From unknown Thu Aug 14 21:51:35 2025 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 X-Mailer: MIME-tools 5.509 (Entity 5.509) Content-Type: text/plain; charset=utf-8 From: bug#73355 <73355@debbugs.gnu.org> To: bug#73355 <73355@debbugs.gnu.org> Subject: Status: 29.4; eglot-rename reports success when it shouldn't Reply-To: bug#73355 <73355@debbugs.gnu.org> Date: Fri, 15 Aug 2025 04:51:35 +0000 retitle 73355 29.4; eglot-rename reports success when it shouldn't reassign 73355 emacs submitter 73355 Joost Kremers severity 73355 normal thanks From debbugs-submit-bounces@debbugs.gnu.org Thu Sep 19 08:01:39 2024 Received: (at submit) by debbugs.gnu.org; 19 Sep 2024 12:01:39 +0000 Received: from localhost ([127.0.0.1]:59942 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1srFqs-0002Rg-Jc for submit@debbugs.gnu.org; Thu, 19 Sep 2024 08:01:39 -0400 Received: from lists.gnu.org ([209.51.188.17]:51124) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1srFqq-0002RT-0H for submit@debbugs.gnu.org; Thu, 19 Sep 2024 08:01:37 -0400 Received: from eggs.gnu.org ([2001:470:142:3::10]) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1srFqX-0005Sh-Qq for bug-gnu-emacs@gnu.org; Thu, 19 Sep 2024 08:01:18 -0400 Received: from fout2-smtp.messagingengine.com ([103.168.172.145]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1srFqU-0008KN-Ky for bug-gnu-emacs@gnu.org; Thu, 19 Sep 2024 08:01:17 -0400 Received: from phl-compute-05.internal (phl-compute-05.phl.internal [10.202.2.45]) by mailfout.phl.internal (Postfix) with ESMTP id 53D2A138038D for ; Thu, 19 Sep 2024 08:01:11 -0400 (EDT) Received: from phl-mailfrontend-01 ([10.202.2.162]) by phl-compute-05.internal (MEProxy); Thu, 19 Sep 2024 08:01:11 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.fm; h= cc:content-type:content-type:date:date:from:from:in-reply-to :message-id:mime-version:reply-to:subject:subject:to:to; s=fm2; t=1726747271; x=1726833671; bh=9lwdLnMNk/iXVj+RRtaSTDxJYkRx3IHF Bq1qTzEqMI8=; b=cW/gBCK7sjPgSFgYeqtjjiDGC1UF6+GHAqbx33donzJnDVIl j0eRQjI5tw3T4GO9ugze08BHhkre4+YsgBf5XeuxrmjgOQpzxZov8Y0lEHVNvXbg QPy43jevynb9D5kl8UkucpnYgrQhcWie8jChvSQOY8W+KawV/AUCp1cbk3QXHkZ6 f/kdQyug/pgemsn8q+WTEuMc5d1lZy3pDTZPFaXBvqNrEnYcAZWJxPWBwKpr51Fi 3l00SmNpGeGI6weYEpRmEWRp4WbEXhpTUmfb7VFhPDKJg4s5nd17q28aN0txcZmO v1ET9amiP4VUpo3tf6fvU5F+QnLkSVu69XZf1Q== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:message-id :mime-version:reply-to:subject:subject:to:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; t= 1726747271; x=1726833671; bh=9lwdLnMNk/iXVj+RRtaSTDxJYkRx3IHFBq1 qTzEqMI8=; b=p3/7jOHO93NAgAXRG9qB8RfhGVMXS+7HN72aKo1939ur2pXkZqL iCnlNhQTEE/ebBx4zqo985JGFVPtW6yKW3bCGxXrX5YLd85C0EhyCGnoptN+MMDC 9W5mZActapSx/w8jy2E26WQTfwRkhgeKPw5wC1p8zU6w2h5k/yIV5jOJLZap2vgD 5MkxQ4y1HLsenHqytQn+u958KHYL2Un1HctkosjTLCkqHISFVsoekKvXHS7Ol7aR dQ5a7jb2hZYMFjCO9AyEAZx+kd5zYMhWBsxJskZrwYqJr4bNI0ZqIFrEXAcMxxmD tat3Rs6DZ7u2J2FJ2845XFbQVPYLJfPkq4w== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrudeluddggeeiucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvffuff fkgggtsehttdertddttddtnecuhfhrohhmpeflohhoshhtucfmrhgvmhgvrhhsuceojhho ohhsthhkrhgvmhgvrhhssehfrghsthhmrghilhdrfhhmqeenucggtffrrghtthgvrhhnpe duleekudefudfhfeekgfettddugfevkeevgfeggefgjeefudduteehleekjeelveenucev lhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehjohhoshhtkh hrvghmvghrshesfhgrshhtmhgrihhlrdhfmhdpnhgspghrtghpthhtohepuddpmhhouggv pehsmhhtphhouhhtpdhrtghpthhtohepsghughdqghhnuhdqvghmrggtshesghhnuhdroh hrgh X-ME-Proxy: Feedback-ID: ie15541ac:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA for ; Thu, 19 Sep 2024 08:01:10 -0400 (EDT) From: Joost Kremers To: bug-gnu-emacs@gnu.org Subject: 29.4; eglot-rename reports success when it shouldn't Date: Thu, 19 Sep 2024 14:01:08 +0200 Message-ID: <86plozvomz.fsf@fastmail.fm> MIME-Version: 1.0 Content-Type: text/plain Received-SPF: pass client-ip=103.168.172.145; envelope-from=joostkremers@fastmail.fm; helo=fout2-smtp.messagingengine.com X-Spam_score_int: -27 X-Spam_score: -2.8 X-Spam_bar: -- X-Spam_report: (-2.8 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, FREEMAIL_FROM=0.001, RCVD_IN_DNSWL_LOW=-0.7, RCVD_IN_VALIDITY_RPBL_BLOCKED=0.001, RCVD_IN_VALIDITY_SAFE_BLOCKED=0.001, SPF_HELO_PASS=-0.001, SPF_PASS=-0.001 autolearn=ham autolearn_force=no X-Spam_action: no action X-Spam-Score: -1.3 (-) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.3 (--) I tried to use 'eglot-rename' to rename a variable to a name that already existed in the relevant function. The change was not applied but Eglot nonetheless reported "[eglot] Edit successful!". This was in a Python buffer, using python-ts-mode and basedpyright (v1.17.1) as language server. The relevant code snippet: ``` def main(): sizes = [100, 1000, 10000] results: dict[str, list[float]] = { "Linear search": [], "Binary search": [], "Interpolation search": [], } for size in sizes: seq: list[int] = sorted([random.randint(0, 10000) for _ in range(size)]) x = random.choice(arr) results["Linear search"].append(measure_time(linear_search, arr, x)) results["Binary search"].append(measure_time(binary_search, arr, x)) results["Interpolation search"].append( measure_time(interpolation_search, arr, x) ) ``` Note the 'seq' variable in the first line of the for loop, and the 'arr' variable in the three '.append' invocations. With point on the first 'arr', calling eglot-rename and giving 'seq' as the new name, Eglot refuses to rename the three occurrences of 'arr' (which makes sense, given that a variable with that name obviously already exists), but still reports success. (Note that there is no problem if the 'seq' above is also 'arr'. Then renaming works fine.) In GNU Emacs 29.4 (build 1, x86_64-pc-linux-gnu, GTK+ Version 3.24.43, cairo version 1.18.0) System Description: Arch Linux Configured using: 'configure --with-pgtk --with-native-compilation=aot --sysconfdir=/etc --prefix=/usr --libexecdir=/usr/lib --with-tree-sitter --localstatedir=/var --with-cairo --disable-build-details --with-harfbuzz --with-libsystemd --with-modules 'CFLAGS=-march=x86-64 -mtune=generic -O2 -pipe -fno-plt -fexceptions -Wp,-D_FORTIFY_SOURCE=3 -Wformat -Werror=format-security -fstack-clash-protection -fcf-protection -fno-omit-frame-pointer -mno-omit-leaf-frame-pointer -g -ffile-prefix-map=/build/emacs/src=/usr/src/debug/emacs -flto=auto' 'LDFLAGS=-Wl,-O1 -Wl,--sort-common -Wl,--as-needed -Wl,-z,relro -Wl,-z,now -Wl,-z,pack-relative-relocs -flto=auto' 'CXXFLAGS=-march=x86-64 -mtune=generic -O2 -pipe -fno-plt -fexceptions -Wp,-D_FORTIFY_SOURCE=3 -Wformat -Werror=format-security -fstack-clash-protection -fcf-protection -fno-omit-frame-pointer -mno-omit-leaf-frame-pointer -Wp,-D_GLIBCXX_ASSERTIONS -g -ffile-prefix-map=/build/emacs/src=/usr/src/debug/emacs -flto=auto'' Configured features: ACL CAIRO DBUS FREETYPE GIF GLIB GMP GNUTLS GPM GSETTINGS HARFBUZZ JPEG JSON LCMS2 LIBOTF LIBSYSTEMD LIBXML2 MODULES NATIVE_COMP NOTIFY INOTIFY PDUMPER PGTK PNG RSVG SECCOMP SOUND SQLITE3 THREADS TIFF TOOLKIT_SCROLL_BARS TREE_SITTER WEBP XIM GTK3 ZLIB Important settings: value of $LANG: en_GB.UTF-8 locale-coding-system: utf-8-unix Major mode: VTerm Minor modes in effect: magit-auto-revert-mode: t pyvenv-mode: t mu4e-modeline-mode: t consult-denote-mode: t flycheck-indicator-mode: t global-flycheck-eglot-mode: t minions-mode: t doom-modeline-mode: t which-key-mode: t global-atomic-chrome-edit-mode: t marginalia-mode: t all-the-icons-completion-mode: t company-prescient-mode: t prescient-persist-mode: t vertico-multiform-mode: t eros-mode: t hexl-follow-ascii: t eglot-booster-mode: t vertico-mode: t global-diff-hl-mode: t global-git-commit-mode: t global-treesit-auto-mode: t which-function-mode: t global-org-modern-mode: t denote-menu-bar-mode: t shell-dirtrack-mode: t company-quickhelp-mode: t company-quickhelp-local-mode: t global-company-mode: t company-mode: t csv-field-index-mode: t override-global-mode: t server-mode: t repeat-mode: t winner-mode: t electric-pair-mode: t recentf-mode: t delete-selection-mode: t tooltip-mode: t global-eldoc-mode: t show-paren-mode: t mouse-wheel-mode: t tool-bar-mode: t menu-bar-mode: t file-name-shadow-mode: t global-font-lock-mode: t font-lock-mode: t buffer-read-only: t column-number-mode: t line-number-mode: t transient-mark-mode: t auto-composition-mode: t auto-encryption-mode: t auto-compression-mode: t auto-save-visited-mode: t Load-path shadows: ~/src/parsebib/parsebib hides /home/joost/.emacs.d/elpa/parsebib-20230228.1530/parsebib ~/.emacs.d/lisp/custom hides /usr/share/emacs/29.4/lisp/custom /home/joost/.emacs.d/elpa/transient-20240918.1138/transient hides /usr/share/emacs/29.4/lisp/transient /home/joost/.emacs.d/elpa/jsonrpc-1.0.25/jsonrpc hides /usr/share/emacs/29.4/lisp/jsonrpc /home/joost/.emacs.d/elpa/eglot-1.17/eglot hides /usr/share/emacs/29.4/lisp/progmodes/eglot /home/joost/.emacs.d/elpa/eldoc-1.15.0/eldoc hides /usr/share/emacs/29.4/lisp/emacs-lisp/eldoc Features: (shadow emacsbug goto-addr magit-extras apheleia apheleia-rcs apheleia-dp apheleia-formatters apheleia-utils apheleia-log apheleia-formatter-context view vc-hg vc-bzr vc-src vc-sccs vc-cvs vc-rcs bug-reference pandoc-mode pandoc-mode-utils markdown-mode magit-bookmark magit-submodule magit-blame magit-stash magit-reflog magit-bisect magit-push magit-pull magit-fetch magit-clone magit-remote magit-commit magit-sequence magit-notes magit-worktree magit-tag magit-merge magit-branch magit-reset magit-files magit-refs magit-status magit magit-repos magit-apply magit-wip magit-log magit-diff smerge-mode magit-core magit-autorevert magit-margin magit-transient magit-process epa-file network-stream mailalias vertico-buffer misearch multi-isearch kivy-mode combobulate combobulate-json combobulate-yaml combobulate-css combobulate-js-ts combobulate-python combobulate-html combobulate-query savehist scheme combobulate-ui combobulate-display combobulate-ztree combobulate-contrib multiple-cursors mc-separate-operations rectangular-region-mode mc-mark-pop mc-edit-lines mc-hide-unmatched-lines-mode mc-mark-more sgml-mode facemenu mc-cycle-cursors multiple-cursors-core rect combobulate-envelope combobulate-manipulation combobulate-procedure combobulate-navigation combobulate-misc combobulate-interface combobulate-rules combobulate-settings indent-bars-ts indent-bars cap-words superword subword pyvenv smiley gnus-cite mm-archive mail-extr qp textsec uni-scripts idna-mapping ucs-normalize uni-confusable textsec-check display-line-numbers mu4e-settings gnus-dired mu4e mu4e-org mu4e-notification mu4e-main smtpmail mu4e-view mu4e-mime-parts mu4e-headers mu4e-thread mu4e-actions mu4e-compose mu4e-draft gnus-msg mu4e-search mu4e-lists mu4e-bookmarks mu4e-mark mu4e-message flow-fill mu4e-contacts mu4e-update mu4e-folders mu4e-context mu4e-query-items mu4e-server mu4e-modeline mu4e-vars mu4e-helpers mu4e-config mu4e-window mu4e-obsolete emoji-labels emoji multisession sqlite ace-window help-fns radix-tree descr-text avy corg guess-language visual-fill-column org-autolist org-indent oc-basic mule-util vc-git consult-flycheck consult-denote consult display-fill-column-indicator flyspell ispell flycheck-indicator flycheck-ledger flycheck-eglot flycheck-posframe flycheck eldoc-box jk-input-methods quail solarized-light-theme solarized-theme solarized solarized-faces go-translate gt-text-utility gt-engine-echo gt-engine-libre gt-engine-chatgpt gt-engine-youdao gt-engine-stardict gt-engine-deepl gt-engine-google-rpc gt-engine-google gt-engine-bing gt-extension gt-faces gt-core gt-httpx wgrep-ag wgrep csv2ledger vterm bookmark term disp-table ehelp vterm-module term/xterm xterm ielm minions doom-modeline doom-modeline-segments doom-modeline-env doom-modeline-core shrink-path f nerd-icons nerd-icons-faces nerd-icons-data nerd-icons-data-mdicon nerd-icons-data-flicon nerd-icons-data-codicon nerd-icons-data-devicon nerd-icons-data-sucicon nerd-icons-data-wicon