From unknown Sat Aug 09 01:11:01 2025 X-Loop: help-debbugs@gnu.org Subject: bug#53744: 27.2; [debbugs] soap-client.el: `string-search' (void function?) Resent-From: Kevin Vigouroux Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Thu, 03 Feb 2022 09:09:02 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: report 53744 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: 53744@debbugs.gnu.org X-Debbugs-Original-To: bug-gnu-emacs@gnu.org Received: via spool by submit@debbugs.gnu.org id=B.16438793082781 (code B ref -1); Thu, 03 Feb 2022 09:09:02 +0000 Received: (at submit) by debbugs.gnu.org; 3 Feb 2022 09:08:28 +0000 Received: from localhost ([127.0.0.1]:54385 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFY6N-0000im-A6 for submit@debbugs.gnu.org; Thu, 03 Feb 2022 04:08:28 -0500 Received: from lists.gnu.org ([209.51.188.17]:47948) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFY6J-0000ic-AG for submit@debbugs.gnu.org; Thu, 03 Feb 2022 04:08:26 -0500 Received: from eggs.gnu.org ([209.51.188.92]:35228) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1nFY6I-0000Q6-Pn for bug-gnu-emacs@gnu.org; Thu, 03 Feb 2022 04:08:23 -0500 Received: from smtp-outgoing-2003.laposte.net ([160.92.124.110]:37815) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1nFY6F-0007mt-2A for bug-gnu-emacs@gnu.org; Thu, 03 Feb 2022 04:08:22 -0500 X-mail-filterd: {"version":"1.3.4", "queueID":"4JqCWC6g3ZzSgpM", "contextId":"c20ad276-1251-48ac-b035-8bf60caae42a"} Received: from outgoing-mail.laposte.net (localhost.localdomain [127.0.0.1]) by mlpnf0112.laposte.net (SMTP Server) with ESMTP id 4JqCWC6g3ZzSgpM for ; Thu, 3 Feb 2022 10:08:07 +0100 (CET) X-mail-filterd: {"version":"1.3.4", "queueID":"4JqCWC36lBzSgpL", "contextId":"c51d276e-b2af-42ee-92bd-b19c0bf76aff"} X-lpn-mailing: LEGIT X-lpn-spamrating: 50 X-lpn-spamlevel: not-spam X-lpn-spamcause: OK, (0)(0000)gggruggvucftvghtrhhoucdtuddrgedvvddrgeeigdduvdeiucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecunfetrffquffvgfdpggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvffufffkgggtgfesthhqredttddtjeenucfhrhhomhepmfgvvhhinhcugghighhouhhrohhugicuoehkvgdrvhhighhouhhrohhugieslhgrphhoshhtvgdrnhgvtheqnecuggftrfgrthhtvghrnhepfeejtddttdeugfegjeejueffvdevgedtgfdvkedtvdegleegtdekvefghfduffdvnecuffhomhgrihhnpehgnhhurdhorhhgpdigmhhlshhorghprdhorhhgpdgrphgrtghhvgdrohhrghdpfiefrdhorhhgpdguvggsihgrnhdrohhrghdplhgrphhoshhtvgdrnhgvthenucfkphepledtrdefvddrkeekrddvvdejnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepledtrdefvddrkeekrddvvdejpdhhvghloheprghrrghgohhgpdhmrghilhhfrhhomhepkhgvrdhvihhgohhurhhouhigsehlrghpohhsthgvrdhnvghtpdhnsggprhgtphhtthhopedupdhrtghpthhtohepsghughdqghhnuhdqvghmrggtshesghhnuhdrohhrghdpmhhouggvpehsmhhtphhouhht Received: from aragog (arennes-656-1-400-227.w90-32.abo.wanadoo.fr [90.32.88.227]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by mlpnf0112.laposte.net (SMTP Server) with ESMTPSA id 4JqCWC36lBzSgpL for ; Thu, 3 Feb 2022 10:08:07 +0100 (CET) From: Kevin Vigouroux Date: Thu, 03 Feb 2022 10:08:06 +0100 Message-ID: <87fsp0fhc9.fsf@laposte.net> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=laposte.net; s=lpn-wlmd; t=1643879288; bh=UUKn7Br/s9xKxEozSitXJ1tFd0sFKy0+1t4DuZCngCw=; h=From:To:Subject:Date:Message-ID:MIME-Version:Content-Type:Content-Transfer-Encoding; b=Ny30QGfLa27g7f7tydskPi1t45xm+rJgQ89ym3D9+EmcpTc6RkTcvjmNSyBR8OvjUji4DUVH84mttyWkC0WzzlDqwcX/WCfr5wKiwQCGc/CDGR3rrooWN0A2VprfStHg/08lEvLnAWcXiHIC7L6z/xEFX2M39/uOV82BRTMddgV0mi4hvMMOvjXLFhYZFiIohdGqnJ0VlXwuOe66nf+MZkeq/vnIduXw4c4S8LyDHt7gZTXAkIQtOTsNwgV544fxm1QOvvsopBx9GBegzVyiijN0NBgfz2UPrRgBoEoSZPjRuZnoWUG3MLCGIPQqnEtOsk6PMtxEfSGyL9kCuCE84A==; Received-SPF: pass client-ip=160.92.124.110; envelope-from=ke.vigouroux@laposte.net; helo=smtp-outgoing-2003.laposte.net X-Spam_score_int: -27 X-Spam_score: -2.8 X-Spam_bar: -- X-Spam_report: (-2.8 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, FREEMAIL_FROM=0.001, RCVD_IN_DNSWL_LOW=-0.7, SPF_HELO_NONE=0.001, SPF_PASS=-0.001, T_SCC_BODY_TEXT_LINE=-0.01 autolearn=ham autolearn_force=no X-Spam_action: no action X-Spam-Score: 0.2 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.4 (--) When I use the =E2=80=9Cdebbugs=E2=80=9D package [https://elpa.gnu.org/pack= ages/debbugs.html] to find keywords with `debbugs-gnu-search', it produces the following error. #+begin_quote error in process filter: soap-decode-xs-complex-type: Symbol=E2=80=99s func= tion definition is void: string-search #+end_quote --- `toggle-debug-on-error' generated the following backtrace: #+begin_quote Debugger entered--Lisp error: (void-function string-search) string-search(":" "s-gensym3") soap-decode-xs-complex-type(#s(soap-xs-complex-type :name "Map" :namespac= e-tag "ns2" :id nil :attributes nil :attribute-groups nil :indicator sequen= ce :base nil :elements ... :optional? nil :multiple? nil :is-group nil) (s-= gensym3 ... ... ... ... ... ... ... ... ... ... ... ... ... ...)) soap-decode-type(#s(soap-xs-complex-type :name "Map" :namespace-tag "ns2"= :id nil :attributes nil :attribute-groups nil :indicator sequence :base ni= l :elements ... :optional? nil :multiple? nil :is-group nil) (s-gensym3 ...= ... ... ... ... ... ... ... ... ... ... ... ... ...)) soap-decode-xs-element(#s(soap-xs-element :name "s-gensym3" :namespace-ta= g "ns1" :id nil :type^ ... :optional? nil :multiple? nil :reference nil :su= bstitution-group nil :alternatives nil :is-group nil) (s-gensym3 ... ... ..= . ... ... ... ... ... ... ... ... ... ... ...)) soap-decode-type(#s(soap-xs-element :name "s-gensym3" :namespace-tag "ns1= " :id nil :type^ ... :optional? nil :multiple? nil :reference nil :substitu= tion-group nil :alternatives nil :is-group nil) (s-gensym3 ... ... ... ... = ... ... ... ... ... ... ... ... ... ...)) soap-parse-response((get_statusResponse ... ...) #s(soap-bound-operation = :operation ... :soap-action "Debbugs/SOAP" :soap-headers nil :soap-body nil= :use encoded) #s(soap-wsdl :origin "/home/kevin/.e..." :current-file "/hom= e/kevin/.e..." :xmlschema-imports nil :ports ... :alias-table ... :namespac= es ...) nil (soap:Body nil ...)) soap-parse-envelope((soap:Envelope ((soap:encodingStyle . "http://schemas= .xmlsoap.org...") (xmlns:apachens . "http://xml.apache.org/xml-...") (xmlns= :soap . "http://schemas.xmlsoap.org...") (xmlns:soapenc . "http://schemas.x= mlsoap.org...") (xmlns:xsd . "http://www.w3.org/2001/XML...") (xmlns:xsi . = "http://www.w3.org/2001/XML...")) (soap:Body nil (get_statusResponse ... ..= .))) #s(soap-bound-operation :operation #s(soap-operation :name "get_status= " :namespace-tag "ns1" :parameter-order (bugs) :input (in1 . ...) :output (= out1 . ...) :faults nil :input-action nil :output-action nil) :soap-action = "Debbugs/SOAP" :soap-headers nil :soap-body nil :use encoded) #s(soap-wsdl = :origin "/home/kevin/.emacs.d/strai..." :current-file "/home/kevin/.emacs.d= /strai..." :xmlschema-imports nil :ports (#s(soap-port :name "debian.org" := namespace-tag nil :service-url "https://bugs.debian.org/cg..." :binding ...