhrnhcuoehtshguhhesghhnuhdrohhrgheqne cuggftrfgrthhtvghrnhepleduvdegfeduvdejkeefteelgeetgfevhefhueffueffgeeh gfeufefgvdffgedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilh hfrhhomhepthhhohhrnhdomhgvshhmthhprghuthhhphgvrhhsohhnrghlihhthidqkeei jeefkeejkeegqdeifeehvdelkedqthhsughhpeepghhnuhdrohhrghesfhgrshhtmhgrih hlrdhfmhdpnhgspghrtghpthhtohepgedpmhhouggvpehsmhhtphhouhhtpdhrtghpthht ohepmhhonhhnihgvrhesihhrohdruhhmohhnthhrvggrlhdrtggrpdhrtghpthhtohepje eiudefvddqughonhgvseguvggssghughhsrdhgnhhurdhorhhgpdhrtghpthhtoheprhhm shesghhnuhdrohhrghdprhgtphhtthhopehsthgvfhgrnhhkrghnghgrshesghhmrghilh drtghomh X-ME-Proxy: Feedback-ID: ib2b94485:Fastmail From: Tassilo Horn To: Stefan Kangas Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: References: <871pw98no1.fsf@gnu.org> <87ikpkmn5b.fsf@gnu.org> <87pljnzb6e.fsf@gnu.org> User-Agent: mu4e 1.12.8; emacs 31.0.50 Date: Sun, 23 Feb 2025 10:11:08 +0100 Message-ID: <87zfidowk3.fsf@gnu.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132-done Cc: 76132-done@debbugs.gnu.org, Richard Stallman , Stefan Monnier X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Stefan Kangas writes: > So what's the conclusion here? Macros (in the presence of eager macro expansion) are hard. :-) > Should this bug be closed, or is there more left to discuss? No, I'm closing it now. Bye, Tassilo From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 23 11:20:07 2025 Received: (at 76132-done) by debbugs.gnu.org; 23 Feb 2025 16:20:07 +0000 Received: from localhost ([127.0.0.1]:35671 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1tmEi6-0001fw-VF for submit@debbugs.gnu.org; Sun, 23 Feb 2025 11:20:07 -0500 Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:4716) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from ) id 1tmEi4-0001cA-5W for 76132-done@debbugs.gnu.org; Sun, 23 Feb 2025 11:20:06 -0500 Received: from pmg2.iro.umontreal.ca (localhost.localdomain [127.0.0.1]) by pmg2.iro.umontreal.ca (Proxmox) with ESMTP id 4F15B80995; Sun, 23 Feb 2025 11:19:56 -0500 (EST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca; s=mail; t=1740327595; bh=CXtSdbXqr8AFJMnL5Mj8uV6goN3E2cCf0ZmoiWEQUf0=; h=From:To:Cc:Subject:In-Reply-To:References:Date:From; b=TqUBj3yX2TZFZbcctBmy7d5+h8BXrwcslhSLOdR72eU/TTW0BoyH0bZ3FSygmP10N /WmqhqA7vEx3NHgDQzE76Vv9EnUmJyqbUSbOaCeT4IFWmmq17m9QkrfAoPvs9KvoMB OYqk6qKbk3qnjfGySd5JdPujXBrRh0H7RbA5IIgocYWenRe9EG5MqKRKvtexztgd71 Q2Cil7SDsSn/zYWaWGQ+gKJQ0irLwlLUrr3PvbmLd9P/sSjvu/iAMBtbdUk0MhPPFq MXU00KTIzKafBLgLdCyXzRmsP/9ytlLNYU053xHtEXkCibeigOKFjdozIDIHgl7c42 +PCTRCaMnCexg== Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1]) by pmg2.iro.umontreal.ca (Proxmox) with ESMTP id 0B0638060A; Sun, 23 Feb 2025 11:19:55 -0500 (EST) Received: from pastel (unknown [104.247.242.5]) by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id CF558120607; Sun, 23 Feb 2025 11:19:54 -0500 (EST) From: Stefan Monnier To: Tassilo Horn Subject: Re: bug#76132: Clojure-style auto-gensyms for macros In-Reply-To: <87zfidowk3.fsf@gnu.org> (Tassilo Horn's message of "Sun, 23 Feb 2025 10:11:08 +0100") Message-ID: References: <871pw98no1.fsf@gnu.org> <87ikpkmn5b.fsf@gnu.org> <87pljnzb6e.fsf@gnu.org> <87zfidowk3.fsf@gnu.org> Date: Sun, 23 Feb 2025 11:19:53 -0500 User-Agent: Gnus/5.13 (Gnus v5.13) MIME-Version: 1.0 Content-Type: text/plain X-SPAM-INFO: Spam detection results: 0 ALL_TRUSTED -1 Passed through trusted hosts only via SMTP AWL -0.229 Adjusted score from AWL reputation of From: address BAYES_00 -1.9 Bayes spam probability is 0 to 1% DKIM_SIGNED 0.1 Message has a DKIM or DK signature, not necessarily valid DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's domain DKIM_VALID_EF -0.1 Message has a valid DKIM or DK signature from envelope-from domain X-SPAM-LEVEL: X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 76132-done Cc: 76132-done@debbugs.gnu.org, Stefan Kangas , Richard Stallman X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Tassilo Horn [2025-02-23 10:11:08] wrote: > Stefan Kangas writes: >> So what's the conclusion here? > Macros (in the presence of eager macro expansion) are hard. :-) Historical notes about "eager macro expansion": - Macros have been expanded eagerly in Emacs since the introduction of a byte-compiler, i.e. before even Emacs-18. - Macros are designed specifically to allow "eager macro expansion". In early Lisp there was another mechanism which supported only lazy expansion, called [fexpr](https://en.wikipedia.org/wiki/Fexpr). They died because of their fundamental incompatibility with compilation. Stefan From unknown Sun Aug 17 22:01:40 2025 Received: (at fakecontrol) by fakecontrolmessage; To: internal_control@debbugs.gnu.org From: Debbugs Internal Request Subject: Internal Control Message-Id: bug archived. Date: Mon, 24 Mar 2025 11:24:08 +0000 User-Agent: Fakemail v42.6.9 # This is a fake control message. # # The action: # bug archived. thanks # This fakemail brought to you by your local debbugs # administrator