nerd-icons-data-faicon nerd-icons-data-powerline nerd-icons-data-octicon nerd-icons-data-pomicon nerd-icons-data-ipsicon which-key atomic-chrome iimage image+ image-file image-converter marginalia all-the-icons-completion company-prescient prescient char-fold orderless vertico-multiform dockerfile-mode sh-script smie executable impatient-mode htmlize jupyter python-pytest edebug eros macrostep checkdoc paredit dape hexl gdb-mi gud eglot-booster eglot external-completion jsonrpc flymake-proc flymake diff ert debug backtrace org-linenote vertico projectile lisp-mnt grep ibuf-ext ibuffer ibuffer-loaddefs ag vc-svn compile find-dired s diff-hl log-view vc-dir ewoc vc vc-dispatcher diff-mode git-commit with-editor log-edit pcvs-util add-log magit-mode benchmark magit-git magit-base magit-section cursor-sensor crm autorevert aggressive-indent nswbuff finder-inf yaml-mode yaml treesit-auto reftex reftex-loaddefs reftex-vars which-func imenu tab-jump-out yasnippet-snippets yasnippet company-org-block org-modern org-settings org-clock ob-jupyter jupyter-tramp tramp-cache time-stamp jupyter-server jupyter-server-kernel jupyter-rest-api url-http url-auth url-gw nsm jupyter-org-extensions jupyter-org-client jupyter-repl jupyter-widget-client websocket bindat simple-httpd jupyter-client jupyter-kernel jupyter-monads jupyter-messages hmac-def jupyter-mime jupyter-kernelspec jupyter-env jupyter-base eieio-base ob-sqlite ob-sql ob-shell ob-clojure ob-python python treesit ol-w3m org-tempo tempo ol-rmail ol-mhe ol-irc ol-info ol-gnus nnselect gnus-art mm-uu mml2015 mm-view mml-smime smime gnutls dig gnus-sum gnus-group gnus-undo gnus-start gnus-dbus gnus-cloud nnimap nnmail mail-source utf7 nnoo gnus-spec gnus-int gnus-range message sendmail yank-media rfc822 mml mml-sec epa derived epg rfc6068 epg-config mm-decode mm-bodies mm-encode mail-parse rfc2231 rfc2047 rfc2045 ietf-drums mailabbrev gmm-utils mailheader gnus-win ol-eww eww thingatpt shr pixel-fill kinsoku svg puny mm-url gnus nnheader gnus-util text-property-search mail-utils range mm-util mail-prsvr ol-doi org-link-doi ol-docview doc-view filenotify jka-compr image-mode exif ol-bibtex ol-bbdb org-element org-persist xdg org-id org-refile avl-tree dom org ob ob-tangle ob-ref ob-lob ob-table ob-exp org-macro org-src ob-comint org-pcomplete org-list org-footnote org-faces org-entities noutline outline ob-emacs-lisp ob-core ob-eval org-cycle org-table ol org-fold org-fold-core org-keys oc org-loaddefs find-func cal-menu calendar cal-loaddefs org-version org-compat org-macs transient compat compat-30 denote dired dired-loaddefs tramp tramp-loaddefs trampver tramp-integration tramp-compat shell pcomplete comint ansi-osc parse-time format-spec ansi-color mixed-pitch face-remap biblio biblio-download biblio-dissemin biblio-ieee biblio-hal biblio-dblp biblio-crossref biblio-arxiv timezone biblio-doi biblio-core let-alist url-queue url-file ido hl-line bibtex iso8601 time-date adaptive-wrap goggles comp comp-cstr warnings rx pulse color posframe hydra lv use-package-bind-key company-quickhelp pos-tip all-the-icons all-the-icons-faces data-material data-weathericons data-octicons data-fileicons data-faicons data-alltheicons company-keywords company-etags etags fileloop xref project company-gtags company-dabbrev-code company-dabbrev company-ipa company-files company-clang company-cmake company-semantic company-template company-css company-capf company use-package-ensure whitespace literate-scratch jk-functions advice csv-mode sort dash eshell esh-cmd generator esh-ext esh-opt esh-proc esh-io esh-arg esh-module esh-groups esh-util files-x notifications dbus xml use-package-core cl-extra help-mode edmacro kmacro bind-key server repeat winner ring elec-pair recentf tree-widget delsel help-at-pt cus-edit pp cus-load icons wid-edit all-the-icons-completion-autoloads all-the-icons-autoloads apheleia-autoloads easy-mmode async-autoloads avy-autoloads boxquote-autoloads breadcrumb-autoloads citar-autoloads citeproc-autoloads clojure-mode-autoloads company-auctex-autoloads auctex-autoloads tex-site company-box-autoloads company-prescient-autoloads company-quickhelp-autoloads consult-denote-autoloads consult-flycheck-autoloads corg-autoloads csv-mode-autoloads dape-autoloads denote-autoloads devdocs-browser-autoloads diff-hl-autoloads docker-autoloads dockerfile-mode-autoloads doom-modeline-autoloads eglot-booster-autoloads eldoc-box-autoloads embark-consult-autoloads consult-autoloads embark-autoloads eros-autoloads expand-region-autoloads flycheck-clj-kondo-autoloads flycheck-eglot-autoloads eglot-autoloads eldoc-autoloads go-translate-autoloads goggles-autoloads gptel-autoloads guess-language-autoloads hydra-autoloads ialign-autoloads impatient-mode-autoloads htmlize-autoloads indent-bars-autoloads company-autoloads js2-mode-autoloads json-process-client-autoloads jsonian-autoloads jsonrpc-autoloads jupyter-autoloads kivy-mode-autoloads ledger-mode-autoloads literate-scratch-autoloads lv-autoloads macrostep-autoloads magit-autoloads magit-section-autoloads marginalia-autoloads markdown-mode-autoloads minions-autoloads multiple-cursors-autoloads nerd-icons-autoloads numpydoc-autoloads nushell-ts-mode-autoloads orderless-autoloads org-linenote-autoloads org-modern-autoloads paredit-autoloads parsebib-autoloads pdf-tools-autoloads pos-tip-autoloads posframe-autoloads prescient-autoloads projectile-autoloads python-pytest-autoloads realgud-autoloads realgud-recursive-autoloads loc-changes-autoloads load-relative-autoloads f-autoloads simple-httpd-autoloads sly-overlay-autoloads sly-autoloads solarized-theme-autoloads string-inflection-autoloads tab-jump-out-autoloads tablist-autoloads test-simple-autoloads tide-autoloads flycheck-autoloads dash-autoloads track-changes-autoloads transient-autoloads treesit-auto-autoloads vertico-autoloads vterm-autoloads vundo-autoloads web-mode-autoloads websocket-autoloads which-key-autoloads with-editor-autoloads info compat-autoloads yaml-autoloads yaml-mode-autoloads yasnippet-snippets-autoloads yasnippet-autoloads zmq-autoloads package browse-url url url-proxy url-privacy url-expand url-methods url-history url-cookie generate-lisp-file url-domsuf url-util mailcap url-handlers url-parse auth-source cl-seq eieio eieio-core cl-macs password-cache json subr-x map byte-opt gv bytecomp byte-compile url-vars cl-loaddefs cl-lib pcase rmc iso-transl tooltip cconv eldoc paren electric uniquify ediff-hook vc-hooks lisp-float-type elisp-mode mwheel term/pgtk-win pgtk-win term/common-win pgtk-dnd tool-bar dnd fontset image regexp-opt fringe tabulated-list replace newcomment text-mode lisp-mode prog-mode register page tab-bar menu-bar rfn-eshadow isearch easymenu timer select scroll-bar mouse jit-lock font-lock syntax font-core term/tty-colors frame minibuffer nadvice seq simple cl-generic indonesian philippine cham georgian utf-8-lang misc-lang vietnamese tibetan thai tai-viet lao korean japanese eucjp-ms cp51932 hebrew greek romanian slovak czech european ethiopic indian cyrillic chinese composite emoji-zwj charscript charprop case-table epa-hook jka-cmpr-hook help abbrev obarray oclosure cl-preloaded button loaddefs theme-loaddefs faces cus-face macroexp files window text-properties overlay sha1 md5 base64 format env code-pages mule custom widget keymap hashtable-print-readable backquote threads dbusbind inotify dynamic-setting system-font-setting font-render-setting cairo gtk pgtk lcms2 multi-tty make-network-process native-compile emacs) Memory information: ((conses 16 1406460 189413) (symbols 48 81849 6) (strings 32 459186 19206) (string-bytes 1 12806777) (vectors 16 178171) (vector-slots 8 4425380 245877) (floats 8 2187 1021) (intervals 56 19925 5482) (buffers 984 49)) -- Joost Kremers Life has its moments From debbugs-submit-bounces@debbugs.gnu.org Thu Sep 19 12:07:50 2024 Received: (at 73355) by debbugs.gnu.org; 19 Sep 2024 16:07:50 +0000 Received: from localhost ([127.0.0.1]:33341 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1srJh7-00085c-7f for submit@debbugs.gnu.org; Thu, 19 Sep 2024 12:07:50 -0400 Received: from fhigh1-smtp.messagingengine.com ([103.168.172.152]:36695) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1srJh3-00085F-J6 for 73355@debbugs.gnu.org; Thu, 19 Sep 2024 12:07:47 -0400 Received: from phl-compute-09.internal (phl-compute-09.phl.internal [10.202.2.49]) by mailfhigh.phl.internal (Postfix) with ESMTP id B9B5B114018C for <73355@debbugs.gnu.org>; Thu, 19 Sep 2024 12:07:21 -0400 (EDT) Received: from phl-mailfrontend-01 ([10.202.2.162]) by phl-compute-09.internal (MEProxy); Thu, 19 Sep 2024 12:07:21 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.fm; h= cc:content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1726762041; x=1726848441; bh=+vxRARKydh r+NaofvfSQcvaj/otdZ+zWYHFzuLKyeHg=; b=i3v1xkwCwtce3dQG9qvLUNkNOR Fu1LJW4EKzpquBrMP1XHNahvvqYsfAkre4/NuhIpEuot+UwbInh9yfIvH3FTJBeU PQmzuwtAmzRbMmFz7YTdFwMyfoueAAe8bp8BnSGMhu+VNauyC3R8OgCs8jqm3fqA 1ahG7FQdQWIts+4FGdQXWh00cGQF3uPkMmgjDcLoluhjlrnNoqsfT2tNgFVEJXr1 KmVKycjp3Ihz9Y/Dylk6HcanwSK6Ax7/RSWCppOQ+9nNHstbXcXI/J8PduQfzuwc iUh1CVXJ271P5uIdnq3HB/OsF3EG5jS82cW+LRorEhbVSUXoWVSRx0Z502vQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1726762041; x=1726848441; bh=+vxRARKydhr+NaofvfSQcvaj/otd Z+zWYHFzuLKyeHg=; b=iixEtvvIzNp7SFF8a0seGTMfIGSSphoQ1JBBGhTi03bh ryzz5NKZlLwqeJe7zhmxOohdE/6rNLZDX2rPqoJQpn/YXKZhluvUr+ooSas8LK66 kDlSt296PU+L9HKtoN3zdI+4qwjtkxbbhaww8En8LBXMGyc+fXW3nbau/a/Y3I14 yAKUXZh+ulspWcoZA+W9DvVlK8+0aQcRsDDY3JA1M5JJqrD4y/0CiP19QsjvZGQt xoobEBADL08fSsfhSBkdMs+mp0BGJxY3soTAxr8/gTNa9KsW03MMEzVpxrKZ857f xJP7nRUPheYCd8w1FAthWXy+MCFT7o3/rE7Wm2Ubhw== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrudeluddgleeiucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvffujg hffffkgggtsehttdertddttddtnecuhfhrohhmpeflohhoshhtucfmrhgvmhgvrhhsuceo jhhoohhsthhkrhgvmhgvrhhssehfrghsthhmrghilhdrfhhmqeenucggtffrrghtthgvrh hnpeeiiedvkeeuheejuefgudeugfdtgfegjeeitdfffeeffeevleeukefhtedvfeegteen ucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehjohhosh htkhhrvghmvghrshesfhgrshhtmhgrihhlrdhfmhdpnhgspghrtghpthhtohepuddpmhho uggvpehsmhhtphhouhhtpdhrtghpthhtohepjeeffeehheesuggvsggsuhhgshdrghhnuh drohhrgh X-ME-Proxy: Feedback-ID: ie15541ac:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA for <73355@debbugs.gnu.org>; Thu, 19 Sep 2024 12:07:20 -0400 (EDT) From: Joost Kremers To: 73355@debbugs.gnu.org Subject: Re: bug#73355: 29.4; eglot-rename reports success when it shouldn't In-Reply-To: <86plozvomz.fsf@fastmail.fm> (Joost Kremers's message of "Thu, 19 Sep 2024 14:01:08 +0200") References: <86plozvomz.fsf@fastmail.fm> Date: Thu, 19 Sep 2024 18:07:18 +0200 Message-ID: <86jzf7vd8p.fsf@fastmail.fm> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 73355 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Apologies for the double posting. My mail client behaved weird when I sent the first message and I didn't get a confirmation, which normally comes within a few minutes, so I thought something had gone wrong... On Thu, Sep 19 2024, Joost Kremers wrote: > I tried to use 'eglot-rename' to rename a variable to a name that already > existed in the relevant function. The change was not applied but Eglot > nonetheless reported "[eglot] Edit successful!". > > This was in a Python buffer, using python-ts-mode and basedpyright > (v1.17.1) as language server. The relevant code snippet: > > ``` > def main(): > sizes = [100, 1000, 10000] > results: dict[str, list[float]] = { > "Linear search": [], > "Binary search": [], > "Interpolation search": [], > } > for size in sizes: > seq: list[int] = sorted([random.randint(0, 10000) for _ in range(size)]) > x = random.choice(arr) > results["Linear search"].append(measure_time(linear_search, arr, x)) > results["Binary search"].append(measure_time(binary_search, arr, x)) > results["Interpolation search"].append( > measure_time(interpolation_search, arr, x) > ) > ``` > > Note