= ) #s(soap-port :name "gnu.org" :namespace-tag nil :service-url "https://deb= bugs.gnu.org/cg..." :binding ...)) :alias-table (("ns3" . "urn:Debbugs/SOAP= /TYPES") ("ns2" . "http://xml.apache.org/xml-...") ("ns1" . "urn:Debbugs/SO= AP") ("soapenc" . "http://schemas.xmlsoap.org...") ("xsd" . "http://www.w3.= org/2001/XML...")) :namespaces (#s(soap-namespace :name "urn:Debbugs/SOAP" = :elements #) #s(soap-namespace :name= "http://xml.apache.org/xml-..." :elements #) #s(soap-namespace :name "urn:Debbugs/SOAP/TYPES" :elements #) #s(soap-namespace :name "http://schemas.x= mlsoap.org..." :elements #) #s(soap-= namespace :name "http://www.w3.org/2001/XML..." :elements #)))) #f(compiled-function (status) #)((:peer (:certif= icates ((:version 3 :serial-number "04:7e:f8:64:00:24:2b:50:fa:fd:33:cd:00:= aa:99:13:50..." :issuer "C=3DUS,O=3DLet's Encrypt,CN=3DR3" :valid-from "202= 1-12-18" :valid-to "2022-03-18" :subject "CN=3Ddebbugs.gnu.org" :public-key= -algorithm "EC/ECDSA" :certificate-security-level "Ultra" :signature-algori= thm "RSA-SHA256" :public-key-id "sha1:cd:cf:69:4d:91:55:10:fd:cb:df:27:77:6= 2:ca:89:..." :certificate-id "sha1:58:b8:10:a2:8c:c2:56:e6:b5:da:9b:a2:34:4= 6:6e:..." :pem "-----BEGIN CERTIFICATE-----\nMIIEhjCCA26gAwIBAgISBH...") (:= version 3 :serial-number "00:91:2b:08:4a:cf:0c:18:a7:53:f6:d6:2e:25:a7:5f:5= a" :issuer "C=3DUS,O=3DInternet Security Research Group,CN=3DISRG Ro..." :v= alid-from "2020-09-04" :valid-to "2025-09-15" :subject "C=3DUS,O=3DLet's En= crypt,CN=3DR3" :public-key-algorithm "RSA" :certificate-security-level "Med= ium" :signature-algorithm "RSA-SHA256" :public-key-id "sha1:8a:93:82:f4:c8:= 04:08:34:5e:5b:c2:f8:d7:55:d3:..." :certificate-id "sha1:a0:53:37:5b:fe:84:= e8:b7:48:78:2c:7c:ee:15:82:..." :pem "-----BEGIN CERTIFICATE-----\nMIIFFjCC= Av6gAwIBAgIRAJ...") (:version 3 :serial-number "40:01:77:21:37:d4:e9:42:b8:= ee:76:aa:3c:64:0a:b7" :issuer "O=3DDigital Signature Trust Co.,CN=3DDST Roo= t CA X3" :valid-from "2021-01-20" :valid-to "2024-09-30" :subject "C=3DUS,O= =3DInternet Security Research Group,CN=3DISRG Ro..." :public-key-algorithm = "RSA" :certificate-security-level "High" :signature-algorithm "RSA-SHA256" = :public-key-id "sha1:f8:16:51:3c:fd:1b:44:9f:2e:6b:28:a1:97:22:1f:..." :cer= tificate-id "sha1:93:3c:6d:de:e9:5c:9c:41:a4:0f:9f:50:49:3d:82:..." :pem "-= ----BEGIN CERTIFICATE-----\nMIIFYDCCBEigAwIBAgIQQA...")) :certificate (:ver= sion 3 :serial-number "04:7e:f8:64:00:24:2b:50:fa:fd:33:cd:00:aa:99:13:50..= ." :issuer "C=3DUS,O=3DLet's Encrypt,CN=3DR3" :valid-from "2021-12-18" :val= id-to "2022-03-18" :subject "CN=3Ddebbugs.gnu.org" :public-key-algorithm "E= C/ECDSA" :certificate-security-level "Ultra" :signature-algorithm "RSA-SHA2= 56" :public-key-id "sha1:cd:cf:69:4d:91:55:10:fd:cb:df:27:77:62:ca:89:..." = :certificate-id "sha1:58:b8:10:a2:8c:c2:56:e6:b5:da:9b:a2:34:46:6e:..." :pe= m "-----BEGIN CERTIFICATE-----\nMIIEhjCCA26gAwIBAgISBH...") :key-exchange "= ECDHE-ECDSA" :protocol "TLS1.2" :cipher "AES-256-GCM" :mac "AEAD" :encrypt-= then-mac nil :safe-renegotiation t))) apply(#f(compiled-function (status) #) (:peer (:= certificates ((:version 3 :serial-number "04:7e:f8:64:00:24:2b:50:fa:fd:33:= cd:00:aa:99:13:50..." :issuer "C=3DUS,O=3DLet's Encrypt,CN=3DR3" :valid-fro= m "2021-12-18" :valid-to "2022-03-18" :subject "CN=3Ddebbugs.gnu.org" :publ= ic-key-algorithm "EC/ECDSA" :certificate-security-level "Ultra" :signature-= algorithm "RSA-SHA256" :public-key-id "sha1:cd:cf:69:4d:91:55:10:fd:cb:df:2= 7:77:62:ca:89:..." :certificate-id "sha1:58:b8:10:a2:8c:c2:56:e6:b5:da:9b:a= 2:34:46:6e:..." :pem "-----BEGIN CERTIFICATE-----\nMIIEhjCCA26gAwIBAgISBH..= .") (:version 3 :serial-number "00:91:2b:08:4a:cf:0c:18:a7:53:f6:d6:2e:25:a= 7:5f:5a" :issuer "C=3DUS,O=3DInternet Security Research Group,CN=3DISRG Ro.= .." :valid-from "2020-09-04" :valid-to "2025-09-15" :subject "C=3DUS,O=3DLe= t's Encrypt,CN=3DR3" :public-key-algorithm "RSA" :certificate-security-leve= l "Medium" :signature-algorithm "RSA-SHA256" :public-key-id "sha1:8a:93:82:= f4:c8:04:08:34:5e:5b:c2:f8:d7:55:d3:..." :certificate-id "sha1:a0:53:37:5b:= fe:84:e8:b7:48:78:2c:7c:ee:15:82:..." :pem "-----BEGIN CERTIFICATE-----\nMI= IFFjCCAv6gAwIBAgIRAJ...") (:version 3 :serial-number "40:01:77:21:37:d4:e9:= 42:b8:ee:76:aa:3c:64:0a:b7" :issuer "O=3DDigital Signature Trust Co.,CN=3DD= ST Root CA X3" :valid-from "2021-01-20" :valid-to "2024-09-30" :subject "C= =3DUS,O=3DInternet Security Research Group,CN=3DISRG Ro..." :public-key-alg= orithm "RSA" :certificate-security-level "High" :signature-algorithm "RSA-S= HA256" :public-key-id "sha1:f8:16:51:3c:fd:1b:44:9f:2e:6b:28:a1:97:22:1f:..= ." :certificate-id "sha1:93:3c:6d:de:e9:5c:9c:41:a4:0f:9f:50:49:3d:82:..." = :pem "-----BEGIN CERTIFICATE-----\nMIIFYDCCBEigAwIBAgIQQA...")) :certificat= e (:version 3 :serial-number "04:7e:f8:64:00:24:2b:50:fa:fd:33:cd:00:aa:99:= 13:50..." :issuer "C=3DUS,O=3DLet's Encrypt,CN=3DR3" :valid-from "2021-12-1= 8" :valid-to "2022-03-18" :subject "CN=3Ddebbugs.gnu.org" :public-key-algor= ithm "EC/ECDSA" :certificate-security-level "Ultra" :signature-algorithm "R= SA-SHA256" :public-key-id "sha1:cd:cf:69:4d:91:55:10:fd:cb:df:27:77:62:ca:8= 9:..." :certificate-id "sha1:58:b8:10:a2:8c:c2:56:e6:b5:da:9b:a2:34:46:6e:.= .." :pem "-----BEGIN CERTIFICATE-----\nMIIEhjCCA26gAwIBAgISBH...") :key-exc= hange "ECDHE-ECDSA" :protocol "TLS1.2" :cipher "AES-256-GCM" :mac "AEAD" :e= ncrypt-then-mac nil :safe-renegotiation t))) url-http-activate-callback() url-http-content-length-after-change-function(5637 5645 8) url-http-generic-filter(# " \345\26)\15\245\0\0") accept-process-output(#) debbugs-get-status(47766 10955 15247 15247 15247 14841 49959 25943 3303 2= 5943 16967 2401 49959 49959 950 25943 950 25511 950 21775 48413 25511 25943= 48413 45844 47244 16013 16967 17046 52677 29953 47244 47244 13594 37826 13= 594 17046 24091 24091 24091 32825 2199 24091 32825 2199 2199 37826) apply(debbugs-get-status (47766 10955 15247 15247 15247 14841 49959 25943= 3303 25943 16967 2401 49959 49959 950 25943 950 25511 950 21775 48413 2551= 1 25943 48413 45844 47244 16013 16967 17046 52677 29953 47244 47244 13594 3= 7826 13594 17046 24091 24091 24091 32825 2199 24091 32825 2199 2199 37826)) debbugs-gnu-show-reports() debbugs-gnu(nil ("emacs") nil) debbugs-gnu-search("invisible frame" nil nil ("emacs") nil) funcall-interactively(debbugs-gnu-search "invisible frame" nil nil ("emac= s") nil) call-interactively(debbugs-gnu-search record nil) command-execute(debbugs-gnu-search record) execute-extended-command(nil "debbugs-gnu-search" "debbugs-gnu-sear") funcall-interactively(execute-extended-command nil "debbugs-gnu-search" "= debbugs-gnu-sear") call-interactively(execute-extended-command nil nil) command-execute(execute-extended-command) #+end_quote In GNU Emacs 27.2 (build 1, aarch64-unknown-linux-gnu, GTK+ Version 3.24.27= , cairo version 1.17.4) of 2021-03-26 built on leming Windowing system distributor 'The X.Org Foundation', version 11.0.12101003 System Description: Manjaro ARM Recent messages: Quit Making completion list... Query bugs...done Get bug information...100%=20 Entering debugger... Checking new news... nnimap read 0k from imap.laposte.net