the 'seq' variable in the first line of the for loop, and the 'arr' > variable in the three '.append' invocations. With point on the first 'arr', > calling eglot-rename and giving 'seq' as the new name, Eglot refuses to > rename the three occurrences of 'arr' (which makes sense, given that a > variable with that name obviously already exists), but still reports > success. > > (Note that there is no problem if the 'seq' above is also 'arr'. Then > renaming works fine.) > > > > In GNU Emacs 29.4 (build 1, x86_64-pc-linux-gnu, GTK+ Version 3.24.43, > cairo version 1.18.0) > System Description: Arch Linux > > Configured using: > 'configure --with-pgtk --with-native-compilation=aot --sysconfdir=/etc > --prefix=/usr --libexecdir=/usr/lib --with-tree-sitter > --localstatedir=/var --with-cairo --disable-build-details --with-harfbuzz > --with-libsystemd --with-modules 'CFLAGS=-march=x86-64 -mtune=generic -O2 > -pipe -fno-plt -fexceptions -Wp,-D_FORTIFY_SOURCE=3 -Wformat > -Werror=format-security -fstack-clash-protection -fcf-protection > -fno-omit-frame-pointer -mno-omit-leaf-frame-pointer -g > -ffile-prefix-map=/build/emacs/src=/usr/src/debug/emacs -flto=auto' > 'LDFLAGS=-Wl,-O1 -Wl,--sort-common -Wl,--as-needed -Wl,-z,relro -Wl,-z,now > -Wl,-z,pack-relative-relocs -flto=auto' 'CXXFLAGS=-march=x86-64 > -mtune=generic -O2 -pipe -fno-plt -fexceptions -Wp,-D_FORTIFY_SOURCE=3 > -Wformat -Werror=format-security -fstack-clash-protection -fcf-protection > -fno-omit-frame-pointer -mno-omit-leaf-frame-pointer > -Wp,-D_GLIBCXX_ASSERTIONS -g > -ffile-prefix-map=/build/emacs/src=/usr/src/debug/emacs -flto=auto'' > Configured features: > ACL CAIRO DBUS FREETYPE GIF GLIB GMP GNUTLS GPM GSETTINGS HARFBUZZ JPEG > JSON LCMS2 LIBOTF LIBSYSTEMD LIBXML2 MODULES NATIVE_COMP NOTIFY INOTIFY > PDUMPER PGTK PNG RSVG SECCOMP SOUND SQLITE3 THREADS TIFF > TOOLKIT_SCROLL_BARS TREE_SITTER WEBP XIM GTK3 ZLIB > Important settings: > value of $LANG: en_GB.UTF-8 > locale-coding-system: utf-8-unix > > Major mode: VTerm > > Minor modes in effect: > magit-auto-revert-mode: t > pyvenv-mode: t > mu4e-modeline-mode: t > consult-denote-mode: t > flycheck-indicator-mode: t > global-flycheck-eglot-mode: t > minions-mode: t > doom-modeline-mode: t > which-key-mode: t > global-atomic-chrome-edit-mode: t > marginalia-mode: t > all-the-icons-completion-mode: t > company-prescient-mode: t > prescient-persist-mode: t > vertico-multiform-mode: t > eros-mode: t > hexl-follow-ascii: t > eglot-booster-mode: t > vertico-mode: t > global-diff-hl-mode: t > global-git-commit-mode: t > global-treesit-auto-mode: t > which-function-mode: t > global-org-modern-mode: t > denote-menu-bar-mode: t > shell-dirtrack-mode: t > company-quickhelp-mode: t > company-quickhelp-local-mode: t > global-company-mode: t > company-mode: t > csv-field-index-mode: t > override-global-mode: t > server-mode: t > repeat-mode: t > winner-mode: t > electric-pair-mode: t > recentf-mode: t > delete-selection-mode: t > tooltip-mode: t > global-eldoc-mode: t > show-paren-mode: t > mouse-wheel-mode: t > tool-bar-mode: t > menu-bar-mode: t > file-name-shadow-mode: t > global-font-lock-mode: t > font-lock-mode: t > buffer-read-only: t > column-number-mode: t > line-number-mode: t > transient-mark-mode: t > auto-composition-mode: t > auto-encryption-mode: t > auto-compression-mode: t > auto-save-visited-mode: t > > Load-path shadows: > ~/src/parsebib/parsebib hides /home/joost/.emacs.d/elpa/parsebib-20230228.1530/parsebib > ~/.emacs.d/lisp/custom hides /usr/share/emacs/29.4/lisp/custom > /home/joost/.emacs.d/elpa/transient-20240918.1138/transient hides /usr/share/emacs/29.4/lisp/transient > /home/joost/.emacs.d/elpa/jsonrpc-1.0.25/jsonrpc hides /usr/share/emacs/29.4/lisp/jsonrpc > /home/joost/.emacs.d/elpa/eglot-1.17/eglot hides /usr/share/emacs/29.4/lisp/progmodes/eglot > /home/joost/.emacs.d/elpa/eldoc-1.15.0/eldoc hides /usr/share/emacs/29.4/lisp/emacs-lisp/eldoc > > Features: > (shadow emacsbug goto-addr magit-extras apheleia apheleia-rcs apheleia-dp > apheleia-formatters apheleia-utils apheleia-log apheleia-formatter-context > view vc-hg vc-bzr vc-src vc-sccs vc-cvs vc-rcs bug-reference pandoc-mode > pandoc-mode-utils markdown-mode magit-bookmark magit-submodule magit-blame > magit-stash magit-reflog magit-bisect magit-push magit-pull magit-fetch > magit-clone magit-remote magit-commit magit-sequence magit-notes > magit-worktree magit-tag magit-merge magit-branch magit-reset magit-files > magit-refs magit-status magit magit-repos magit-apply magit-wip magit-log > magit-diff smerge-mode magit-core magit-autorevert magit-margin > magit-transient magit-process epa-file network-stream mailalias > vertico-buffer misearch multi-isearch kivy-mode combobulate > combobulate-json combobulate-yaml combobulate-css combobulate-js-ts > combobulate-python combobulate-html combobulate-query savehist scheme > combobulate-ui combobulate-display combobulate-ztree combobulate-contrib > multiple-cursors mc-separate-operations rectangular-region-mode mc-mark-pop > mc-edit-lines mc-hide-unmatched-lines-mode mc-mark-more sgml-mode facemenu > mc-cycle-cursors multiple-cursors-core rect combobulate-envelope > combobulate-manipulation combobulate-procedure combobulate-navigation > combobulate-misc combobulate-interface combobulate-rules > combobulate-settings indent-bars-ts indent-bars cap-words superword subword > pyvenv smiley gnus-cite mm-archive mail-extr qp textsec uni-scripts > idna-mapping ucs-normalize uni-confusable textsec-check > display-line-numbers mu4e-settings gnus-dired mu4e mu4e-org > mu4e-notification mu4e-main smtpmail mu4e-view mu4e-mime-parts mu4e-headers > mu4e-thread mu4e-actions mu4e-compose mu4e-draft gnus-msg mu4e-search > mu4e-lists mu4e-bookmarks mu4e-mark mu4e-message flow-fill mu4e-contacts > mu4e-update mu4e-folders mu4e-context mu4e-query-items mu4e-server > mu4e-modeline mu4e-vars mu4e-helpers mu4e-config mu4e-window mu4e-obsolete > emoji-labels emoji multisession sqlite ace-window help-fns radix-tree > descr-text avy corg guess-language visual-fill-column org-autolist > org-indent oc-basic mule-util vc-git consult-flycheck consult-denote > consult display-fill-column-indicator flyspell ispell flycheck-indicator > flycheck-ledger flycheck-eglot flycheck-posframe flycheck eldoc-box > jk-input-methods quail solarized-light-theme solarized-theme solarized > solarized-faces go-translate gt-text-utility gt-engine-echo gt-engine-libre > gt-engine-chatgpt gt-engine-youdao gt-engine-stardict gt-engine-deepl > gt-engine-google-rpc gt-engine-google gt-engine-bing gt-extension gt-faces > gt-core gt-httpx wgrep-ag wgrep csv2ledger vterm bookmark term disp-table > ehelp vterm-module term/xterm xterm ielm minions doom-modeline > doom-modeline-segments doom-modeline-env doom-modeline-core shrink-path f > nerd-icons nerd-icons-faces nerd-icons-data nerd-icons-data-mdicon > nerd-icons-data-flicon nerd-icons-data-codicon nerd-icons-data-devicon > nerd-icons-data-sucicon nerd-icons-data-wicon nerd-icons-data-faicon > nerd-icons-data-powerline nerd-icons-data-octicon nerd-icons-data-pomicon > nerd-icons-data-ipsicon which-key atomic-chrome iimage image+ image-file > image-converter marginalia all-the-icons-completion company-prescient > prescient char-fold orderless vertico-multiform dockerfile-mode sh-script > smie executable impatient-mode htmlize jupyter python-pytest edebug eros > macrostep checkdoc paredit dape hexl gdb-mi gud eglot-booster eglot > external-completion jsonrpc flymake-proc flymake diff ert debug backtrace > org-linenote vertico projectile lisp-mnt grep ibuf-ext ibuffer > ibuffer-loaddefs ag vc-svn compile find-dired s diff-hl log-view vc-dir > ewoc vc vc-dispatcher diff-mode git-commit with-editor log-edit pcvs-util > add-log magit-mode benchmark magit-git magit-base magit-section > cursor-sensor crm autorevert aggressive-indent nswbuff finder-inf yaml-mode > yaml treesit-auto reftex reftex-loaddefs reftex-vars which-func imenu > tab-jump-out yasnippet-snippets yasnippet company-org-block org-modern > org-settings org-clock ob-jupyter jupyter-tramp tramp-cache time-stamp > jupyter-server jupyter-server-kernel jupyter-rest-api url-http url-auth > url-gw nsm jupyter-org-extensions jupyter-org-client jupyter-repl > jupyter-widget-client websocket bindat simple-httpd jupyter-client > jupyter-kernel jupyter-monads jupyter-messages hmac-def jupyter-mime > jupyter-kernelspec jupyter-env jupyter-base eieio-base ob-sqlite ob-sql > ob-shell ob-clojure ob-python python treesit ol-w3m org-tempo tempo > ol-rmail ol-mhe ol-irc ol-info ol-gnus nnselect gnus-art mm-uu mml2015 > mm-view mml-smime smime gnutls dig gnus-sum gnus-group gnus-undo gnus-start > gnus-dbus gnus-cloud nnimap nnmail mail-source utf7 nnoo gnus-spec gnus-int > gnus-range message sendmail yank-media rfc822 mml mml-sec epa derived epg > rfc6068 epg-config mm-decode mm-bodies mm-encode mail-parse rfc2231 rfc2047 > rfc2045 ietf-drums mailabbrev gmm-utils mailheader gnus-win ol-eww eww > thingatpt shr pixel-fill kinsoku svg puny mm-url gnus nnheader gnus-util > text-property-search mail-utils range mm-util mail-prsvr ol-doi > org-link-doi ol-docview doc-view filenotify jka-compr image-mode exif > ol-bibtex ol-bbdb org-element org-persist xdg org-id org-refile avl-tree > dom org ob ob-tangle ob-ref ob-lob ob-table ob-exp org-macro org-src > ob-comint org-pcomplete org-list org-footnote org-faces org-entities > noutline outline ob-emacs-lisp ob-core ob-eval org-cycle org-table ol > org-fold org-fold-core org-keys oc org-loaddefs find-func cal-menu calendar > cal-loaddefs org-version org-compat org-macs transient compat compat-30 > denote dired dired-loaddefs tramp tramp-loaddefs trampver tramp-integration > tramp-compat shell pcomplete comint ansi-osc parse-time format-spec > ansi-color mixed-pitch face-remap biblio biblio-download biblio-dissemin > biblio-ieee biblio-hal biblio-dblp biblio-crossref biblio-arxiv timezone > biblio-doi biblio-core let-alist url-queue url-file ido hl-line bibtex > iso8601 time-date adaptive-wrap goggles comp comp-cstr warnings rx pulse > color posframe hydra lv use-package-bind-key company-quickhelp pos-tip > all-the-icons all-the-icons-faces data-material data-weathericons > data-octicons data-fileicons data-faicons data-alltheicons company-keywords > company-etags etags fileloop xref project company-gtags > company-dabbrev-code company-dabbrev company-ipa company-files > company-clang company-cmake company-semantic company-template company-css > company-capf company use-package-ensure whitespace literate-scratch > jk-functions advice csv-mode sort dash eshell esh-cmd generator esh-ext > esh-opt esh-proc esh-io esh-arg esh-module esh-groups esh-util files-x > notifications dbus xml use-package-core cl-extra help-mode edmacro kmacro > bind-key server repeat winner ring elec-pair recentf tree-widget delsel > help-at-pt cus-edit pp cus-load icons wid-edit > all-the-icons-completion-autoloads all-the-icons-autoloads > apheleia-autoloads easy-mmode async-autoloads avy-autoloads > boxquote-autoloads breadcrumb-autoloads citar-autoloads citeproc-autoloads > clojure-mode-autoloads company-auctex-autoloads auctex-autoloads tex-site > company-box-autoloads company-prescient-autoloads > company-quickhelp-autoloads consult-denote-autoloads > consult-flycheck-autoloads corg-autoloads csv-mode-autoloads dape-autoloads > denote-autoloads devdocs-browser-autoloads diff-hl-autoloads > docker-autoloads dockerfile-mode-autoloads doom-modeline-autoloads > eglot-booster-autoloads eldoc-box-autoloads embark-consult-autoloads > consult-autoloads embark-autoloads eros-autoloads expand-region-autoloads > flycheck-clj-kondo-autoloads flycheck-eglot-autoloads eglot-autoloads > eldoc-autoloads go-translate-autoloads goggles-autoloads gptel-autoloads > guess-language-autoloads hydra-autoloads ialign-autoloads > impatient-mode-autoloads htmlize-autoloads indent-bars-autoloads > company-autoloads js2-mode-autoloads json-process-client-autoloads > jsonian-autoloads jsonrpc-autoloads jupyter-autoloads kivy-mode-autoloads > ledger-mode-autoloads literate-scratch-autoloads lv-autoloads > macrostep-autoloads magit-autoloads magit-section-autoloads > marginalia-autoloads markdown-mode-autoloads minions-autoloads > multiple-cursors-autoloads nerd-icons-autoloads numpydoc-autoloads > nushell-ts-mode-autoloads orderless-autoloads org-linenote-autoloads > org-modern-autoloads paredit-autoloads parsebib-autoloads > pdf-tools-autoloads pos-tip-autoloads posframe-autoloads > prescient-autoloads projectile-autoloads python-pytest-autoloads > realgud-autoloads realgud-recursive-autoloads loc-changes-autoloads > load-relative-autoloads f-autoloads simple-httpd-autoloads > sly-overlay-autoloads sly-autoloads solarized-theme-autoloads > string-inflection-autoloads tab-jump-out-autoloads tablist-autoloads > test-simple-autoloads tide-autoloads flycheck-autoloads dash-autoloads > track-changes-autoloads transient-autoloads treesit-auto-autoloads > vertico-autoloads vterm-autoloads vundo-autoloads web-mode-autoloads > websocket-autoloads which-key-autoloads with-editor-autoloads info > compat-autoloads yaml-autoloads yaml-mode-autoloads > yasnippet-snippets-autoloads yasnippet-autoloads zmq-autoloads package > browse-url url url-proxy url-privacy url-expand url-methods url-history > url-cookie generate-lisp-file url-domsuf url-util mailcap url-handlers > url-parse auth-source cl-seq eieio eieio-core cl-macs password-cache json > subr-x map byte-opt gv bytecomp byte-compile url-vars cl-loaddefs cl-lib > pcase rmc iso-transl tooltip cconv eldoc paren electric uniquify ediff-hook > vc-hooks lisp-float-type elisp-mode mwheel term/pgtk-win pgtk-win > term/common-win pgtk-dnd tool-bar dnd fontset image regexp-opt fringe > tabulated-list replace newcomment text-mode lisp-mode prog-mode register > page tab-bar menu-bar rfn-eshadow isearch easymenu timer select scroll-bar > mouse jit-lock font-lock syntax font-core term/tty-colors frame minibuffer > nadvice seq simple cl-generic indonesian philippine cham georgian > utf-8-lang misc-lang vietnamese tibetan thai tai-viet lao korean japanese > eucjp-ms cp51932 hebrew greek romanian slovak czech european ethiopic > indian cyrillic chinese composite emoji-zwj charscript charprop case-table > epa-hook jka-cmpr-hook help abbrev obarray oclosure cl-preloaded button > loaddefs theme-loaddefs faces cus-face macroexp files window > text-properties overlay sha1 md5 base64 format env code-pages mule custom > widget keymap hashtable-print-readable backquote threads dbusbind inotify > dynamic-setting system-font-setting font-render-setting cairo gtk pgtk > lcms2 multi-tty make-network-process native-compile emacs) > > Memory information: > ((conses 16 1406460 189413) > (symbols 48 81849 6) > (strings 32 459186 19206) > (string-bytes 1 12806777) > (vectors 16 178171) > (vector-slots 8 4425380 245877) > (floats 8 2187 1021) > (intervals 56 19925 5482) > (buffers 984 49)) -- Joost Kremers Life has its moments From debbugs-submit-bounces@debbugs.gnu.org Thu Sep 19 12:13:39 2024 Received: (at control) by debbugs.gnu.org; 19 Sep 2024 16:13:39 +0000 Received: from localhost ([127.0.0.1]:33360 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1srJmk-0008QB-GC for submit@debbugs.gnu.org; Thu, 19 Sep 2024 12:13:38 -0400 Received: from eggs.gnu.org ([209.51.188.92]:52920) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1srJmX-0008PX-2g; Thu, 19 Sep 2024 12:13:36 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1srJmA-00071M-09; Thu, 19 Sep 2024 12:13:02 -0400 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=References:Subject:In-Reply-To:To:From:Date: mime-version; bh=A9VFST9HQQ/dQLNOOOUsZaYlPibOrI/cVY8P/ZBwR90=; b=EvB8UgvQhqPl Dusy8eZwmdIrFRtCMV+1mB9NutHvtyw/WcoCzmIAjXuarMxj2cY0KIj+6anGA0oOTE66Kr5zYKDvO G/yp5O0MeQq8CNkJ2jruPL71cFyiCKHULglP0VtfmZYlOopSptz6ZioVNmWK0Kw+njcAN8njEY5oN tzcG6IE6qH+M6iXdUIMWg019qIahsNBUxHNHNfk88kfVJXSXh1iKqqKpd9puB2/JR7d2Yl/TWDaZ7 4HZdmNkCq4+3c2sZ4zJhhCRR3oFDNH+BN9UWcGSNeNCLPVrAU36qMErNzObWEx26UIZi/gdg5abHF f7QF4DGQVV6iSZAnFWs76w==; Date: Thu, 19 Sep 2024 19:12:58 +0300 Message-Id: <86ldzn8vw5.fsf@gnu.org> From: Eli Zaretskii To: Joost Kremers In-Reply-To: <86v7ys3yyy.fsf@fastmail.fm> (message from Joost Kremers on Thu, 19 Sep 2024 09:05:25 +0200) Subject: Re: bug#73358: 29.4; eglot-rename falsely claims success References: <86v7ys3yyy.fsf@fastmail.fm> X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: control Cc: 73358@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) merge 73358 73355 thanks > From: Joost Kremers > Date: Thu, 19 Sep 2024 09:05:25 +0200 > > > I tried to use 'eglot-rename' to rename a variable to a name that > already existed in the relevant function. The change was not > applied but Eglot nonetheless reported "[eglot] Edit successful!". This is an almost exact duplicate of bug#73355 which you submitted. Which one of them is more correct? I'm merging them. From debbugs-submit-bounces@debbugs.gnu.org Sat Sep 21 06:35:30 2024 Received: (at 73355) by debbugs.gnu.org; 21 Sep 2024 10:35:30 +0000 Received: from localhost ([127.0.0.1]:37392 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1srxSb-0006XK-M5 for submit@debbugs.gnu.org; Sat, 21 Sep 2024 06:35:30 -0400 Received: from eggs.gnu.org ([209.51.188.92]:52096) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1srxSZ-0006QT-1r for 73355@debbugs.gnu.org; Sat, 21 Sep 2024 06:35:27 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1srxS9-0005pP-LF; Sat, 21 Sep 2024 06:35:01 -0400 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-version:References:Subject:In-Reply-To:To:From: Date; bh=ODNv3Kg2NrpvV5jgPN+zhA2HPoZ+qUD5nZ+hNKhJZ8Y=; b=MiK6u+U/EWfIGovGauev I9pUiBAlHmnQexlRRU3cl/tdVE5TFvPfAmNsE/Nvj7L0gCcb1QaFfCgPoHhmXqxcRYBCVZs6uHglE zhT/PmqWh9WRo3r1hIehYzLsLYKbZJBlUDaLZdzKaflaLcD06fFRDEqIUu1D3+5vVe+E8KKW3gBKX AluefTTVRZdfxdCms6BVSIIVU7Jas1wjgx/XAAZZQzwKIM/C4zd7KgBINJbrbQPsj2lAGFCKzk6+G E922FKLjk6vpo/Fl23cSQTJpLp+KVCy9AYjbaC5eGokH0aL6RcOV2UnCAZ0nIQg0JsQcRJLg/Fi16 k6+oEIpR4ZiJvQ==; Date: Sat, 21 Sep 2024 13:34:58 +0300 Message-Id: <864j6947n1.fsf@gnu.org> From: Eli Zaretskii To: Joost Kremers , =?iso-8859-1?Q?Jo=E3o_T=E1vo?= =?iso-8859-1?Q?ra?= In-Reply-To: <86plozvomz.fsf@fastmail.fm> (message from Joost Kremers on Thu, 19 Sep 2024 14:01:08 +0200) Subject: Re: bug#73355: 29.4; eglot-rename reports success when it shouldn't References: <86plozvomz.fsf@fastmail.fm> MIME-version: 1.0 Content-type: text/plain; charset=iso-8859-1 Content-Transfer-Encoding: 8bit X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 73355 Cc: 73355@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > From: Joost Kremers > Date: Thu, 19 Sep 2024 14:01:08 +0200 > > > I tried to use 'eglot-rename' to rename a variable to a name that already > existed in the relevant function. The change was not applied but Eglot > nonetheless reported "[eglot] Edit successful!". > > This was in a Python buffer, using python-ts-mode and basedpyright > (v1.17.1) as language server. The relevant code snippet: > > ``` > def main(): > sizes = [100, 1000, 10000] > results: dict[str, list[float]] = { > "Linear search": [], > "Binary search": [], > "Interpolation search": [], > } > for size in sizes: > seq: list[int] = sorted([random.randint(0, 10000) for _ in range(size)]) > x = random.choice(arr) > results["Linear search"].append(measure_time(linear_search, arr, x)) > results["Binary search"].append(measure_time(binary_search, arr, x)) > results["Interpolation search"].append( > measure_time(interpolation_search, arr, x) > ) > ``` > > Note the 'seq' variable in the first line of the for loop, and the 'arr' > variable in the three '.append' invocations. With point on the first 'arr', > calling eglot-rename and giving 'seq' as the new name, Eglot refuses to > rename the three occurrences of 'arr' (which makes sense, given that a > variable with that name obviously already exists), but still reports > success. > > (Note that there is no problem if the 'seq' above is also 'arr'. Then > renaming works fine.) Adding João. From debbugs-submit-bounces@debbugs.gnu.org Sat Sep 21 07:45:12 2024 Received: (at 73355) by debbugs.gnu.org; 21 Sep 2024 11:45:12 +0000 Received: from localhost ([127.0.0.1]:37528 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1sryY4-0001p6-Hp for submit@debbugs.gnu.org; Sat, 21 Sep 2024 07:45:12 -0400 Received: from mail-oo1-f47.google.com ([209.85.161.47]:61879) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1sryY2-0001op-8L for 73355@debbugs.gnu.org; Sat, 21 Sep 2024 07:45:10 -0400 Received: by mail-oo1-f47.google.com with SMTP id 006d021491bc7-5daa93677e1so1510646eaf.3 for <73355@debbugs.gnu.org>; Sat, 21 Sep 2024 04:44:50 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1726919024; x=1727523824; darn=debbugs.gnu.org; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:from:to:cc:subject:date:message-id:reply-to; bh=yDeXUwzCxv4Q9zLv4H0RhoEcQqfIvHVeWM8NHooVZvs=; b=It2vf8he39i3kxCOkSO5eHEf3yZeyiec24Rw+ricICKvXWURJsJitlVhzu6VECCSf7 HjSK/wR9GPw3BjptyXNKxszyatBX00Sy0CupTIengNtzSj7/GnGxsXT2ciqAsypu+qoc 6XGvUF7bKAqd5kSTqY2O2U6BBwI3UPMs+tui4f+86QmeIAXZs3qvyj9/mqzIHEAF2X+l EOlcMzkfulk+t84VZjmq+SiDZuAlYkpWaCIHCyyCNK6M3uJVgDT4w+vB+GS4XT/VR9vO ReyhXZZN3QXSaz/VaTI/IT8kIgt/SygAlpjhioTifvaF0y2xDLu2txHd9K2/WdbGGz8P n2MA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1726919024; x=1727523824; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:x-gm-message-state:from:to:cc:subject:date:message-id :reply-to; bh=yDeXUwzCxv4Q9zLv4H0RhoEcQqfIvHVeWM8NHooVZvs=; b=LOsR76SkazujaWUNq7NpRe2trPdpxa4V6A2P40Z+im2v8QvYaONx+7w778j+ZJsD/U fKa3b7usIeofAw2aFIIOOF6z8V63wHa06/N5gS+2zBtw4hB9tArTdJndVjG0IviDvifP 7snw21eWA9eNjXdssg96Er6i2/hr/oDWf78A9jAWwKU5kYm4E8pSbe8DREF3p3pU0V9g 7slg90WfboRwAU+HKsvNo0PR76E26a8Ss7Q48UOmn+3ZXqFMEU3Q7ouZiY/DSmodaooZ Up16dL8MHtc1geWUqJgc9PbWQlrG9gJ92zisO00d9kZuWqnde47aOz41nXniwywuPwSG HGMg== X-Forwarded-Encrypted: i=1; AJvYcCWakLB9eVxga8KOEY5QjXXZv4/438MgHr8Dt7bq3G3vshy9EQI5ddFzR2guJpSYGU+F8Zy3ug==@debbugs.gnu.org X-Gm-Message-State: AOJu0Yzyd0d1kOu1ZVpWynvGiq4+cxd7EIyo4/px36fBuOd62nr21DoJ Jt/6cm7H1JXR62DzodO6NyEAVYp3aKV+qRnH6michUJI8iaqk7Eicaw3fZ2xq5HG8e+tTGC4QOa 7oOZfTylJ9D1vMP06CYVle9J/yGQ= X-Google-Smtp-Source: AGHT+IE+63zBjR4ZnlVfYEALj2rr2zE+TF94+Xn3+lyQu0nn7+WAKiraJdO39RrLOnkUqeE/aMpIYnIWfmUr9Jw4tlg= X-Received: by 2002:a05:6820:1c84:b0:5e1:e65d:5146 with SMTP id 006d021491bc7-5e58d17c295mr3062831eaf.5.1726919024402; Sat, 21 Sep 2024 04:43:44 -0700 (PDT) MIME-Version: 1.0 References: <86plozvomz.fsf@fastmail.fm> <864j6947n1.fsf@gnu.org> In-Reply-To: <864j6947n1.fsf@gnu.org> From: =?UTF-8?B?Sm/Do28gVMOhdm9yYQ==?= Date: Sat, 21 Sep 2024 12:43:32 +0100 Message-ID: Subject: Re: bug#73355: 29.4; eglot-rename reports success when it shouldn't To: Eli Zaretskii Content-Type: multipart/alternative; boundary="000000000000016d8706229fabec" X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 73355 Cc: Joost Kremers , 73355@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --000000000000016d8706229fabec Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable I have this some version of this server somewhere, maybe I can reproduce, but as always better to follow the instructions in the manual https://joaotavora.github.io/eglot/#Troubleshooting-Eglot and give the remaining items of a full MRE. It's possible Eglot is just successfully applying 0 edits. Jo=C3=A3o --000000000000016d8706229fabec Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
I have this some version of this server somewhere, maybe = I can reproduce, but as always better to follow the instructions in the man= ual h= ttps://joaotavora.github.io/eglot/#Troubleshooting-Eglot and give the r= emaining items of a full MRE.

= It's possible Eglot is just successfully applying 0 edits.