Reading active file from archive via nnfolder...done Reading active file via nndraft...done Checking new news...done Configured using: 'configure --prefix=3D/usr --sysconfdir=3D/etc --libexecdir=3D/usr/lib --localstatedir=3D/var --with-x-toolkit=3Dgtk3 --with-xft --with-wide-int --with-modules --with-cairo --with-harfbuzz 'CFLAGS=3D-march=3Darmv8-a -O2 -pipe -fno-plt' CPPFLAGS=3D-D_FORTIFY_SOURCE=3D2 LDFLAGS=3D-Wl,-O1,--sort-common,--as-needed,-z,relro,-z,now' Configured features: XPM JPEG TIFF GIF PNG RSVG CAIRO SOUND GPM DBUS GSETTINGS GLIB NOTIFY INOTIFY ACL GNUTLS LIBXML2 FREETYPE HARFBUZZ M17N_FLT LIBOTF ZLIB TOOLKIT_SCROLL_BARS GTK3 X11 XDBE XIM MODULES THREADS LIBSYSTEMD JSON PDUMPER LCMS2 GMP Important settings: value of $LC_MONETARY: fr_FR.UTF-8 value of $LC_NUMERIC: fr_FR.UTF-8 value of $LC_TIME: fr_FR.UTF-8 value of $LANG: fr_FR.UTF-8 locale-coding-system: utf-8-unix Major mode: Summary Minor modes in effect: gnus-mailing-list-mode: t doom-modeline-mode: t display-time-mode: t leaf-key-override-global-mode: t straight-use-package-mode: t straight-package-neutering-mode: t global-eldoc-mode: t electric-indent-mode: t mouse-wheel-mode: t file-name-shadow-mode: t global-font-lock-mode: t font-lock-mode: t blink-cursor-mode: t auto-composition-mode: t auto-encryption-mode: t auto-compression-mode: t buffer-read-only: t line-number-mode: t transient-mark-mode: t Load-path shadows: /home/kevin/.emacs.d/straight/build/soap-client/soap-client hides /usr/shar= e/emacs/27.2/lisp/net/soap-client /home/kevin/.emacs.d/straight/build/soap-client/soap-inspect hides /usr/sha= re/emacs/27.2/lisp/net/soap-inspect Features: (shadow sort emacsbug sendmail help-fns radix-tree cl-print debug backtrace mm-archive url-cache crm debbugs-gnu add-log debbugs soap-client url-http url-auth url-gw warnings rng-xsd rng-dt rng-util xsd-regexp debbugs-autoloads soap-client-autoloads misearch multi-isearch vc-mtn vc-hg vc-git diff-mode vc-bzr vc-src vc-sccs vc-svn vc-cvs vc-rcs vc vc-dispatcher project org-element avl-tree generator ol-eww eww mm-url thingatpt url-queue ol-rmail ol-mhe ol-irc ol-info ol-gnus ol-docview doc-view jka-compr image-mode exif ol-bibtex bibtex ol-bbdb ol-w3m gnus-cite mail-extr nnir gnus-ml disp-table pp gnus-eform gnus-demon gnus-topic nndraft nnmh nnfolder utf-7 gnutls network-stream nsm gnus-agent gnus-srvr gnus-score score-mode nnvirtual gnus-msg gnus-art mm-uu mml2015 mm-view mml-smime smime dig nntp gnus-cache gnus-sum url url-proxy url-privacy url-expand url-methods url-history mailcap shr url-cookie url-domsuf url-util url-parse auth-source eieio eieio-core eieio-loaddefs json map url-vars svg xml dom browse-url gnus-group gnus-undo gnus-start gnus-cloud nnimap nnmail mail-source utf7 netrc nnoo parse-time iso8601 gnus-spec gnus-int gnus-range message rmc puny dired dired-loaddefs rfc822 mml mml-sec password-cache epa derived epg epg-config mm-decode mm-bodies mm-encode mail-parse rfc2231 mailabbrev gmm-utils mailheader gnus-win gnus nnheader gnus-util rmail rmail-loaddefs rfc2047 rfc2045 ietf-drums text-property-search mail-utils mm-util mail-prsvr face-remap vterm-autoloads edmacro kmacro doom-modeline doom-modeline-segments doom-modeline-env doom-modeline-core shrink-path rx f s dash doom-modeline-autoloads shrink-path-autoloads f-autoloads dash-autoloads s-autoloads all-the-icons all-the-icons-faces data-material data-weathericons data-octicons data-fileicons data-faicons data-alltheicons hydra-autoloads lv-autoloads time cus-edit cus-start cus-load wid-edit doom-solarized-dark-theme doom-themes doom-themes-base doom-themes-autoloads finder-inf leaf-keywords leaf org ob ob-tangle ob-ref ob-lob ob-table ob-exp org-macro org-footnote org-src ob-comint org-pcomplete pcomplete comint ansi-color ring org-list org-faces org-entities time-date noutline outline easy-mmode org-version ob-emacs-lisp ob-core ob-eval org-table ol org-keys org-compat advice org-macs org-loaddefs format-spec find-func cal-menu calendar cal-loaddefs all-the-icons-autoloads elpher-autoloads leaf-keywords-autoloads leaf-autoloads straight-autoloads info cl-seq cl-extra help-mode easymenu seq byte-opt straight subr-x cl-macs gv cl-loaddefs cl-lib bytecomp byte-compile cconv tooltip eldoc electric uniquify ediff-hook vc-hooks lisp-float-type mwheel term/x-win x-win term/common-win x-dnd tool-bar dnd fontset image regexp-opt fringe tabulated-list replace newcomment text-mode elisp-mode lisp-mode prog-mode register page tab-bar menu-bar rfn-eshadow isearch timer select scroll-bar mouse jit-lock font-lock syntax facemenu font-core term/tty-colors frame minibuffer cl-generic cham georgian utf-8-lang misc-lang vietnamese tibetan thai tai-viet lao korean japanese eucjp-ms cp51932 hebrew greek romanian slovak czech european ethiopic indian cyrillic chinese composite charscript charprop case-table epa-hook jka-cmpr-hook help simple abbrev obarray cl-preloaded nadvice loaddefs button faces cus-face macroexp files text-properties overlay sha1 md5 base64 format env code-pages mule custom widget hashtable-print-readable backquote threads dbusbind inotify lcms2 dynamic-setting system-font-setting font-render-setting cairo move-toolbar gtk x-toolkit x multi-tty make-network-process emacs) Memory information: ((conses 16 605558 47540) (symbols 48 30141 1) (strings 32 106055 14318) (string-bytes 1 3311045) (vectors 16 44619) (vector-slots 8 644938 27816) (floats 8 954 513) (intervals 56 3573 722) (buffers 1000 34)) From unknown Sat Aug 09 01:11:01 2025 X-Loop: help-debbugs@gnu.org Subject: bug#53744: 27.2; [debbugs] soap-client.el: `string-search' (void function?) Resent-From: Michael Albinus Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Thu, 03 Feb 2022 11:04:02 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 53744 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: 53744@debbugs.gnu.org Cc: ke.vigouroux@laposte.net, mattiase@acm.org X-Debbugs-Original-To: Kevin Vigouroux via "Bug reports for GNU Emacs, the Swiss army knife of text editors" X-Debbugs-Original-Cc: Kevin Vigouroux , 53744@debbugs.gnu.org, Mattias =?UTF-8?Q?Engdeg=C3=A5rd?= Received: via spool by 53744-submit@debbugs.gnu.org id=B53744.164388624214569 (code B ref 53744); Thu, 03 Feb 2022 11:04:02 +0000 Received: (at 53744) by debbugs.gnu.org; 3 Feb 2022 11:04:02 +0000 Received: from localhost ([127.0.0.1]:54615 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFZuE-0003ms-4S for submit@debbugs.gnu.org; Thu, 03 Feb 2022 06:04:02 -0500 Received: from mout.gmx.net ([212.227.17.20]:40589) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFZuB-0003ma-Ac for 53744@debbugs.gnu.org; Thu, 03 Feb 2022 06:04:00 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=gmx.net; s=badeba3b8450; t=1643886229; bh=UWVHkEkduUMD0SUq2zPeYUufwV4yRLD3ouS33kY5EuA=; h=X-UI-Sender-Class:From:To:Cc:Subject:References:Date:In-Reply-To; b=Zx2tTxgLvOQhbjUjQGb5LnAw+6w4yUDZktiBjhxMyb/wYYZdHFvgQYiUr6XXFMnrM Ug3zihvqgP4y3XqeUVaL1H16HhvtaE2xRC47EwYIA/OMmV9Z8br8+t7NLxaO7uS7Hz DN0spEilYqE93WzRgOWpFFueFhOJboVCTvFvwtMM= X-UI-Sender-Class: 01bb95c1-4bf8-414a-932a-4f6e2808ef9c Received: from gandalf.gmx.de ([213.220.159.97]) by mail.gmx.net (mrgmx104 [212.227.17.168]) with ESMTPSA (Nemesis) id 1Mi2O1-1mbYFY0Dgn-00e82y; Thu, 03 Feb 2022 12:03:49 +0100 From: Michael Albinus References: <87fsp0fhc9.fsf@laposte.net> Date: Thu, 03 Feb 2022 12:03:47 +0100 In-Reply-To: <87fsp0fhc9.fsf@laposte.net> (Kevin Vigouroux via's message of "Thu, 03 Feb 2022 10:08:06 +0100") Message-ID: <87o83op5yk.fsf@gmx.de> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/29.