Jo=C3=A3o
--000000000000016d8706229fabec-- From debbugs-submit-bounces@debbugs.gnu.org Sat Sep 21 08:13:29 2024 Received: (at 73355) by debbugs.gnu.org; 21 Sep 2024 12:13:29 +0000 Received: from localhost ([127.0.0.1]:37547 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1sryzQ-0003Na-Su for submit@debbugs.gnu.org; Sat, 21 Sep 2024 08:13:29 -0400 Received: from fhigh4-smtp.messagingengine.com ([103.168.172.155]:45005) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1sryzO-0003NF-A3 for 73355@debbugs.gnu.org; Sat, 21 Sep 2024 08:13:27 -0400 Received: from phl-compute-01.internal (phl-compute-01.phl.internal [10.202.2.41]) by mailfhigh.phl.internal (Postfix) with ESMTP id DB6F41140241; Sat, 21 Sep 2024 08:13:00 -0400 (EDT) Received: from phl-mailfrontend-01 ([10.202.2.162]) by phl-compute-01.internal (MEProxy); Sat, 21 Sep 2024 08:13:00 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.fm; h= cc:cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm2; t=1726920780; x=1727007180; bh=zLRzrEX52wIUavZrYNy0wJRDZVk5uO1ZKKGuqnYf+dM=; b= IXXZkUs2+bJ8sefS8/7NNb9djNo8zorw7KRSkN9l1mJexzNQlvig92RMiNNuAync pOuOQ1C48I8ni+y8cojT7s7kHZVcRogRyoVHF5gaSHGqI3GVJ7jZeVOiy6BCYUfi ABbhfc/9O4yTMeKKgW1Qvb6Kj/CqHfx50EpeqnDWK6N/4dneaaupZkJtTsvUeX6s M+ZkFIHBLuITYd0ocHGEQ06+EQ9wuGTOQQWFQC4feKMmrE9QTq2OpOLToxJdPDt9 NvEsXp1F6ZNjFNXhL0h9CaNs8WG4/L5dcS7YPwizegxOsNbO4qssHuItpFLcZP1c LOQfB4LJ3QtbRjLczdeBNw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm2; t=1726920780; x= 1727007180; bh=zLRzrEX52wIUavZrYNy0wJRDZVk5uO1ZKKGuqnYf+dM=; b=e 9IHNcnPaWKqtqtP0gGOVQocuPycVk+clTHqvdlHQO0fzyBmQrpJAeriFyXa5Fe5k DfmsLXTvhKDIPbG7Y7Ozs+UUP0WyZRaUsGY3GvIUqMrupxXIp2Kk9JMe7aWhy6UI N96mePGFxdyZEq3kVDOT7bbqVFkbURx3EbHmX980YuWNnqBcZomA4kLRjTFNA79q 01DSJZe7i4AMg5py+t5h351YlRyuDmIKbesFZnuG6IEEPhpOFPydUyvuN4d4/Vy3 MYl09VLp59l+hFLyS3z+VlH26d4zQWnukwGVTxaJCXcy+9PpDgkIrrCjjmcL116H W8tm8bKYuYklNR5P4jVUA== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrudelhedghedtucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnegoufhushhpvggtthffohhmrghinhculdegledmnecujfgurhep hffvvefujghffffkgggtgfesthhqredttddtjeenucfhrhhomheplfhoohhsthcumfhrvg hmvghrshcuoehjohhoshhtkhhrvghmvghrshesfhgrshhtmhgrihhlrdhfmheqnecuggft rfgrthhtvghrnhepvdfhveefuddvheetheekheduledvtdekveetkeeitdeihfeiueelvd egieehffdtnecuffhomhgrihhnpehgihhthhhusgdrihhonecuvehluhhsthgvrhfuihii vgeptdenucfrrghrrghmpehmrghilhhfrhhomhepjhhoohhsthhkrhgvmhgvrhhssehfrg hsthhmrghilhdrfhhmpdhnsggprhgtphhtthhopeefpdhmohguvgepshhmthhpohhuthdp rhgtphhtthhopeejfeefheehseguvggssghughhsrdhgnhhurdhorhhgpdhrtghpthhtoh epvghlihiisehgnhhurdhorhhgpdhrtghpthhtohepjhhorghothgrvhhorhgrsehgmhgr ihhlrdgtohhm X-ME-Proxy: Feedback-ID: ie15541ac:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Sat, 21 Sep 2024 08:12:58 -0400 (EDT) From: Joost Kremers To: =?utf-8?B?Sm/Do28gVMOhdm9yYQ==?= Subject: Re: bug#73355: 29.4; eglot-rename reports success when it shouldn't In-Reply-To: (=?utf-8?Q?=22Jo=C3=A3o_T=C3=A1vora=22's?= message of "Sat, 21 Sep 2024 12:43:32 +0100") References: <86plozvomz.fsf@fastmail.fm> <864j6947n1.fsf@gnu.org> Date: Sat, 21 Sep 2024 14:12:55 +0200 Message-ID: <86zfo1kxx4.fsf@fastmail.fm> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 73355 Cc: 73355@debbugs.gnu.org, Eli Zaretskii X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) On Sat, Sep 21 2024, Jo=C3=A3o T=C3=A1vora wrote: > I have this some version of this server somewhere, maybe I can reproduce, > but as always better to follow the instructions in the manual > https://joaotavora.github.io/eglot/#Troubleshooting-Eglot and give the > remaining items of a full MRE. Sure, I'll do that later today or tomorrow. > It's possible Eglot is just successfully applying 0 edits. I guess that's one way of looking at it. :-) --=20 Joost Kremers Life has its moments From debbugs-submit-bounces@debbugs.gnu.org Sat Sep 21 16:17:24 2024 Received: (at 73355) by debbugs.gnu.org; 21 Sep 2024 20:17:25 +0000 Received: from localhost ([127.0.0.1]:40355 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ss6Xk-0005Uo-In for submit@debbugs.gnu.org; Sat, 21 Sep 2024 16:17:24 -0400 Received: from mail-oi1-f176.google.com ([209.85.167.176]:46198) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ss6Xi-0005US-4b for 73355@debbugs.gnu.org; Sat, 21 Sep 2024 16:17:22 -0400 Received: by mail-oi1-f176.google.com with SMTP id 5614622812f47-3e03b6d99c3so1619570b6e.0 for <73355@debbugs.gnu.org>; Sat, 21 Sep 2024 13:17:01 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1726949756; x=1727554556; darn=debbugs.gnu.org; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:from:to:cc:subject:date:message-id:reply-to; bh=S8XCJ3QhyN1q8Di0NXeMVT0J5LCEEWI8HvEq512Ypfk=; b=KAfC4GuOzFie0FTxNMpCISwNardLBLVyp0ok6HEFDbCc9XGA9GpNbGzRqJQwIY2rZx W78i1F5k+WMVz3nxK9VjuWHf3fC6aU+gBN4ARDiT1tLnIIGjTOqqa2Fs0zw5OGHzO3rN y0tnPVxyOBPmADt7uUAe5j2wFcp5+3axkrbaFs/Bf6Glb2TjpqKexkvrjQelAMxTzhet IgZC5zgEUh/tF7uYUJadi2YFgg9hPVx/dFM//iAPh0Bs2S0uuDnv6nnZYQiuMqF3lY+p wE7uqHAHtVDdbMLYIsQRStdGnyA3cc8ga7goDgA5fY3BdRx4Xhi4ezeCdqboLK+Dg8SC Zpew== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1726949756; x=1727554556; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:x-gm-message-state:from:to:cc:subject:date:message-id :reply-to; bh=S8XCJ3QhyN1q8Di0NXeMVT0J5LCEEWI8HvEq512Ypfk=; b=blNK5jofBEQVfz/lxLmDHy1WD7n0faad6WL83uJBogWlWHtSrhPAU3rUJadDFZ8z78 SN6U09DEdjDDADt01foYtoQ+Bnc1V1r1KbUyCWoFtyMO/lg+0OKNTHNJ1kWvFIZU8ZPd +Jl3O1TmXKsGGAhizg7aiL1oT7fMr3bzIw5TUz0Iypo4qe7ST+St1+VCiK8B1gp573bK Xce5yymhYZTTOK43X1d7tZ1tL1Bfmmiy6ckd9qbK3SV4wphVEvjBBbLLr0ft9LJk/8XY hq5ttAvG997akKZJAuW5qXgSxAF6zm1bfxN+/8nX/sjfi7E8PPUyP14/2HgL3ioGAjDN 3+hw== X-Forwarded-Encrypted: i=1; AJvYcCV78hzyAt5Cpm8YxMcgmxswOZS5QL48r1HOIRbysMZ5VFIY1cE1hmLp2J0o9X5vBl+LuDnYdQ==@debbugs.gnu.org X-Gm-Message-State: AOJu0Yxo+xPfBSbtvKRVEOVWxhzhEIx6owHt7h9NwGOE5jy5UtC0CmRK RIi5j/3JENi8uYaQMSxIok7a6dRWVBXtomRJAs7LFZ3WzF3BFOvk91Rm8XsfIWEeRHG7NpEb406 SkfhtiA+ecLLQWVkBT8UAhgQErEg= X-Google-Smtp-Source: AGHT+IGxEg0BBMvlSJD8bqy42ZiGnHS2KiveyWTCmBY3WKDo13pU/j38/IwE0W3iM50AZDmcGz3inSdQANviLYAnkfM= X-Received: by 2002:a05:6808:199b:b0:3e0:3ab7:d7ad with SMTP id 5614622812f47-3e271bbd299mr5141904b6e.22.1726949755685; Sat, 21 Sep 2024 13:15:55 -0700 (PDT) MIME-Version: 1.0 References: <86plozvomz.fsf@fastmail.fm> <864j6947n1.fsf@gnu.org> <86zfo1kxx4.fsf@fastmail.fm> In-Reply-To: <86zfo1kxx4.fsf@fastmail.fm> From: =?UTF-8?B?Sm/Do28gVMOhdm9yYQ==?= Date: Sat, 21 Sep 2024 21:15:42 +0100 Message-ID: Subject: Re: bug#73355: 29.4; eglot-rename reports success when it shouldn't To: Joost Kremers Content-Type: multipart/alternative; boundary="000000000000bb92ff0622a6d2b2" X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 73355 Cc: 73355@debbugs.gnu.org, Eli Zaretskii X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --000000000000bb92ff0622a6d2b2 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable On Sat, Sep 21, 2024, 13:13 Joost Kremers wrote:= . > > > It's possible Eglot is just successfully applying 0 edits. > > I guess that's one way of looking at it. :-) > I'm say this because Eglot has no logic to check if a rename is valid or not. It just does what the server tells it to. If the intended rename is invalid, the server can error out (and Eglot will tell you this) out return 0 edits. Either way, the server calls all the shots. Jo=C3=A3o > --000000000000bb92ff0622a6d2b2 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable

On Sat, Sep 21, 2024, 13:13 Joost Kremers <joostk= remers@fastmail.fm> wrote:.

> It's possible Eglot is just successfully applying 0 edits.

I guess that's one way of looking at it. :-)

I'm say this because Eg= lot has no logic to check if a rename is valid or not. It just does what th= e server tells it to. If the intended rename is invalid, the server can err= or out (and Eglot will tell you this) out return 0 edits. Either way, the s= erver calls all the shots.

Jo=C3=A3o
--000000000000bb92ff0622a6d2b2-- From debbugs-submit-bounces@debbugs.gnu.org Sat Sep 21 18:05:26 2024 Received: (at 73355) by debbugs.gnu.org; 21 Sep 2024 22:05:26 +0000 Received: from localhost ([127.0.0.1]:40423 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ss8EH-0002nz-PZ for submit@debbugs.gnu.org; Sat, 21 Sep 2024 18:05:26 -0400 Received: from fhigh3-smtp.messagingengine.com ([103.168.172.154]:37891) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ss8EG-0002lP-3A for 73355@debbugs.gnu.org; Sat, 21 Sep 2024 18:05:24 -0400 Received: from phl-compute-01.internal (phl-compute-01.phl.internal [10.202.2.41]) by mailfhigh.phl.internal (Postfix) with ESMTP id 21A171140143; Sat, 21 Sep 2024 18:04:57 -0400 (EDT) Received: from phl-mailfrontend-01 ([10.202.2.162]) by phl-compute-01.internal (MEProxy); Sat, 21 Sep 2024 18:04:57 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.fm; h= cc:cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm2; t=1726956297; x=1727042697; bh=2xqXoYv39FBydBggSrEOklOfgtZIGDQajTXEYu/+KrM=; b= IGPsg33LMGyevYl7MQpg5KKNelbSK7HgREazyNUwbIj1Q23nFEOpJ3L5SV9DR4EU NOWbRbFIh+Y0n/lNUC3uZTTWJVyrr6ldg9BlQGh+SaYdMo90itISQF8vgfh6P1vm XDDvBa/Nn2ueIAHCcMJSkJs/rW8dpmgmthjB0ru3Bhd261Id1aIlTV8sSjDDD3j9 R4YMTGXqkTFks0cW2D/CR2SdairL1fQV8nN6gJGGPNfF7lyjZOLGnmpO4G/xmpvn ZaCOyCY0OqWW3nReWME0H60RASCo6iAh0w1PWxJfPqcuEnToEvh/00xvlfxVnAnI e6dk7rXHDfuNdU1+WwO8Sw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm2; t=1726956297; x= 1727042697; bh=2xqXoYv39FBydBggSrEOklOfgtZIGDQajTXEYu/+KrM=; b=H MsJn2G6mGu/9jC0AtnMyaUmUU/5kuDtTJ2PvbPfqPsPB6uRBe360o35yYHk38/hr IFYjJ7JHXO1cXTFRbGMT7qA7slElMG1qRqPkEtApefD/5qco3+tAp0wr8xlUEBSu KzqknwxpTNiVkO/kO5nbKb21NSNhZkD6zBw3jNSE0bjwkw1zpqeRHtZuyJ5QWA8O W8iVG5/RBBCio7br8WKye+9m9g2Ub4LxljZY5IB7VLasB5CrYo/EDlgX7isY1D15 4giYlj9DCRapXmGT1n/sGKzzFzhZ+nb2BcahertpsbYxQn+XPDGWqNs/B5vHmMfJ 2N+yizgMdDTxCUkC+KLbg== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrudeliedgtdeiucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhephffvvefujghffffkgggtgfesthhqredttddtjeen ucfhrhhomheplfhoohhsthcumfhrvghmvghrshcuoehjohhoshhtkhhrvghmvghrshesfh grshhtmhgrihhlrdhfmheqnecuggftrfgrthhtvghrnhepgffggeekheevfefgtdfgveej feegveehfeelueehgfehgeejheevjeeugfejjedtnecuvehluhhsthgvrhfuihiivgeptd enucfrrghrrghmpehmrghilhhfrhhomhepjhhoohhsthhkrhgvmhgvrhhssehfrghsthhm rghilhdrfhhmpdhnsggprhgtphhtthhopeefpdhmohguvgepshhmthhpohhuthdprhgtph htthhopeejfeefheehseguvggssghughhsrdhgnhhurdhorhhgpdhrtghpthhtohepvghl ihiisehgnhhurdhorhhgpdhrtghpthhtohepjhhorghothgrvhhorhgrsehgmhgrihhlrd gtohhm X-ME-Proxy: Feedback-ID: ie15541ac:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Sat, 21 Sep 2024 18:04:55 -0400 (EDT) From: Joost Kremers To: =?utf-8?B?Sm/Do28gVMOhdm9yYQ==?= Subject: Re: bug#73355: 29.4; eglot-rename reports success when it shouldn't In-Reply-To: (=?utf-8?Q?=22Jo=C3=A3o_T=C3=A1vora=22's?