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Provags-ID: V03:K1:D4RnCVpwaG0FK1BTCFVzoRUcYPG9HU3qDozkmBb8hgGxBxs84Ko I+x5ihDnJlcIuGf0iNNVS+csUEoAEDLi3FIYthFXeZr59gQhua5grQ91VUXck5TZNeYGrQW Pe+Sqc5JxxNJd5R+3e2VU+tdO69TDPjuqUBPOsW9hbPDAlutuXlYiIbOYptey9ecG5r1sOC XLUT+cZTGzaq/KKq2UMHA== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:MSaRuRztZcY=:jDElOTVMNcdBfmDHnaE/zo +Dml+crZX7Y/LieKviBHsIxKbqh/2wOlDTLvPLxCsYsvDPm+p1KHVUZE9AgNadKPen5uBgr04 Z7GFGYl4a+goUAMYlhoy3hStX1NoTb3fWy42qFuy0j/BHggi8/STiPd/+fLj/jWlYIi/gLZ8R DafmT2aKnp3dLrGXTwpyOMY+fcIhHv1p0k/qJ/Cu/UZM9w5wj6+ZCa/GZmbw9X058r5+x3hKq Gcb9v5Qppm0nj2/BS71amx0qddNruuCCg9Ov8qvQFkqkm/0X3t0NN3UY8E003D/Ux2LLlEoEm FQJVpPKOnjEpAq8HTTmt7kJQgF1KQf9klN+KjWgcPa/cwoyLHLT2gKocEeZ3L4Oq0tIGRfOIk 9ZWqtHke/mmYQkFvlr7K5wxiz3EWJ2Ydi8pKsm3OF7UYJ0n7zG8tQq9k2NsiUgCYX8F0cnA7S d3MYjPlo4EKlqhOTvhdIuR/tzyfma2ZElM5Ix7AMfsGPAlu5d8BZaRbRHiwbwG2Pe/jUbUZ8N ou6sR5u6IaSLYItfDkTRFikcx2h1q9Fc39RJPNV1P9fORArz0YHRDtnAKfT0bnAaG74G8ktdw cewwla/xq87x1K2pl1UjmdR4VJecEbyP9nDf3eHz4OGk1zT86MO/B22OoADGgFYcuKMaUU/tH kc0knC10tN4YIXvynq0w83LpqNn+OX8x1oYTJW7vuyUeK7RoynDQTNcB7PLK0nBFtEVeoPDV3 u+Vk9v1sEbn0iT77+gfXy1qX9Ij2jU2lzK0rAhzDk4vc9Saj6SsRkLRrYdOBHmtMVWXg4aBb4 w+us8iTzz3OB9ONJHYW0ZmlaOoq3kOorv4/0A1m6IwbaLh05KKsc13cF0Jij28WL3BHfyDa99 r8xONrsJDAgGODRr3jgJ3NfhHgHFAeRwK1GGdkvVeKXV/0hdAB/uhjXCAhLz+XzTV/LTMW+fa SG7yrcMThK4f7rQCdp4UFjqU1WcpXOZJDVcUSg8DV6Z4PWICedEKREVkA9Nz6u0aiuZd4Xa8u zl5y4/bpoBtU7JozJKNuUpclXb2K2R/ojEP7dmArlMWSgws9O/IrhQWKaaomxvRF7iIBcx33S 9JmPcqHBYEb1VQ= X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Kevin Vigouroux via "Bug reports for GNU Emacs, the Swiss army knife of text editors" writes: Hi, > When I use the =E2=80=9Cdebbugs=E2=80=9D package [https://elpa.gnu.org/pa= ckages/debbugs.html] > to find keywords with `debbugs-gnu-search', it produces the following err= or. > > #+begin_quote > error in process filter: soap-decode-xs-complex-type: Symbol=E2=80=99s fu= nction definition is void: string-search > #+end_quote `string-search' is used in soap-client.el since commit 3b7b181bded in Emacs master branch. However, it exists since Emacs 28.1 only. soap-client.el is used also for older Emacsen via GNU ELPA. I recommend to revert that change. Best regards, Michael. From unknown Sat Aug 09 01:11:01 2025 X-Loop: help-debbugs@gnu.org Subject: bug#53744: 27.2; [debbugs] soap-client.el: `string-search' (void function?) Resent-From: Eli Zaretskii Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Thu, 03 Feb 2022 11:10:01 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 53744 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Michael Albinus Cc: ke.vigouroux@laposte.net, 53744@debbugs.gnu.org, mattiase@acm.org Received: via spool by 53744-submit@debbugs.gnu.org id=B53744.164388659615171 (code B ref 53744); Thu, 03 Feb 2022 11:10:01 +0000 Received: (at 53744) by debbugs.gnu.org; 3 Feb 2022 11:09:56 +0000 Received: from localhost ([127.0.0.1]:54635 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFZzw-0003wd-Hc for submit@debbugs.gnu.org; Thu, 03 Feb 2022 06:09:56 -0500 Received: from eggs.gnu.org ([209.51.188.92]:34114) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFZzr-0003wI-6c for 53744@debbugs.gnu.org; Thu, 03 Feb 2022 06:09:55 -0500 Received: from [2001:470:142:3::e] (port=59526 helo=fencepost.gnu.org) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1nFZzj-000410-Vm; Thu, 03 Feb 2022 06:09:44 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-version:References:Subject:In-Reply-To:To:From: Date; bh=n1tvbIspRm+1m28TruR9o6eL7SsXaUNfefQ96rBeezU=; b=HOfjZX1qxpW04DDjvHpq WB1xEaoQu/z9kjeDo5DLS4+Q/eKPRLiCOe2DYNRqLnYa4cZAQofQ/x4IPlvTPFLa1OOSl+Sh7JpdJ KcE5MO/rygO5gBRY5c7GuxNGgswPpShXbLCIxaoZL755UqphPUB1QSsZpg2kK7hAB/aCkPSuDvg2N Q9mw9X3KN7wiP7qPhSpAPvkrsI0w2+n+V7x91JyOzTIkdwdNf8rRTuLkOg6L/DqgILUnnV/yYuvu+ 0D6w1e+wo+Gpho5OdvYJ6XX/SraHtA7Gh8BWwKw6JPYiMGIQ8izbwUOcQMMCwnibipv6Wr4pd7NQm Mfwt7ylb61nMhA==; Received: from [87.69.77.57] (port=3185 helo=home-c4e4a596f7) by fencepost.gnu.org with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1nFZzf-0006Je-N2; Thu, 03 Feb 2022 06:09:40 -0500 Date: Thu, 03 Feb 2022 13:09:44 +0200 Message-Id: <83mtj8435z.fsf@gnu.org> From: Eli Zaretskii In-Reply-To: <87o83op5yk.fsf@gmx.de> (message from Michael Albinus on Thu, 03 Feb 2022 12:03:47 +0100) References: <87fsp0fhc9.fsf@laposte.net> <87o83op5yk.fsf@gmx.de> MIME-version: 1.0 Content-type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -2.3 (--) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > From: Michael Albinus > Date: Thu, 03 Feb 2022 12:03:47 +0100 > Cc: ke.vigouroux@laposte.net, mattiase@acm.org > > > When I use the “debbugs” package [https://elpa.gnu.org/packages/debbugs.html] > > to find keywords with `debbugs-gnu-search', it produces the following error. > > > > #+begin_quote > > error in process filter: soap-decode-xs-complex-type: Symbol’s function definition is void: string-search > > #+end_quote > > `string-search' is used in soap-client.el since commit 3b7b181bded in > Emacs master branch. However, it exists since Emacs 28.1 only. > > soap-client.el is used also for older Emacsen via GNU ELPA. I recommend > to revert that change. Please go ahead and revert. From unknown Sat Aug 09 01:11:01 2025 X-Loop: help-debbugs@gnu.org Subject: bug#53744: 27.2; [debbugs] soap-client.el: `string-search' (void function?) Resent-From: Mattias =?UTF-8?Q?Engdeg=C3=A5rd?= Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Thu, 03 Feb 2022 11:37:01 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 53744 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Michael Albinus Cc: ke.vigouroux@laposte.net, 53744@debbugs.gnu.org, fitzsim@fitzsim.org X-Debbugs-Original-Cc: Kevin Vigouroux , "Kevin Vigouroux via Bug reports for GNU Emacs, the Swiss army knife of text editors" , Thomas Fitzsimmons , 53744@debbugs.gnu.org Received: via spool by submit@debbugs.gnu.org id=B.164388819418464 (code B ref -1); Thu, 03 Feb 2022 11:37:01 +0000 Received: (at submit) by debbugs.gnu.org; 3 Feb 2022 11:36:34 +0000 Received: from localhost ([127.0.0.1]:54674 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFaPh-0004nj-JU for submit@debbugs.gnu.org; Thu, 03 Feb 2022 06:36:33 -0500 Received: from lists.gnu.org ([209.51.188.17]:53680) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFaPc-0004nX-FN for submit@debbugs.gnu.org; Thu, 03 Feb 2022 06:36:32 -0500 Received: from eggs.gnu.org ([209.51.188.92]:46746) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1nFaPc-0001HD-9G for bug-gnu-emacs@gnu.org; Thu, 03 Feb 2022 06:36:28 -0500 Received: from mail1458c50.megamailservers.eu ([91.136.14.58]:55746 helo=mail267c50.megamailservers.eu) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1nFaPY-00005Z-Uj for bug-gnu-emacs@gnu.org; Thu, 03 Feb 2022 06:36:27 -0500 X-Authenticated-User: mattiase@bredband.net DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=megamailservers.eu; s=maildub; t=1643888168; bh=B4bvpGH0nglwneS/M2fZbV9XIXv5l+eATUigBfiab54=; h=Subject:From:In-Reply-To:Date:Cc:References:To:From; b=PwJm6Pqh2MeWcaOx5263wNPapBCVm7rAyinUb+ENbOsLidnbAgNhK8bCCYp0ekd0w 4GuQnh/pcbjO3j39q1gUprKwD2WSRkuC7kJ2hoXmcPQkeQk4C7ucCHDHUWRW3RXCub gMGyqBMrtKfzmSZUwc2yyQCD8Qplc4QJnw/6+6+w= Feedback-ID: mattiase@acm.or Received: from smtpclient.apple (c188-150-171-71.bredband.tele2.se [188.150.171.71]) (authenticated bits=0) by mail267c50.megamailservers.eu (8.14.9/8.13.1) with ESMTP id 213Ba5Ku023630; Thu, 3 Feb 2022 11:36:07 +0000 Content-Type: text/plain; charset=us-ascii Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.120.0.1.13\)) From: Mattias =?UTF-8?Q?Engdeg=C3=A5rd?