= message of "Sat, 21 Sep 2024 21:15:42 +0100") References: <86plozvomz.fsf@fastmail.fm> <864j6947n1.fsf@gnu.org> <86zfo1kxx4.fsf@fastmail.fm> Date: Sun, 22 Sep 2024 00:04:52 +0200 Message-ID: <86plowslx7.fsf@fastmail.fm> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 73355 Cc: 73355@debbugs.gnu.org, Eli Zaretskii X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) On Sat, Sep 21 2024, Jo=C3=A3o T=C3=A1vora wrote: > On Sat, Sep 21, 2024, 13:13 Joost Kremers > wrote:. > >> >> > It's possible Eglot is just successfully applying 0 edits. >> >> I guess that's one way of looking at it. :-) >> > > I'm say this because Eglot has no logic to check if a rename is valid or > not. It just does what the server tells it to. If the intended rename is > invalid, the server can error out (and Eglot will tell you this) out retu= rn > 0 edits. Either way, the server calls all the shots. Ah, OK, I didn't realise that. So does the server report it made 0 edits? If it does, would it make sense to have Eglot say no changes were made? As soon as I have some time, I'll see if I can find out a bit more and possibly take it up with the basedpyright people. Thanks, Joost --=20 Joost Kremers Life has its moments From debbugs-submit-bounces@debbugs.gnu.org Sat Sep 21 18:31:45 2024 Received: (at 73355) by debbugs.gnu.org; 21 Sep 2024 22:31:45 +0000 Received: from localhost ([127.0.0.1]:40429 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ss8dl-0004GV-B5 for submit@debbugs.gnu.org; Sat, 21 Sep 2024 18:31:45 -0400 Received: from mail-oo1-f45.google.com ([209.85.161.45]:46404) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ss8dj-0004GF-4c for 73355@debbugs.gnu.org; Sat, 21 Sep 2024 18:31:44 -0400 Received: by mail-oo1-f45.google.com with SMTP id 006d021491bc7-5d5eec95a74so1543909eaf.1 for <73355@debbugs.gnu.org>; Sat, 21 Sep 2024 15:31:22 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1726957816; x=1727562616; darn=debbugs.gnu.org; h=content-transfer-encoding:cc:to:subject:message-id:date:from :in-reply-to:references:mime-version:from:to:cc:subject:date :message-id:reply-to; bh=9zgsXzI1sc6gPDj3VQckFrij/snve2+c1HTuqZ/pOEc=; b=lqTi58X/6rrk6d4aSRL13YgLGJI3LlnCln7Y/0lfcpvnKsgzI29qtijym7FaTQm3E1 9PDWXPeAcyjhJJs7Fu5yHj7933D13T8oEkygjnCh30Y7+tMlGlg8mYhrikEY4RZ8/p53 Uu90PnmXM1MqJLA4+UyvyqRgSTI6UBjhwR7WyuZ57S96LR0qUw7LUBGhpUT7tExPxlsG 1KF2ousVsKEEVkJGhL3I3ZnF9i15WJOOPhbXkG5VUKjcmYyOzJ52c3oAD7HPW4zvSQfs 67yo/4Y9/XcYA3Su2tc9qvEBq6bJNRlGfGfd1FjRIQBPTWn+BtKGsXIjknWAtA1Dqg96 dQIQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1726957816; x=1727562616; h=content-transfer-encoding:cc:to:subject:message-id:date:from :in-reply-to:references:mime-version:x-gm-message-state:from:to:cc :subject:date:message-id:reply-to; bh=9zgsXzI1sc6gPDj3VQckFrij/snve2+c1HTuqZ/pOEc=; b=RahAVtseLBiwKm7EDAVMkHX/NpLlr62bqTpX9gRzUdnT0lulTaq04Fog7+7ajulQwo o7eStWaC354UKTR8Gtw7F74inj5aaDYrh/D0zOpBKmNLKypy1o7Th+3RVc9FkXD1N77/ RkJKb9+VcZcB4zBCTwc2gJaEi8nBSGmecpCmwwD1WxRzOGeYuvPMqF+A3GSAcZINFPZ9 ap6wo3KnESI6v8EEaQ8vAJFL77tvd84eNXq43sjWBx2NuQWWofx1uIjdOLW6A0HzBeTq Z9umPwOs32TbmT2t8xLHp0jaZx4sZGDLzRlze065P6veL8Kz2TFrZgRw1U8Ca87ZbwtB vxMw== X-Forwarded-Encrypted: i=1; AJvYcCWw95qPb0kGqVoXCV4od32oH5Kd0IdfE3KAF4WacHNH+J5N6fnlC3KvkzONKzyn1qwis/yq7g==@debbugs.gnu.org X-Gm-Message-State: AOJu0YxUObYuIfcc0Jl/ycvNY8Xs5/fQqSUwcdivfO8Omd7i84gpieZe jUFEYRV0HL/UuMWyokyW0c977o7qyb9d2qQuREOEjoHk6FTJ09YrBHWJ2teVHshQwJo3nnqxAN3 K9ug+VSaz+SJc56aCZCTydCGYf+g= X-Google-Smtp-Source: AGHT+IHZ1aceJe2TjhjdySJ5VQ509AI+usKkPZYm91ZPDLVa+lXslYjUwxvE0vZwPDGMWroDh/QLuC6iaLAxrtogww0= X-Received: by 2002:a05:6808:d4d:b0:3df:144f:9ef9 with SMTP id 5614622812f47-3e271cf5ecbmr5162070b6e.41.1726957816329; Sat, 21 Sep 2024 15:30:16 -0700 (PDT) MIME-Version: 1.0 References: <86plozvomz.fsf@fastmail.fm> <864j6947n1.fsf@gnu.org> <86zfo1kxx4.fsf@fastmail.fm> <86plowslx7.fsf@fastmail.fm> In-Reply-To: <86plowslx7.fsf@fastmail.fm> From: =?UTF-8?B?Sm/Do28gVMOhdm9yYQ==?= Date: Sat, 21 Sep 2024 23:31:43 +0100 Message-ID: Subject: Re: bug#73355: 29.4; eglot-rename reports success when it shouldn't To: Joost Kremers Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 73355 Cc: 73355@debbugs.gnu.org, Eli Zaretskii X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) On Sat, Sep 21, 2024 at 11:04=E2=80=AFPM Joost Kremers wrote: > Ah, OK, I didn't realise that. So does the server report it made 0 edits? I don't know, you haven't supplied that part of the report yet. > If it does, would it make sense to have Eglot say no changes were made? Maybe. Some sense. But IMO it would make even more sense for the server to error out. From debbugs-submit-bounces@debbugs.gnu.org Sat Sep 21 18:46:36 2024 Received: (at 73355) by debbugs.gnu.org; 21 Sep 2024 22:46:36 +0000 Received: from localhost ([127.0.0.1]:40435 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ss8s7-00053T-Qm for submit@debbugs.gnu.org; Sat, 21 Sep 2024 18:46:36 -0400 Received: from fhigh3-smtp.messagingengine.com ([103.168.172.154]:46291) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ss8s6-00053D-Kd for 73355@debbugs.gnu.org; Sat, 21 Sep 2024 18:46:35 -0400 Received: from phl-compute-09.internal (phl-compute-09.phl.internal [10.202.2.49]) by mailfhigh.phl.internal (Postfix) with ESMTP id 3C1B31140430; Sat, 21 Sep 2024 18:46:08 -0400 (EDT) Received: from phl-mailfrontend-01 ([10.202.2.162]) by phl-compute-09.internal (MEProxy); Sat, 21 Sep 2024 18:46:08 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.fm; h= cc:cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm2; t=1726958768; x=1727045168; bh=Qc6d3t0rNoxAlJILYgsEQe+KazBhBPWaRImYGbsN+J8=; b= Lz2GHUnTJXc4UNr2237EwtYeDaJv7wEpDPNWP1iGy6U8YjU60mTCvekEKsPKjWtN 4k1womsy7Z/nXxJGMkc70d2xa4H4QcrY8bW339GE75Ky6XjP/jWeduwNqg1vtQRL MBq4D5BUZk0Qm864yc69N+jdGY+f0MrRHtTpUR50vdVc6Vp3DNee6hB1sRnA1XWz yvV9HDrL6/8GmM2Hpd0kS0wLS65uIweLguO36AhSjrFOyt8ZFr4YYy+bRnVvyWkO bgGy8lmP8/HQVNmtf1a/jGZHzvJXFSqgLzcp8BO3xVSmNNhIx7sePS18H6OvRoF9 cfMgXDyADeSzWJ+8N63+KQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm2; t=1726958768; x= 1727045168; bh=Qc6d3t0rNoxAlJILYgsEQe+KazBhBPWaRImYGbsN+J8=; b=Z GgkYwXy4lamIf1rMTuWd/VmOFGP5oyJGzDmphk1aEe8HDGA1hEBCV5L41og6KEy5 C3iP5DwoencMw4dlrozfMz16r1G8kp8TTXlll8kIt5Ecl4dQwt0UmYINN0RN2aSK MTBRpuu/gOlAEhUjlScol5xXIwm3BsACqUo0VHAj9fNUpgr7lzDLYrUW0gg0yaNR 2hl8QFW0d1OaUKgb6bUh4xUCSxJybMgeKgEpzHMA5KhCkbktPso9JDW/MiCvCSV/ Yp8eOSkjeLUtX/KBzLrtPtBfk28BdemJr7Oa+9cx7d0RQTvGMgs3DZwNbQ/w8jTM p3ndu0ogJ3zHs0v2l0lJg== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrudeliedgudegucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnegoufhushhpvggtthffohhmrghinhculdegledmnecujfgurhep hffvvefujghffffkgggtgfesthhqredttddtjeenucfhrhhomheplfhoohhsthcumfhrvg hmvghrshcuoehjohhoshhtkhhrvghmvghrshesfhgrshhtmhgrihhlrdhfmheqnecuggft rfgrthhtvghrnheptedugefgveeihedtleelgffgtdeljeekvdeuleegieeljedukeeutd ehveetteeknecuffhomhgrihhnpehgihhthhhusgdrihhopdgsrghsvgguphihrhhighhh thdrtghomhenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhroh hmpehjohhoshhtkhhrvghmvghrshesfhgrshhtmhgrihhlrdhfmhdpnhgspghrtghpthht ohepfedpmhhouggvpehsmhhtphhouhhtpdhrtghpthhtohepjeeffeehheesuggvsggsuh hgshdrghhnuhdrohhrghdprhgtphhtthhopegvlhhiiiesghhnuhdrohhrghdprhgtphht thhopehjohgrohhtrghvohhrrgesghhmrghilhdrtghomh X-ME-Proxy: Feedback-ID: ie15541ac:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Sat, 21 Sep 2024 18:46:06 -0400 (EDT) From: Joost Kremers To: =?utf-8?B?Sm/Do28gVMOhdm9yYQ==?= Subject: Re: bug#73355: 29.4; eglot-rename reports success when it shouldn't In-Reply-To: (=?utf-8?Q?=22Jo=C3=A3o_T=C3=A1vora=22's?= message of "Sat, 21 Sep 2024 12:43:32 +0100") References: <86plozvomz.fsf@fastmail.fm> <864j6947n1.fsf@gnu.org> Date: Sun, 22 Sep 2024 00:46:04 +0200 Message-ID: <8634lspqvn.fsf@fastmail.fm> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 73355 Cc: 73355@debbugs.gnu.org, Eli Zaretskii X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) On Sat, Sep 21 2024, Jo=C3=A3o T=C3=A1vora wrote: > I have this some version of this server somewhere, maybe I can reproduce, > but as always better to follow the instructions in the manual > https://joaotavora.github.io/eglot/#Troubleshooting-Eglot and give the > remaining items of a full MRE. OK, here goes: 1. The relevant lines from the events buffer (apologies for the long lines): ``` [jsonrpc] e[00:13:52.047] --> textDocument/rename[27] {"jsonrpc":"2.0","id"= :27,"method":"textDocument/rename","params":{"textDocument":{"uri":"file://= /home/joost/Projects/Python/pyscratch/src/search.py"},"position":{"line":88= ,"character":29},"newName":"seq"}} [jsonrpc] e[00:13:52.049] <-- textDocument/rename[27] #[0 "\300\301\302\3= 03\304\305\257\6\207" [:id 27 :jsonrpc "2.0" :result nil] 14] ``` Contrast this with a call to 'eglot-rename' that *does* yield changes: ``` [jsonrpc] e[00:16:34.228] --> textDocument/rename[68] {"jsonrpc":"2.0","id"= :68,"method":"textDocument/rename","params":{"textDocument":{"uri":"file://= /home/joost/Projects/Python/pyscratch/src/search.py"},"position":{"line":87= ,"character":8},"newName":"arr"}} [jsonrpc] e[00:16:34.235] <-- textDocument/rename[68] #[0 "\323\312\324\3= 25\326\327\313\330\313\302\303\304\305\306\307\300\331\301\314F\310\300\332= \301\314FF\257\6\302\303\304\305\306\307\300\333\301\315F\310\300\334\301\3= 15FF\257\6\302\303\304\305\306\307\300\311\301\316F\310\300\312\301\316FF\2= 57\6\302\303\304\305\306\307\300\317\301\320F\310\300\311\301\320FF\257\6\3= 02\303\304\305\306\307\300\317\301\321F\310\300\311\301\321FF\257\6\302\303= \304\305\306\307\300\335\301\322F\310\300\336\301\322FF\257\6&\6\337\340\34= 1\342\343FF!D\257\6\207" [:character :line :annotationId "default" :newText= "arr" :range :end :start 71 68 vector 87 88 89 74 90 91 93 :id :jsonrpc "2= .0" :result :documentChanges :edits 11 8 32 29 50 47 :textDocument :uri "fi= le:///home/joost/Projects/Python/pyscratch/src/search.py" :version nil] 34] ``` Looks like basedpyright is reporting that it didn't make any changes in the first case (':results nil'). 2. Emacs did not signal an error. 3. The language server I used is basedpyright, which can be installed from PyPI with the usual tools. I have version 1.17.5, which is the latest release. To configure Eglot to use it, the basedpyright docs suggest to add the following to one's init file (which is what I do): ``` (add-to-list 'eglot-server-programs '((python-mode python-ts-mode) "basedpyright-langserver" "--stdio")) ``` See https://docs.basedpyright.com/#/installation for details. 4. For a minimal project, all you'll need is a single Python file with a single function, which can be as simple as this: ``` def some_func(): a: int =3D 5 b: int =3D d + 7 c: int =3D d + 13 print(b+c) ``` Try to rename the two occurrences of 'd' to 'a'. The code snippet in my original email will also do, even if basedpyright will report a bunch of errors in it for undefined functions. Those don't affect the rename. 5. Emacs: 29.4, Eglot 1.17 (from GNU ELPA), basedpyright 1.17.5. 