= In-Reply-To: <87o83op5yk.fsf@gmx.de> Date: Thu, 3 Feb 2022 12:36:05 +0100 Content-Transfer-Encoding: quoted-printable Message-Id: <0EDB1FB5-3EBD-4CD7-897B-C956E1069E70@acm.org> References: <87fsp0fhc9.fsf@laposte.net> <87o83op5yk.fsf@gmx.de> X-Mailer: Apple Mail (2.3654.120.0.1.13) X-CTCH-RefID: str=0001.0A742F16.61FBBE28.004D, ss=1, re=0.000, recu=0.000, reip=0.000, cl=1, cld=1, fgs=0 X-CTCH-VOD: Unknown X-CTCH-Spam: Unknown X-CTCH-Score: 0.000 X-CTCH-Rules: X-CTCH-Flags: 0 X-CTCH-ScoreCust: 0.000 X-Origin-Country: SE Received-SPF: softfail client-ip=91.136.14.58; envelope-from=mattiase@acm.org; helo=mail267c50.megamailservers.eu X-Spam_score_int: -11 X-Spam_score: -1.2 X-Spam_bar: - X-Spam_report: (-1.2 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, SPF_HELO_NONE=0.001, SPF_SOFTFAIL=0.665, T_SCC_BODY_TEXT_LINE=-0.01 autolearn=no autolearn_force=no X-Spam_action: no action X-Spam-Score: -1.3 (-) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.3 (--) 3 feb. 2022 kl. 12.03 skrev Michael Albinus : > soap-client.el is used also for older Emacsen via GNU ELPA. Thanks you, that file has now been changed not to use `string-search` or = `string-replace`. Emacs is becoming a mine-field with all these core packages. In = particular, soap-client does not advertise its required Emacs version in = the Package-Requires: line. What Emacs version would be the appropriate = minimum? Without knowing that, it's difficult to ensure that the package works = for the intended configurations. From unknown Sat Aug 09 01:11:01 2025 X-Loop: help-debbugs@gnu.org Subject: bug#53744: 27.2; [debbugs] soap-client.el: `string-search' (void function?) Resent-From: Eli Zaretskii Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Thu, 03 Feb 2022 11:54:02 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 53744 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Mattias =?UTF-8?Q?Engdeg=C3=A5rd?= Cc: ke.vigouroux@laposte.net, fitzsim@fitzsim.org, michael.albinus@gmx.de, 53744@debbugs.gnu.org Received: via spool by 53744-submit@debbugs.gnu.org id=B53744.164388922120263 (code B ref 53744); Thu, 03 Feb 2022 11:54:02 +0000 Received: (at 53744) by debbugs.gnu.org; 3 Feb 2022 11:53:41 +0000 Received: from localhost ([127.0.0.1]:54700 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFagH-0005Gk-L1 for submit@debbugs.gnu.org; Thu, 03 Feb 2022 06:53:41 -0500 Received: from eggs.gnu.org ([209.51.188.92]:42794) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFagF-0005GU-Vn for 53744@debbugs.gnu.org; Thu, 03 Feb 2022 06:53:40 -0500 Received: from [2001:470:142:3::e] (port=60034 helo=fencepost.gnu.org) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1nFag9-00068m-Kf; Thu, 03 Feb 2022 06:53:33 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-version:References:Subject:In-Reply-To:To:From: Date; bh=hzoNJgqVzGOrF2sg7gq2LOV1RhPfOfjK9Y0SwxzB+ho=; b=Cm2GewTFZiUFRHWpE2yD 4KXtlSncvt4w/PW5ROgHdbk351R3nBzrYPi2D0lZ63FwZTHFNkckdTanI2PoKuJRsvooQJjF7lvPY YItA/w6Pxb/zstdfm5v2kmOhXxxzrRSlAA045Uk7aqVBDuqW7xIlGaTmSSglKNZvSoU3crQePg6Uj QW3XAB6vzofkpSiFiIMtgOj+2d6IYsU372+cwiDnhj+RmhZwaVFsArMR/lT05m+aRXD/ST/57KcaU D+JV9lmNBRRoFzoD06Lw3MXTImmZp1og3Z+3wacAkLLg1Sf1djlLwm/niOjJ9oviv4iklXs9ltQej ogavmRqcavWptQ==; Received: from [87.69.77.57] (port=1954 helo=home-c4e4a596f7) by fencepost.gnu.org with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1nFag9-00039S-0C; Thu, 03 Feb 2022 06:53:33 -0500 Date: Thu, 03 Feb 2022 13:53:37 +0200 Message-Id: <83iltw414u.fsf@gnu.org> From: Eli Zaretskii In-Reply-To: <0EDB1FB5-3EBD-4CD7-897B-C956E1069E70@acm.org> (message from Mattias =?UTF-8?Q?Engdeg=C3=A5rd?= on Thu, 3 Feb 2022 12:36:05 +0100) References: <87fsp0fhc9.fsf@laposte.net> <87o83op5yk.fsf@gmx.de> <0EDB1FB5-3EBD-4CD7-897B-C956E1069E70@acm.org> MIME-version: 1.0 Content-type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -2.3 (--) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > From: Mattias Engdegård > Date: Thu, 3 Feb 2022 12:36:05 +0100 > Cc: ke.vigouroux@laposte.net, fitzsim@fitzsim.org, 53744@debbugs.gnu.org > > Emacs is becoming a mine-field with all these core packages. In particular, soap-client does not advertise its required Emacs version in the Package-Requires: line. What Emacs version would be the appropriate minimum? > > Without knowing that, it's difficult to ensure that the package works for the intended configurations. Yes, we should aim at including this information in files used by ELPA packages. From unknown Sat Aug 09 01:11:01 2025 X-Loop: help-debbugs@gnu.org Subject: bug#53744: 27.2; [debbugs] soap-client.el: `string-search' (void function?) Resent-From: Michael Albinus Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Thu, 03 Feb 2022 12:39:02 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 53744 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Mattias =?UTF-8?Q?Engdeg=C3=A5rd?= Cc: ke.vigouroux@laposte.net, 53744@debbugs.gnu.org, fitzsim@fitzsim.org X-Debbugs-Original-Cc: Kevin Vigouroux , "Kevin Vigouroux via Bug reports for GNU Emacs, the Swiss army knife of text editors" , Thomas Fitzsimmons , 53744@debbugs.gnu.org Received: via spool by 53744-submit@debbugs.gnu.org id=B53744.1643891924798 (code B ref 53744); Thu, 03 Feb 2022 12:39:02 +0000 Received: (at 53744) by debbugs.gnu.org; 3 Feb 2022 12:38:44 +0000 Received: from localhost ([127.0.0.1]:54742 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFbNs-0000Cn-9G for submit@debbugs.gnu.org; Thu, 03 Feb 2022 07:38:44 -0500 Received: from mout.gmx.net ([212.227.17.21]:35525) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFbNo-0000CY-0z for 53744@debbugs.gnu.org; Thu, 03 Feb 2022 07:38:43 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=gmx.net; s=badeba3b8450; t=1643891910; bh=KBzAXUHJPYOCC8VKY/qJyz0SNkoBb5/WtF+5XJFdZ6g=; h=X-UI-Sender-Class:From:To:Cc:Subject:References:Date:In-Reply-To; b=khOFXwnzckmIKkOnhRg6IbuUQsjRbgC+ipCxmzjVdnAD42nIqS3SDds2f0+BMltTX UX2nxyRPeIWq6DJ5N5dXwk3VqaEKzs9ZQR6lWY0jVKtPgdZzo0CZZfskLtWzfBp3iY pP/5yMagh+oDoskdfM8zM0ZiZX9OTU13lESbCHNk= X-UI-Sender-Class: 01bb95c1-4bf8-414a-932a-4f6e2808ef9c Received: from gandalf.gmx.de ([213.220.159.97]) by mail.gmx.net (mrgmx104 [212.227.17.168]) with ESMTPSA (Nemesis) id 1M72sJ-1n9Hj70C3r-008YYf; Thu, 03 Feb 2022 13:38:30 +0100 From: Michael Albinus References: <87fsp0fhc9.fsf@laposte.net> <87o83op5yk.fsf@gmx.de> <0EDB1FB5-3EBD-4CD7-897B-C956E1069E70@acm.org> Date: Thu, 03 Feb 2022 13:38:28 +0100 In-Reply-To: <0EDB1FB5-3EBD-4CD7-897B-C956E1069E70@acm.org> ("Mattias =?UTF-8?Q?Engdeg=C3=A5rd?