6. I assume the issue is so straightforward that there's no need for a recipe that's more detailed than the above. Thanks, Joost --=20 Joost Kremers Life has its moments From debbugs-submit-bounces@debbugs.gnu.org Sat Oct 05 05:57:35 2024 Received: (at 73355) by debbugs.gnu.org; 5 Oct 2024 09:57:35 +0000 Received: from localhost ([127.0.0.1]:37301 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1sx1Xb-0003rI-3f for submit@debbugs.gnu.org; Sat, 05 Oct 2024 05:57:35 -0400 Received: from eggs.gnu.org ([209.51.188.92]:60072) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1sx1XZ-0003pz-96 for 73355@debbugs.gnu.org; Sat, 05 Oct 2024 05:57:34 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1sx1XP-0007Ri-Jd; Sat, 05 Oct 2024 05:57:23 -0400 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-version:References:Subject:In-Reply-To:To:From: Date; bh=ohHC5aMC20RZA1aacTL4MPcGgDeXWsl8KUQPuulnEMQ=; b=YEd2WlwAlKHLSjRCZgL+ gExVx+UHth1IPC+7xTnAFlfDy9eHD7EtSmmvVPg84mj0ZuAdTM7XsLu7ijVUY/jD1yyfnnJ4zpW9O kDsNw120qPSOoMYY3zQSnBHfh74jV/OsCBrnJt4Lci4WAf0YVbVTDeWhGcvGs8XHaeEuU2RIUWzXU LPXU0NVirtnuyM9LmNTrge+Ts+n06Ni0wdU8LcLIqNdW2eHsoyFl6Sa4r7oeWDdNZPpiKGihAGjRe FdWof2azRsMKFN7bh9rS0m3We68rdUZ4F/zR/5sGYqWkHf2D1eiDsFIzY+EqmnAl0cVB0C4uJCJWG wX0eMdm5xbTagw==; Date: Sat, 05 Oct 2024 12:57:20 +0300 Message-Id: <86ttdqx473.fsf@gnu.org> From: Eli Zaretskii To: joaotavora@gmail.com, Joost Kremers In-Reply-To: <8634lspqvn.fsf@fastmail.fm> (message from Joost Kremers on Sun, 22 Sep 2024 00:46:04 +0200) Subject: Re: bug#73355: 29.4; eglot-rename reports success when it shouldn't References: <86plozvomz.fsf@fastmail.fm> <864j6947n1.fsf@gnu.org> <8634lspqvn.fsf@fastmail.fm> MIME-version: 1.0 Content-type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 73355 Cc: 73355@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Ping! > From: Joost Kremers > Cc: Eli Zaretskii , 73355@debbugs.gnu.org > Date: Sun, 22 Sep 2024 00:46:04 +0200 > > On Sat, Sep 21 2024, João Távora wrote: > > I have this some version of this server somewhere, maybe I can reproduce, > > but as always better to follow the instructions in the manual > > https://joaotavora.github.io/eglot/#Troubleshooting-Eglot and give the > > remaining items of a full MRE. > > OK, here goes: > > 1. The relevant lines from the events buffer (apologies for the long lines): > > ``` > [jsonrpc] e[00:13:52.047] --> textDocument/rename[27] {"jsonrpc":"2.0","id":27,"method":"textDocument/rename","params":{"textDocument":{"uri":"file:///home/joost/Projects/Python/pyscratch/src/search.py"},"position":{"line":88,"character":29},"newName":"seq"}} > [jsonrpc] e[00:13:52.049] <-- textDocument/rename[27] #[0 "\300\301\302\303\304\305\257\6\207" [:id 27 :jsonrpc "2.0" :result nil] 14] > ``` > > Contrast this with a call to 'eglot-rename' that *does* yield changes: > > ``` > [jsonrpc] e[00:16:34.228] --> textDocument/rename[68] {"jsonrpc":"2.0","id":68,"method":"textDocument/rename","params":{"textDocument":{"uri":"file:///home/joost/Projects/Python/pyscratch/src/search.py"},"position":{"line":87,"character":8},"newName":"arr"}} > [jsonrpc] e[00:16:34.235] <-- textDocument/rename[68] #[0 "\323\312\324\325\326\327\313\330\313\302\303\304\305\306\307\300\331\301\314F\310\300\332\301\314FF\257\6\302\303\304\305\306\307\300\333\301\315F\310\300\334\301\315FF\257\6\302\303\304\305\306\307\300\311\301\316F\310\300\312\301\316FF\257\6\302\303\304\305\306\307\300\317\301\320F\310\300\311\301\320FF\257\6\302\303\304\305\306\307\300\317\301\321F\310\300\311\301\321FF\257\6\302\303\304\305\306\307\300\335\301\322F\310\300\336\301\322FF\257\6&\6\337\340\341\342\343FF!D\257\6\207" [:character :line :annotationId "default" :newText "arr" :range :end :start 71 68 vector 87 88 89 74 90 91 93 :id :jsonrpc "2.0" :result :documentChanges :edits 11 8 32 29 50 47 :textDocument :uri "file:///home/joost/Projects/Python/pyscratch/src/search.py" :version nil] 34] > ``` > > Looks like basedpyright is reporting that it didn't make any changes in the > first case (':results nil'). > > 2. Emacs did not signal an error. > > 3. The language server I used is basedpyright, which can be installed from > PyPI with the usual tools. I have version 1.17.5, which is the latest > release. > > To configure Eglot to use it, the basedpyright docs suggest to add the > following to one's init file (which is what I do): > > ``` > (add-to-list 'eglot-server-programs > '((python-mode python-ts-mode) > "basedpyright-langserver" "--stdio")) > ``` > > See https://docs.basedpyright.com/#/installation for details. > > 4. For a minimal project, all you'll need is a single Python file with a > single function, which can be as simple as this: > > ``` > def some_func(): > a: int = 5 > b: int = d + 7 > c: int = d + 13 > print(b+c) > ``` > > Try to rename the two occurrences of 'd' to 'a'. > > The code snippet in my original email will also do, even if basedpyright > will report a bunch of errors in it for undefined functions. Those don't > affect the rename. > > 5. Emacs: 29.4, Eglot 1.17 (from GNU ELPA), basedpyright 1.17.5. > > 6. I assume the issue is so straightforward that there's no need for a > recipe that's more detailed than the above. > > Thanks, > > Joost > > > -- > Joost Kremers > Life has its moments > From debbugs-submit-bounces@debbugs.gnu.org Sat Oct 19 03:03:40 2024 Received: (at 73355) by debbugs.gnu.org; 19 Oct 2024 07:03:40 +0000 Received: from localhost ([127.0.0.1]:41085 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1t23Ux-00070h-FF for submit@debbugs.gnu.org; Sat, 19 Oct 2024 03:03:40 -0400 Received: from eggs.gnu.org ([209.51.188.92]:33546) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1t23Uv-00070M-8l for 73355@debbugs.gnu.org; Sat, 19 Oct 2024 03:03:38 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1t23US-00011e-Cm; Sat, 19 Oct 2024 03:03:08 -0400 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-version:References:Subject:In-Reply-To:To:From: Date; bh=6d/JcUKHnztBkM64otbfr4UUrRgnqpp28rHaySN5Cxw=; b=MJKUyfla2lYMaAuw9tSJ SPTOudGSidz7wMQjq8WVL97LtrxTWR/p15+106815EU9usTCNKnIHfKMmMpDH4bhbUaZGH5+b6J32 J0wn8Kx2fkXzm/IVk2Na4rjp6HNC6pPtRgLWOWcq/wL8mFwfyftGRZd204HpyDR4yn8K4uMjVj+Er zFvDLXjPYDv2EMSqbiPQPwVH3JGQVsCmE3YQgmxTxl17RQ973IKRc4xrKkleWp8sJG0q3IhKSPod/ NQ6qF6jxLzCto/fs17yudUV0XiP6wZQ5gaYijc/8ZbVKI4cvjePT27qljgFM1OHu5LIYKGNS+3w7Y DvDibdGYbrpPLA==; Date: Sat, 19 Oct 2024 10:03:06 +0300 Message-Id: <864j58mv6d.fsf@gnu.org> From: Eli Zaretskii To: joaotavora@gmail.com, joostkremers@fastmail.fm In-Reply-To: <86ttdqx473.fsf@gnu.org> (message from Eli Zaretskii on Sat, 05 Oct 2024 12:57:20 +0300) Subject: Re: bug#73355: 29.4; eglot-rename reports success when it shouldn't References: <86plozvomz.fsf@fastmail.fm> <864j6947n1.fsf@gnu.org> <8634lspqvn.fsf@fastmail.fm> <86ttdqx473.fsf@gnu.org> MIME-version: 1.0 Content-type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 73355 Cc: 73355@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Ping! Ping! > Cc: 73355@debbugs.gnu.org > Date: Sat, 05 Oct 2024 12:57:20 +0300 > From: Eli Zaretskii > > Ping! > > > From: Joost Kremers > > Cc: Eli Zaretskii , 73355@debbugs.gnu.org > > Date: Sun, 22 Sep 2024 00:46:04 +0200 > > > > On Sat, Sep 21 2024, João Távora wrote: > > > I have this some version of this server somewhere, maybe I can reproduce, > > > but as always better to follow the instructions in the manual > > > https://joaotavora.github.io/eglot/#Troubleshooting-Eglot and give the > > > remaining items of a full MRE. > > > > OK, here goes: > > > > 1. The relevant lines from the events buffer (apologies for the long lines): > > > > ``` > > [jsonrpc] e[00:13:52.047] --> textDocument/rename[27] {"jsonrpc":"2.0","id":27,"method":"textDocument/rename","params":{"textDocument":{"uri":"file:///home/joost/Projects/Python/pyscratch/src/search.py"},"position":{"line":88,"character":29},"newName":"seq"}} > > [jsonrpc] e[00:13:52.049] <-- textDocument/rename[27] #[0 "\300\301\302\303\304\305\257\6\207" [:id 27 :jsonrpc "2.0" :result nil] 14] > > ``` > > > > Contrast this with a call to 'eglot-rename' that *does* yield changes: > > > > ``` > > [jsonrpc] e[00:16:34.228] --> textDocument/rename[68] {"jsonrpc":"2.0","id":68,"method":"textDocument/rename","params":{"textDocument":{"uri":"file:///home/joost/Projects/Python/pyscratch/src/search.py"},"position":{"line":87,"character":8},"newName":"arr"}} > > [jsonrpc] e[00:16:34.235] <-- textDocument/rename[68] #[0 "\323\312\324\325\326\327\313\330\313\302\303\304\305\306\307\300\331\301\314F\310\300\332\301\314FF\257\6\302\303\304\305\306\307\300\333\301\315F\310\300\334\301\315FF\257\6\302\303\304\305\306\307\300\311\301\316F\310\300\312\301\316FF\257\6\302\303\304\305\306\307\300\317\301\320F\310\300\311\301\320FF\257\6\302\303\304\305\306\307\300\317\301\321F\310\300\311\301\321FF\257\6\302\303\304\305\306\307\300\335\301\322F\310\300\336\301\322FF\257\6&\6\337\340\341\342\343FF!D\257\6\207" [:character :line :annotationId "default" :newText "arr" :range :end :start 71 68 vector 87 88 89 74 90 91 93 :id :jsonrpc "2.0" :result :documentChanges :edits 11 8 32 29 50 47 :textDocument :uri "file:///home/joost/Projects/Python/pyscratch/src/search.py" :version nil] 34] > > ``` > > > > Looks like basedpyright is reporting that it didn't make any changes in the > > first case (':results nil'). > > > > 2. Emacs did not signal an error. > > > > 3. The language server I used is basedpyright, which can be installed from > > PyPI with the usual tools. I have version 1.17.5, which is the latest > > release. > > > > To configure Eglot to use it, the basedpyright docs suggest to add the > > following to one's init file (which is what I do): > > > > ``` > > (add-to-list 'eglot-server-programs > > '((python-mode python-ts-mode) > > "basedpyright-langserver" "--stdio")) > > ``` > > > > See https://docs.basedpyright.com/#/installation for details. > > > > 4. For a minimal project, all you'll need is a single Python file with a > > single function, which can be as simple as this: > > > > ``` > > def some_func(): > > a: int = 5 > > b: int = d + 7 > > c: int = d + 13 > > print(b+c) > > ``` > > > > Try to rename the two occurrences of 'd' to 'a'. > > > > The code snippet in my original email will also do, even if basedpyright > > will report a bunch of errors in it for undefined functions. Those don't > > affect the rename. > > > > 5. Emacs: 29.4, Eglot 1.17 (from GNU ELPA), basedpyright 1.17.5. > > > > 6. I assume the issue is so straightforward that there's no need for a > > recipe that's more detailed than the above. > > > > Thanks, > > > > Joost > > > > > > -- > > Joost Kremers > > Life has its moments > > > > > > From debbugs-submit-bounces@debbugs.gnu.org Sat Nov 02 07:43:51 2024 Received: (at 73355) by debbugs.gnu.org; 2 Nov 2024 11:43:51 +0000 Received: from localhost ([127.0.0.1]:53358 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1t7CXn-0008G1-0A for submit@debbugs.gnu.org; Sat, 02 Nov 2024 07:43:51 -0400 Received: from eggs.gnu.org ([209.51.188.92]:41114) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1t7CXl-0008Fr-RC for 73355@debbugs.gnu.org; Sat, 02 Nov 2024 07:43:50 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1t7CXg-0005rC-Ds; Sat, 02 Nov 2024 07:43:44 -0400 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-version:References:Subject:In-Reply-To:To:From: Date; bh=peVV1hCwhyQsx5f5gjssgmKkVdkMhNGDqd7X3OZyi8Q=; b=sfQYTUhV3NTPzAxMx/RC MUnRpbVn4ijFdQ4rYXA0NXYizYXnRevikSAZIqSUlowNls0e/vR3ZrCT11HiRGzs0pq3OP5VlMIDV MNzvyNiqpm2HOIO4eVAGpjproX1wSne8RgICgA1I0GTGSfHbBL4VUprfVfrBf+KWq0tOYbHEn478t 2Obd41i3V7MtP8KJTk1Dh4bSRQQJS+8M4DllmmdlVHkXaLTNsv7+60eyiemkX9tpmWhvjGERv71CN L9GV3YwU6v3qQ1BaD61+VG1XdFIfa5ndb2Y8OZVphpiGfCD6Wx6AT/Ni5QFnrqdXptqZSl+7dW60n SoWZhnyLe066vg==; Date: Sat, 02 Nov 2024 13:43:42 +0200 Message-Id: <86y121yi6p.fsf@gnu.org> From: Eli Zaretskii To: joaotavora@gmail.com, joostkremers@fastmail.fm In-Reply-To: <864j58mv6d.fsf@gnu.org> (message from Eli Zaretskii on Sat, 19 Oct 2024 10:03:06 +0300) Subject: Re: bug#73355: 29.4; eglot-rename reports success when it shouldn't References: <86plozvomz.fsf@fastmail.fm> <864j6947n1.fsf@gnu.org> <8634lspqvn.fsf@fastmail.fm> <86ttdqx473.fsf@gnu.org> <864j58mv6d.fsf@gnu.org> MIME-version: 1.0 Content-type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -1.6 (-) X-Debbugs-Envelope-To: 73355 Cc: 73355@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.6 (--) Ping! Ping! Ping! > Cc: 73355@debbugs.gnu.org > Date: Sat, 19 Oct 2024 10:03:06 +0300 > From: Eli Zaretskii > > Ping! Ping! > > > Cc: 73355@debbugs.gnu.org > > Date: Sat, 05 Oct 2024 12:57:20 +0300 > > From: Eli Zaretskii > > > > Ping! > > > > > From: Joost Kremers > > > Cc: Eli Zaretskii , 73355@debbugs.gnu.org > > > Date: Sun, 22 Sep 2024 00:46:04 +0200 > > > > > > On Sat, Sep 21 2024, João Távora wrote: > > > > I have this some version of this server somewhere, maybe I can reproduce, > > > > but as always better to follow the instructions in the manual > > > > https://joaotavora.github.io/eglot/#Troubleshooting-Eglot and give the > > > > remaining items of a full MRE. > > > > > > OK, here goes: > > > > > > 1. The relevant lines from the events buffer (apologies for the long lines): > > > > > > ``` > > > [jsonrpc] e[00:13:52.047] --> textDocument/rename[27] {"jsonrpc":"2.0","id":27,"method":"textDocument/rename","params":{"textDocument":{"uri":"file:///home/joost/Projects/Python/pyscratch/src/search.py"},"position":{"line":88,"character":29},"newName":"seq"}} > > > [jsonrpc] e[00:13:52.049] <-- textDocument/rename[27] #[0 "\300\301\302\303\304\305\257\6\207" [:id 27 :jsonrpc "2.0" :result nil] 14] > > > ``` > > > > > > Contrast this with a call to 'eglot-rename' that *does* yield changes: > > > > > > ``` > > > [jsonrpc] e[00:16:34.228] --> textDocument/rename[68] {"jsonrpc":"2.0","id":68,"method":"textDocument/rename","params":{"textDocument":{"uri":"file:///home/joost/Projects/Python/pyscratch/src/search.py"},"position":{"line":87,"character":8},"newName":"arr"}} > > > [jsonrpc] e[00:16:34.235] <-- textDocument/rename[68] #[0 "\323\312\324\325\326\327\313\330\313\302\303\304\305\306\307\300\331\301\314F\310\300\332\301\314FF\257\6\302\303\304\305\306\307\300\333\301\315F\310\300\334\301\315FF\257\6\302\303\304\305\306\307\300\311\301\316F\310\300\312\301\316FF\257\6\302\303\304\305\306\307\300\317\301\320F\310\300\311\301\320FF\257\6\302\303\304\305\306\307\300\317\301\321F\310\300\311\301\321FF\257\6\302\303\304\305\306\307\300\335\301\322F\310\300\336\301\322FF\257\6&\6\337\340\341\342\343FF!D\257\6\207" [:character :line :annotationId "default" :newText "arr" :range :end :start 71 68 vector 87 88 89 74 90 91 93 :id :jsonrpc "2.0" :result :documentChanges :edits 11 8 32 29 50 47 :textDocument :uri "file:///home/joost/Projects/Python/pyscratch/src/search.py" :version nil] 34] > > > ``` > > > > > > Looks like basedpyright is reporting that it didn't make any changes in the > > > first case (':results nil'). > > > > > > 2. Emacs did not signal an error. > > > > > > 3. The language server I used is basedpyright, which can be installed from > > > PyPI with the usual tools. I have version 1.17.5, which is the latest > > > release. > > > > > > To configure Eglot to use it, the basedpyright docs suggest to add the > > > following to one's init file (which is what I do): > > > > > > ``` > > > (add-to-list 'eglot-server-programs > > > '((python-mode python-ts-mode) > > > "basedpyright-langserver" "--stdio")) > > > ``` > > > > > > See https://docs.basedpyright.com/#/installation for details. > > > > > > 4. For a minimal project, all you'll need is a single Python file with a > > > single function, which can be as simple as this: > > > > > > ``` > > > def some_func(): > > > a: int = 5 > > > b: int = d + 7 > > > c: int = d + 13 > > > print(b+c) > > > ``` > > > > > > Try to rename the two occurrences of 'd' to 'a'. > > > > > > The code snippet in my original email will also do, even if basedpyright > > > will report a bunch of errors in it for undefined functions. Those don't > > > affect the rename. > > > > > > 5. Emacs: 29.4, Eglot 1.17 (from GNU ELPA), basedpyright 1.17.5. > > > > > > 6. I assume the issue is so straightforward that there's no need for a > > > recipe that's more detailed than the above. > > > > > > Thanks, > > > > > > Joost > > > > > > > > > -- > > > Joost Kremers > > > Life has its moments > > > > > > > > > > > > > > > From debbugs-submit-bounces@debbugs.gnu.org Sat Nov 02 09:25:41 2024 Received: (at 73355) by debbugs.gnu.org; 2 Nov 2024 13:25:41 +0000 Received: from localhost ([127.0.0.1]:53505 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1t7E8L-00039K-0S for submit@debbugs.gnu.org; Sat, 02 Nov 2024 09:25:41 -0400 Received: from mail-oo1-f47.google.com ([209.85.161.47]:56685) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1t7E8I-00039B-02 for 73355@debbugs.gnu.org; Sat, 02 Nov 2024 09:25:38 -0400 Received: by mail-oo1-f47.google.com with SMTP id 006d021491bc7-5ebc1af8e91so1347757eaf.1 for <73355@debbugs.gnu.org>; Sat, 02 Nov 2024 06:25:37 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1730553872; x=1731158672; darn=debbugs.gnu.org; h=content-transfer-encoding:cc:to:subject:message-id:date:from :in-reply-to:references:mime-version:from:to:cc:subject:date :message-id:reply-to; bh=nxVte1rZXEuOviTcuuCs3AtzjNdntzddkhVpYGzlaHU=; b=J+g0Sj7UuWwE+M1w2KrXJ5v79hmDsy1gAzLc3BfbssqgpWQgrouJI4L1SzUx9h44ep DIS+EnhSeJ8dnb8IwDSRIxZGXfnBI9x6c0cAW8vN5om5cN5CkEnXr5Nh6KMdmlxJCQrG 8UdMBsOHGqsV4je6cSdiHNaJnqIrPjLYnfGdgJouwNFLye8qg80YvJOgnVhJt4DDRF3P 7JAet4y+gatRx+Bb5SzOS+SQzGy/uoy+a8sAGJBEtbEH8+8FESsdHd+DL1pb/Twdd+BB T98t0eV1DifW6NFv3/3dz1gVLz7ccGA6ZdOPLGumG6FJ+LOw9eCRfH3/KfWeeyvV8WvF RTUg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1730553872; x=1731158672; h=content-transfer-encoding:cc:to:subject:message-id:date:from :in-reply-to:references:mime-version:x-gm-message-state:from:to:cc :subject:date:message-id:reply-to; bh=nxVte1rZXEuOviTcuuCs3AtzjNdntzddkhVpYGzlaHU=; b=E3vHrO06obiZaE/m9EV6Jr5jqZUscybP0F0GUHg1Le0VEe6eTcjaWa2Ypqo8Z43VYG QCNbk8Eg8GXuVf4vD3O3hKfGVPgpCifGU5uwWYIDAfjeGPHitq4ei7q4yKaEDrcVM1bc YGnIIasDFeYbYGKb/CbWQ/QPgnmY7T2M43aYnD+V3BNRc8oXJqcBXTycNp9oWvCqiNr9 gVG5aNeZQMtcIN11Qa32qfKfmjGteWSHM7ZzdkYJ3mkM8y/R9lMIeNOv0os2xAdu8Niu RyYhYIn1+7H48JRntSjwe1BHqL7oE74Rkccy9XEgqOWKNhxTYOx2cBSYEAu9h2C7PY2j 3utA== X-Forwarded-Encrypted: i=1; AJvYcCUIGRSb2KwyJoaELNzIqUbYAOW8BGIOTUw5Zxu6ZFyCml5CHMc3OwfnwxtQzFsIVW1dteUxmA==@debbugs.gnu.org X-Gm-Message-State: AOJu0YwWX5tbsr+f9FmYphESh8qv1m94YEHrqnxQhaEe4wyvnGxES5Qx xvtuhkvZv6T0JlwKdiIKf4gnm0tihJJWNQ5FlwwAwOUULNBFB2RthLoRreAk0Kk4rWXHoE3WP+1 VyHBq0vL+x3UcYqGiAaflA5cLWZUhyg== X-Google-Smtp-Source: AGHT+IHoHdYUzZvFB9llKpCMdE+MPS+0qJm1dazggjYKExJpbDFOuLeMWLqcJgfx00Np+IAzJeIOXKzQGtOBQx2p/8Y= X-Received: by 2002:a05:6820:1ad5:b0:5e1:e65d:5148 with SMTP id 006d021491bc7-5ec2397a323mr18208403eaf.6.1730553872466; Sat, 02 Nov 2024 06:24:32 -0700 (PDT) MIME-Version: 1.0 References: <86plozvomz.fsf@fastmail.fm> <864j6947n1.fsf@gnu.org> <8634lspqvn.fsf@fastmail.fm> <86ttdqx473.fsf@gnu.org> <864j58mv6d.fsf@gnu.org> <86y121yi6p.fsf@gnu.org> In-Reply-To: <86y121yi6p.fsf@gnu.org> From: =?UTF-8?B?Sm/Do28gVMOhdm9yYQ==?= Date: Sat, 2 Nov 2024 13:26:13 +0000 Message-ID: Subject: Re: bug#73355: 29.4; eglot-rename reports success when it shouldn't To: Eli Zaretskii Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Spam-Score: 0.7 (/) X-Debbugs-Envelope-To: 73355 Cc: joostkremers@fastmail.fm, 73355@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.3 (/) Sorry for the silence, but I don't have time to work on this right now, and I don't find the issue serious enough to warrant urgency. In fact, it could be argued that this isn't an issue at all. If I give someone no work to do, they might well announce that they have done all the work I have given them. But someone can propose a patch to Eglot that detects when the changes proposed by the server are an empty set and report something that indicates that somehow. Or instead of "rename successful", Eglot could report the more laconic "All server changes performed". Or not report anything at all. Jo=C3=A3o On Sat, Nov 2, 2024 at 11:43=E2=80=AFAM Eli Zaretskii wrote: > > Ping! Ping! Ping! > > > Cc: 73355@debbugs.gnu.org > > Date: Sat, 19 Oct 2024 10:03:06 +0300 > > From: Eli Zaretskii > > > > Ping! Ping! > > > > > Cc: 73355@debbugs.gnu.org > > > Date: Sat, 05 Oct 2024 12:57:20 +0300 > > > From: Eli Zaretskii > > > > > > Ping! > > > > > > > From: Joost Kremers > > > > Cc: Eli Zaretskii , 73355@debbugs.gnu.org > > > > Date: Sun, 22 Sep 2024 00:46:04 +0200 > > > > > > > > On Sat, Sep 21 2024, Jo=C3=A3o T=C3=A1vora wrote: > > > > > I have this some version of this server somewhere, maybe I can re= produce, > > > > > but as always better to follow the instructions in the manual > > > > > https://joaotavora.github.io/eglot/#Troubleshooting-Eglot and giv= e the > > > > > remaining items of a full MRE. > > > > > > > > OK, here goes: > > > > > > > > 1. The relevant lines from the events buffer (apologies for the lon= g lines): > > > > > > > > ``` > > > > [jsonrpc] e[00:13:52.047] --> textDocument/rename[27] {"jsonrpc":"2= .0","id":27,"method":"textDocument/rename","params":{"textDocument":{"uri":= "file:///home/joost/Projects/Python/pyscratch/src/search.py"},"position":{"= line":88,"character":29},"newName":"seq"}} > > > > [jsonrpc] e[00:13:52.049] <-- textDocument/rename[27] #[0 "\300\3= 01\302\303\304\305\257\6\207" [:id 27 :jsonrpc "2.0" :result nil] 14] > > > > ``` > > > > > > > > Contrast this with a call to 'eglot-rename' that *does* yield chang= es: > > > > > > > > ``` > > > > [jsonrpc] e[00:16:34.228] --> textDocument/rename[68] {"jsonrpc":"2= .0","id":68,"method":"textDocument/rename","params":{"textDocument":{"uri":= "file:///home/joost/Projects/Python/pyscratch/src/search.py"},"position":{"= line":87,"character":8},"newName":"arr"}} > > > > [jsonrpc] e[00:16:34.235] <-- textDocument/rename[68] #[0 "\323\3= 12\324\325\326\327\313\330\313\302\303\304\305\306\307\300\331\301\314F\310= \300\332\301\314FF\257\6\302\303\304\305\306\307\300\333\301\315F\310\300\3= 34\301\315FF\257\6\302\303\304\305\306\307\300\311\301\316F\310\300\312\301= \316FF\257\6\302\303\304\305\306\307\300\317\301\320F\310\300\311\301\320FF= \257\6\302\303\304\305\306\307\300\317\301\321F\310\300\311\301\321FF\257\6= \302\303\304\305\306\307\300\335\301\322F\310\300\336\301\322FF\257\6&\6\33= 7\340\341\342\343FF!D\257\6\207" [:character :line :annotationId "default" = :newText "arr" :range :end :start 71 68 vector 87 88 89 74 90 91 93 :id :js= onrpc "2.0" :result :documentChanges :edits 11 8 32 29 50 47 :textDocument = :uri "file:///home/joost/Projects/Python/pyscratch/src/search.py" :version = nil] 34] > > > > ``` > > > > > > > > Looks like basedpyright is reporting that it didn't make any change= s in the > > > > first case (':results nil'). > > > > > > > > 2. Emacs did not signal an error. > > > > > > > > 3. The language server I used is basedpyright, which can be install= ed from > > > > PyPI with the usual tools. I have version 1.17.5, which is the late= st > > > > release. > > > > > > > > To configure Eglot to use it, the basedpyright docs suggest to add = the > > > > following to one's init file (which is what I do): > > > > > > > > ``` > > > > (add-to-list 'eglot-server-programs > > > > '((python-mode python-ts-mode) > > > > "basedpyright-langserver" "--stdio")) > > > > ``` > > > > > > > > See https://docs.basedpyright.com/#/installation for details. > > > > > > > > 4. For a minimal project, all you'll need is a single Python file w= ith a > > > > single function, which can be as simple as this: > > > > > > > > ``` > > > > def some_func(): > > > > a: int =3D 5 > > > > b: int =3D d + 7 > > > > c: int =3D d + 13 > > > > print(b+c) > > > > ``` > > > > > > > > Try to rename the two occurrences of 'd' to 'a'. > > > > > > > > The code snippet in my original email will also do, even if basedpy= right > > > > will report a bunch of errors in it for undefined functions. Those = don't > > > > affect the rename. > > > > > > > > 5. Emacs: 29.4, Eglot 1.17 (from GNU ELPA), basedpyright 1.17.5. > > > > > > > > 6. I assume the issue is so straightforward that there's no need fo= r a > > > > recipe that's more detailed than the above. > > > > > > > > Thanks, > > > > > > > > Joost > > > > > > > > > > > > -- > > > > Joost Kremers > > > > Life has its moments > > > > > > > > > > > > > > > > > > > > > > > >