="'s message of "Thu, 3 Feb 2022 12:36:05 +0100") Message-ID: <87k0ecp1kr.fsf@gmx.de> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/29.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Provags-ID: V03:K1:5WRX2jnqk+TKIpCZiT0KEmnQmLucfArMMwg4F44uyBPORRBlFoy l8nBaxGZ0O9L31rPbg+QSOnmr5+XjwJ1ClLze42rfDmKK9sxENg6s1jQApRENgupILYz52o bw0HkmyCus3vXdRyeEk0wyN6qzHbhjxKHDgLX8VSoNeTXG1c9rEz7A+BIz1pMfvsEGoYDiK Bja40pfg7v/c0ludzqEKA== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:5FK8IJB/VLk=:cmUPNJ+76ptaCmf3aLrpRr 8UKXjbRn6PoVF+j3/y0+P/uu+BIjthdbA5FyyX4pHr6NfbsmAmCYTqJTUkCvt8tzG52Nh9vKr /zIaQIgjW9iNlqtUykK1pCyt/t7l6Abz8ppd6qF2mBYYT0Zio1BoD79GHyIunbaZUKRQsli30 8jZoQ7j5akINwsHbE81Ye7epryEa/HuwgRhrKKleeEB+jyg5WYbxn0GDjUw+/lgt6fJvBLDM1 hQEhNiPuh2ciQTenZMQMknotANh2PQump08EhtsNlJgr5kPm2xZ3z7lkuo3LjsIVH6RHZmwNe jQd+7GJGlCa3dsay3rm/gEydS/cNqXGUdOop51Ien1PKnK7cucLeFn4d4NL+xyYHkF+Mk122W aDtGfO5JQ8/ATIPTuPA0Lju7jKrfKIkPwDC1zEv6rqaVPybgnoHaXy5nhtqi0ieoaapnGclIR JCJufh6WG5SQfJIWwvCNaxIySi+L+bbifAeTG6tacDVkWo6z0YaHjSTsfzQHMunA3NKdpxgmi r8q3cfuaG7VKBawToTzowls+rPTuQx6Y45IjIEfAzplHJZ7dQXaSAvEYY+LFrQfn0irurogMu q5kvBSqpzXdayVw2OVU+5oJcfCIREsZa9wrmIvQQ2CylQRIqV9UuifgMmd0AHoF/ZdNAfBKDz vJuWaOtpe89DZnF5TFa5pvy93Z1WzY2G9pXduJ8P4NksScnplPQU9xUEMOh21W3DgG2gr6tFS sYmvAGjH3bpXjNvLrhmQpDGNu01wDyhQBMkuEbV+hwLmSXKetzcEWCQ1RBi7yURIhzt0NnDlO iDo70SMOBAXoRBrp9hbJ4KnLs3hKAtLY01ijn1AD8KDPkf/NMmE4D+m1fT6Mxijt2ctYJ8y2O zW228WFDNioMBZHVy2HL82+rtONqA0scu7+9sLOuOKNAg4qSyljb6RXJ6GTaQbmIMNr+7ZaXW oRhLotpdqC8r6C+qvDG8bi0HUzbai7R1DbynIEn4+NwC7NtdaCNseTRWkAx2gFFq84D1NikMX QyW1b4rMDgwElzzqu3Aa0DQnk3+ps8/9q8aWeFYMB687qPqp6zUYBSv8VeNmXqFowu548k/ne dMitP9IbxAJPmY= X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Mattias Engdeg=C3=A5rd writes: Hi Mattias, >> soap-client.el is used also for older Emacsen via GNU ELPA. > > Thanks you, that file has now been changed not to use `string-search` or = `string-replace`. Thanks. Perhaps it needs also a new version in order to be visible on GNU ELPA, don't know. Thomas might know. > Emacs is becoming a mine-field with all these core packages. In particula= r, soap-client does not advertise its required Emacs version in the Package= -Requires: line. What Emacs version would be the appropriate minimum? > Without knowing that, it's difficult to ensure that the package works for= the intended configurations. Yes. debbugs requires (emacs "25.1"), I would appreciate if soap-client could do the same. Best regards, Michael. From unknown Sat Aug 09 01:11:01 2025 X-Loop: help-debbugs@gnu.org Subject: bug#53744: 27.2; [debbugs] soap-client.el: `string-search' (void function?) Resent-From: Thomas Fitzsimmons Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Thu, 03 Feb 2022 14:49:02 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 53744 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Michael Albinus Cc: Mattias =?UTF-8?Q?Engdeg=C3=A5rd?= , 53744@debbugs.gnu.org, ke.vigouroux@laposte.net Received: via spool by 53744-submit@debbugs.gnu.org id=B53744.164389974113659 (code B ref 53744); Thu, 03 Feb 2022 14:49:02 +0000 Received: (at 53744) by debbugs.gnu.org; 3 Feb 2022 14:49:01 +0000 Received: from localhost ([127.0.0.1]:54971 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFdPx-0003YB-CJ for submit@debbugs.gnu.org; Thu, 03 Feb 2022 09:49:01 -0500 Received: from mail-qv1-f43.google.com ([209.85.219.43]:34462) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFdPw-0003Xz-HI for 53744@debbugs.gnu.org; Thu, 03 Feb 2022 09:49:01 -0500 Received: by mail-qv1-f43.google.com with SMTP id a7so2763754qvl.1 for <53744@debbugs.gnu.org>; Thu, 03 Feb 2022 06:49:00 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fitzsim-org.20210112.gappssmtp.com; s=20210112; h=from:to:cc:subject:references:date:in-reply-to:message-id :user-agent:mime-version:content-transfer-encoding; bh=kEXE7DYHzgHPmmDGXcbgixkmt4LzHJ4v0/BtCuy3fV8=; b=owB6P8dQCGm1YgaFUoZXSJBJVZFWi+fbfS+yibipLi2HUYbEtR4dKpFgnMOq0vcW5T mBdZjNaBerPTZb3nuzD4RzrApl7Ooq3qHk3hBZv6aucbswD+pCO9kdJ8ENmQz3wV2xhL a5WNTjbkzwPMCR3zPwokSPnHKhur95EVcgpr4bidoQbTzQZZnYtbdgUrwow07gz+VDeV fE5l98WS7mCkmqMXBeG+ZjMrlfQbfgv6Ha8dhntIYqmXtmXbYXQyuqDRmXu/mhneFpnI CcEqANRECBCkbGtQ0DVaGpU7MbqKikEfS2VXA3qnKXOQX6Otrl/MnRQA4X+1z2gSjRKX RrLg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:from:to:cc:subject:references:date:in-reply-to :message-id:user-agent:mime-version:content-transfer-encoding; bh=kEXE7DYHzgHPmmDGXcbgixkmt4LzHJ4v0/BtCuy3fV8=; b=hU2AQ6fP5+BxCFmkLtJFLC5T1hX5CRxNkhnByoUxiupLLrYR+jaS01YnnHLnPuDm8A N3AsoL8+fn0gGHgXqnHHSgI8ncZWy4zTljz2VB5jDTPmsY07YfzLnw/Aun8Is5ACosnJ GqThd9wAocmLRMSd3nBJHjGt2I7oNieum+AWW64Qe6LKkT9xJ5xNVtnfDKKzJE0MD/lB i2GdSQbsHVmv96iKByMdEZqwuLyiSb/BOGl1TxiYJ0EiVVIBHpdBYdqmxF4sYp1rW/a3 tXSpfwzpZih/dAFoxglQqm3Bko44PzklrEGLMsZoVNHZHVhG3T3OLs5zfNnHsIutrri4 H3Wg== X-Gm-Message-State: AOAM532AkfwlUN7vn1wBkYVw5QrDit3xtQMpnUW3RAgboD+U3bxtAqlj wF3W6lGGXCTcmczYSCA2JraMLADO4dylnA== X-Google-Smtp-Source: ABdhPJzPSCPAvm7AbYofb+K5vnzvG1X65LWa5DkIHLTxhTXdxarR/fgo+tDkAsRKMC/ItKqrrHiOMQ== X-Received: by 2002:a05:6214:2529:: with SMTP id gg9mr31155490qvb.60.1643899734763; Thu, 03 Feb 2022 06:48:54 -0800 (PST) Received: from localhost.localdomain (69-165-165-189.dsl.teksavvy.com. [69.165.165.189]) by smtp.gmail.com with ESMTPSA id x12sm7128988qkp.122.2022.02.03.06.48.54 (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Thu, 03 Feb 2022 06:48:54 -0800 (PST) From: Thomas Fitzsimmons References: <87fsp0fhc9.fsf@laposte.net> <87o83op5yk.fsf@gmx.de> <0EDB1FB5-3EBD-4CD7-897B-C956E1069E70@acm.org> <87k0ecp1kr.fsf@gmx.de> Date: Thu, 03 Feb 2022 09:48:53 -0500 In-Reply-To: <87k0ecp1kr.fsf@gmx.de> (Michael Albinus's message of "Thu, 03 Feb 2022 13:38:28 +0100") Message-ID: User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/28.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.0 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hi Michael, Mattias, Michael Albinus writes: > Mattias Engdeg=C3=A5rd writes: > > Hi Mattias, > >>> soap-client.el is used also for older Emacsen via GNU ELPA. >> >> Thanks you, that file has now been changed not to use `string-search` >> or `string-replace`. Yes, thanks for fixing this Mattias. > Perhaps it needs also a new version in order to be visible on GNU > ELPA, don't know. Thomas might know. As I remember, jump bumping the version of a core ELPA package on emacs.git's master branch will result in it being updated in the archive. I've done a minor version bump, so we'll see if 3.2.1 appears in "list-packages" within 24 hours. >> Emacs is becoming a mine-field with all these core packages. In >> particular, soap-client does not advertise its required Emacs >> version in the Package-Requires: line. What Emacs version would be >> the appropriate minimum? >> Without knowing that, it's difficult to ensure that the package works >> for the intended configurations. > > Yes. debbugs requires (emacs "25.1"), I would appreciate if > soap-client could do the same. Done, added (emacs "24.1") to Package-Requires. Excorporate 1.0.0, which uses most of soap-client's features, works back to Emacs 24.1. Thomas From unknown Sat Aug 09 01:11:01 2025 X-Loop: help-debbugs@gnu.org Subject: bug#53744: 27.2; [debbugs] soap-client.el: `string-search' (void function?) Resent-From: Mattias =?UTF-8?Q?Engdeg=C3=A5rd?= Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Thu, 03 Feb 2022 15:00:02 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 53744 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Thomas Fitzsimmons Cc: Kevin Vigouroux , Michael Albinus , Stefan Kangas , 53744@debbugs.gnu.org Received: via spool by 53744-submit@debbugs.gnu.org id=B53744.164390035716957 (code B ref 53744); Thu, 03 Feb 2022 15:00:02 +0000 Received: (at 53744) by debbugs.gnu.org; 3 Feb 2022 14:59:17 +0000 Received: from localhost ([127.0.0.1]:57375 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFdZt-0004PQ-D7 for submit@debbugs.gnu.org; Thu, 03 Feb 2022 09:59:17 -0500 Received: from mail1454c50.megamailservers.eu ([91.136.14.54]:54022 helo=mail266c50.megamailservers.eu) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFdZo-0004Oh-GD for 53744@debbugs.gnu.org; Thu, 03 Feb 2022 09:59:16 -0500 X-Authenticated-User: mattiase@bredband.net DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=megamailservers.eu; s=maildub; t=1643900345; bh=Lb5CCw2BPNs67wJdSB9yJhPOyi9u23l5TadJSLzSShQ=; h=Subject:From:In-Reply-To:Date:Cc:References:To:From; b=onCeUHwxHc4p0UppF+YYR+eoIUI1DRRwAAgDZi9Ezd+mRb3BgIS0KLRvBhBrInNWy jMjt0cGiRUeTxXyQWt6psbmiV4VfqlHAhm0gBwVXXkKiqPfy/ThMBO+A3hH6czWHyz oXL5lif4fzMddfP5M+uRIrhBcvghvI+/HhXjQcuM= Feedback-ID: mattiase@acm.or Received: from smtpclient.apple (c188-150-171-71.bredband.tele2.se [188.150.171.71]) (authenticated bits=0) by mail266c50.megamailservers.eu (8.14.9/8.13.1) with ESMTP id 213Ex2Bd022625; Thu, 3 Feb 2022 14:59:04 +0000 Content-Type: text/plain; charset=us-ascii Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.120.0.1.13\)) From: Mattias =?UTF-8?Q?Engdeg=C3=A5rd?= In-Reply-To: Date: Thu, 3 Feb 2022 15:59:02 +0100 Content-Transfer-Encoding: quoted-printable Message-Id: <896F68B1-BE75-4690-AB78-A615ABCC6428@acm.org> References: <87fsp0fhc9.fsf@laposte.net> <87o83op5yk.fsf@gmx.de> <0EDB1FB5-3EBD-4CD7-897B-C956E1069E70@acm.org> <87k0ecp1kr.fsf@gmx.de> X-Mailer: Apple Mail (2.3654.120.0.1.13) X-CTCH-RefID: str=0001.0A742F18.61FBEDB9.0015, ss=1, re=0.000, recu=0.000, reip=0.000, cl=1, cld=1, fgs=0 X-CTCH-VOD: Unknown X-CTCH-Spam: Unknown X-CTCH-Score: 0.000 X-CTCH-Rules: X-CTCH-Flags: 0 X-CTCH-ScoreCust: 0.000 X-Origin-Country: SE X-Spam-Score: 1.3 (+) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: 3 feb. 2022 kl. 15.48 skrev Thomas Fitzsimmons : > Done, added (emacs "24.1") to Package-Requires. Excorporate 1.0.0, > which uses most of soap-client's features, works back to Emacs 24.1. Content analysis details: (1.3 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 SPF_HELO_NONE SPF: HELO does not publish an SPF Record 1.0 SPF_SOFTFAIL SPF: sender does not match SPF record (softfail) -0.0 T_SCC_BODY_TEXT_LINE No description available. 0.3 KHOP_HELO_FCRDNS Relay HELO differs from its IP's reverse DNS X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.0 (/) 3 feb. 2022 kl. 15.48 skrev Thomas Fitzsimmons : > Done, added (emacs "24.1") to Package-Requires. Excorporate 1.0.0, > which uses most of soap-client's features, works back to Emacs 24.1. Excellent! Do you have a CI or other arrangement to test that = soap-client and excorporate work with versions back to 24.1? For instance, soap-inspect.el also uses seq-random-elt which seems to = have been introduced in Emacs 26. From unknown Sat Aug 09 01:11:01 2025 X-Loop: help-debbugs@gnu.org Subject: bug#53744: 27.2; [debbugs] soap-client.el: `string-search' (void function?) Resent-From: Thomas Fitzsimmons Original-Sender: "Debbugs-submit" Resent-CC: bug-gnu-emacs@gnu.org Resent-Date: Thu, 03 Feb 2022 15:59:02 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 53744 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Mattias =?UTF-8?Q?Engdeg=C3=A5rd?= Cc: Kevin Vigouroux , Michael Albinus , Stefan Kangas , 53744@debbugs.gnu.org Received: via spool by 53744-submit@debbugs.gnu.org id=B53744.164390389222911 (code B ref 53744); Thu, 03 Feb 2022 15:59:02 +0000 Received: (at 53744) by debbugs.gnu.org; 3 Feb 2022 15:58:12 +0000 Received: from localhost ([127.0.0.1]:57500 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFeUu-0005xS-Fg for submit@debbugs.gnu.org; Thu, 03 Feb 2022 10:58:12 -0500 Received: from mail-qt1-f175.google.com ([209.85.160.175]:46939) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFeUs-0005xF-CF for 53744@debbugs.gnu.org; Thu, 03 Feb 2022 10:58:11 -0500 Received: by mail-qt1-f175.google.com with SMTP id h8so2738978qtk.13 for <53744@debbugs.gnu.org>; Thu, 03 Feb 2022 07:58:10 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fitzsim-org.20210112.gappssmtp.com; s=20210112; h=from:to:cc:subject:references:date:in-reply-to:message-id :user-agent:mime-version:content-transfer-encoding; bh=1GdP3duhs2LUUdWpmDtxxVbbh6eypS6MuTmL7cAnKzw=; b=O3jbl4QnfJac8oDRy7QVnRrn7zm4IpQcFxIQqQxJWMwv6ewbiMQEw/Szb2oMo56GaL NmQWj095EFOhOHtrrUje/7PnO6qcLp8GwzU0BL0q6o7JaeF9ZJcgdyoALtC+xOb8x56n psd0V3FzYU9euPWBpf9PHUqDkQetoJTn/QbsG2Pgs358Bl5a8WprDMQWyqmxxZnadWKD cw0MuB/EsGERptLCuWUOhWSGUm/dsGal6cu5AoPHcFswZPMNhhSbg+ieWjemtc9BTs7r slCVmvhLRZ1e6F/drdKLxYwXJ0ibsAmxoaw5NYuV/5JemfPIbmSUcsDGVxRdb8dbGp4Z 83wg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:from:to:cc:subject:references:date:in-reply-to :message-id:user-agent:mime-version:content-transfer-encoding; bh=1GdP3duhs2LUUdWpmDtxxVbbh6eypS6MuTmL7cAnKzw=; b=aAzmn9VfFI2dsXDUGF/FzjbY0xpDAgbyNuE0iBSjWiBJlYmqC95dj6XJFr2t1Tmwr9 LWyAiFSG5mtU+otUSv9cP7LcMKf0DIZaQHayh9XIXdwu2uXqeeyBUKnR6bWr952y96g9 9H/f0aixiCDveJP8Kt/0wY0SBGP7IireZUnn5qsWCimT7MSQAS2x9AkSVhZmqT0QE4zs cwXfymVdc6yBcH9Q2C3UfH2urpEXiyS+o8zhIilCTgdjVilrs21p/2m+26hWuxYTvHvv VURNnhl9qeLA1Z1TwHIx9o0BCn5bg/A5WbxeBiYpJjd4In83eTrWn6PU3jgwBdtwiyUy eiBA== X-Gm-Message-State: AOAM531qQkSsiYOUVgxYMXVIOQCxDysFJ2bB3KA0ls8vkxZa+wrujhRd Qkz+Ws/fjl3vBzeMsb7gX+y9nw== X-Google-Smtp-Source: ABdhPJzxgxhnJkp+VvstmMY9JAxdfG0u4hvYYvTbvsLS3fwptiDrzlsFnBAdIrPoBq+L3Ul+W2Irag== X-Received: by 2002:a05:620a:2809:: with SMTP id f9mr23506008qkp.527.1643903884734; Thu, 03 Feb 2022 07:58:04 -0800 (PST) Received: from localhost.localdomain (69-165-165-189.dsl.teksavvy.com. [69.165.165.189]) by smtp.gmail.com with ESMTPSA id h6sm12729925qkk.14.2022.02.03.07.58.04 (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Thu, 03 Feb 2022 07:58:04 -0800 (PST) From: Thomas Fitzsimmons References: <87fsp0fhc9.fsf@laposte.net> <87o83op5yk.fsf@gmx.de> <0EDB1FB5-3EBD-4CD7-897B-C956E1069E70@acm.org> <87k0ecp1kr.fsf@gmx.de> <896F68B1-BE75-4690-AB78-A615ABCC6428@acm.org> Date: Thu, 03 Feb 2022 10:58:03 -0500 In-Reply-To: <896F68B1-BE75-4690-AB78-A615ABCC6428@acm.org> ("Mattias =?UTF-8?Q?Engdeg=C3=A5rd?="'s message of "Thu, 3 Feb 2022 15:59:02 +0100") Message-ID: User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/28.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.0 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Mattias Engdeg=C3=A5rd writes: > 3 feb. 2022 kl. 15.48 skrev Thomas Fitzsimmons : > >> Done, added (emacs "24.1") to Package-Requires. Excorporate 1.0.0, >> which uses most of soap-client's features, works back to Emacs 24.1. > > Excellent! Do you have a CI or other arrangement to test that > soap-client and excorporate work with versions back to 24.1? I've been testing it by hand against a server for each Excorporate release. I have Alex Harsanyi's soap-client test suite but it's probably not redistributable because it contains WSDL files that don't have proper license information. Maybe I could rig something up on sourcehut (sr.ht) to periodically run that test suite with Emacs 24.1 and soap-client from master. It would be nice if there were some official GNU ELPA CI for older versions of Emacs though, since, as you point out, this same issue applies to other core packages. > For instance, soap-inspect.el also uses seq-random-elt which seems to > have been introduced in Emacs 26. Yeah, soap-inspect.el is a debugging tool, not a library like soap-client.el, so I'd say maintaining backward compatibility isn't as important for it. Thomas From unknown Sat Aug 09 01:11:01 2025 MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) X-Loop: help-debbugs@gnu.org From: help-debbugs@gnu.org (GNU bug Tracking System) To: Kevin Vigouroux Subject: bug#53744: closed (Re: bug#53744: 27.2; [debbugs] soap-client.el: `string-search' (void function?)) Message-ID: References: <864C6ECB-2F24-4CE3-A92A-77EDF5FBBF7B@acm.org> <87fsp0fhc9.fsf@laposte.net> X-Gnu-PR-Message: they-closed 53744 X-Gnu-PR-Package: emacs Reply-To: 53744@debbugs.gnu.org Date: Thu, 03 Feb 2022 16:04:02 +0000 Content-Type: multipart/mixed; boundary="----------=_1643904242-23670-1" This is a multi-part message in MIME format... ------------=_1643904242-23670-1 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="utf-8" Your bug report #53744: 27.2; [debbugs] soap-client.el: `string-search' (void function?) which was filed against the emacs package, has been closed. The explanation is attached below, along with your original report. If you require more details, please reply to 53744@debbugs.gnu.org. --=20 53744: http://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D53744 GNU Bug Tracking System Contact help-debbugs@gnu.org with problems ------------=_1643904242-23670-1 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at 53744-done) by debbugs.gnu.org; 3 Feb 2022 16:03:23 +0000 Received: from localhost ([127.0.0.1]:57517 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFeZv-00068Y-66 for submit@debbugs.gnu.org; Thu, 03 Feb 2022 11:03:23 -0500 Received: from mail18c50.megamailservers.eu ([91.136.10.28]:44980) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFeZs-00068L-79 for 53744-done@debbugs.gnu.org; Thu, 03 Feb 2022 11:03:21 -0500 X-Authenticated-User: mattiase@bredband.net DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=megamailservers.eu; s=maildub; t=1643904197; bh=v10RiGdjdh7voLqEdMp26arapdkU3AZlC0yZK8ix9Gk=; h=Subject:From:In-Reply-To:Date:Cc:References:To:From; b=n6jFsIc36UzMmJTtvIC8KGNm8w77/XNcDXn1mKZSfhHzdQ+8zpIwX9pkZA47JILeX BXa2rbF2HlWi6lhBsn8yS5s3WKYwMIDXvdQvBXT+CaBb7O6Zzqa0ovDOePGB3mw0Zm mfXXafWv6FIIj+7hShEIa/m02MllKasupp9wVvAw= Feedback-ID: mattiase@acm.or Received: from smtpclient.apple (c188-150-171-71.bredband.tele2.se [188.150.171.71]) (authenticated bits=0) by mail18c50.megamailservers.eu (8.14.9/8.13.1) with ESMTP id 213G3EfZ024587; Thu, 3 Feb 2022 16:03:16 +0000 Content-Type: text/plain; charset=us-ascii Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.120.0.1.13\)) Subject: Re: bug#53744: 27.2; [debbugs] soap-client.el: `string-search' (void function?) From: =?utf-8?Q?Mattias_Engdeg=C3=A5rd?= In-Reply-To: Date: Thu, 3 Feb 2022 17:03:14 +0100 Content-Transfer-Encoding: quoted-printable Message-Id: <864C6ECB-2F24-4CE3-A92A-77EDF5FBBF7B@acm.org> References: <87fsp0fhc9.fsf@laposte.net> <87o83op5yk.fsf@gmx.de> <0EDB1FB5-3EBD-4CD7-897B-C956E1069E70@acm.org> <87k0ecp1kr.fsf@gmx.de> <896F68B1-BE75-4690-AB78-A615ABCC6428@acm.org> To: Thomas Fitzsimmons X-Mailer: Apple Mail (2.3654.120.0.1.13) X-CTCH-RefID: str=0001.0A742F28.61FBFCC5.00A0, ss=1, re=0.000, recu=0.000, reip=0.000, cl=1, cld=1, fgs=0 X-CTCH-VOD: Unknown X-CTCH-Spam: Unknown X-CTCH-Score: 0.000 X-CTCH-Rules: X-CTCH-Flags: 0 X-CTCH-ScoreCust: 0.000 X-Origin-Country: SE X-Spam-Score: 1.0 (+) X-Debbugs-Envelope-To: 53744-done Cc: Kevin Vigouroux , Michael Albinus , Stefan Kangas , 53744-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.0 (/) 3 feb. 2022 kl. 16.58 skrev Thomas Fitzsimmons : > I've been testing it by hand against a server for each Excorporate > release. That's reassuring to know. It sounds as if we are done for now, so I'm closing the bug. Do tell if = there is anything else. ------------=_1643904242-23670-1 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at submit) by debbugs.gnu.org; 3 Feb 2022 09:08:28 +0000 Received: from localhost ([127.0.0.1]:54385 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFY6N-0000im-A6 for submit@debbugs.gnu.org; Thu, 03 Feb 2022 04:08:28 -0500 Received: from lists.gnu.org ([209.51.188.17]:47948) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1nFY6J-0000ic-AG for submit@debbugs.gnu.org; Thu, 03 Feb 2022 04:08:26 -0500 Received: from eggs.gnu.org ([209.51.188.92]:35228) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1nFY6I-0000Q6-Pn for bug-gnu-emacs@gnu.org; Thu, 03 Feb 2022 04:08:23 -0500 Received: from smtp-outgoing-2003.laposte.net ([160.92.124.110]:37815) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1nFY6F-0007mt-2A for bug-gnu-emacs@gnu.org; Thu, 03 Feb 2022 04:08:22 -0500 X-mail-filterd: {"version":"1.3.4", "queueID":"4JqCWC6g3ZzSgpM", "contextId":"c20ad276-1251-48ac-b035-8bf60caae42a"} Received: from outgoing-mail.laposte.net (localhost.localdomain [127.0.0.1]) by mlpnf0112.laposte.net (SMTP Server) with ESMTP id 4JqCWC6g3ZzSgpM for ; Thu, 3 Feb 2022 10:08:07 +0100 (CET) X-mail-filterd: {"version":"1.3.4", "queueID":"4JqCWC36lBzSgpL", "contextId":"c51d276e-b2af-42ee-92bd-b19c0bf76aff"} X-lpn-mailing: LEGIT X-lpn-spamrating: 50 X-lpn-spamlevel: not-spam X-lpn-spamcause: OK, (0)(0000)gggruggvucftvghtrhhoucdtuddrgedvvddrgeeigdduvdeiucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecunfetrffquffvgfdpggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvffufffkgggtgfesthhqredttddtjeenucfhrhhomhepmfgvvhhinhcugghighhouhhrohhugicuoehkvgdrvhhighhouhhrohhugieslhgrphhoshhtvgdrnhgvtheqnecuggftrfgrthhtvghrnhepfeejtddttdeugfegjeejueffvdevgedtgfdvkedtvdegleegtdekvefghfduffdvnecuffhomhgrihhnpehgnhhurdhorhhgpdigmhhlshhorghprdhorhhgpdgrphgrtghhvgdrohhrghdpfiefrdhorhhgpdguvggsihgrnhdrohhrghdplhgrphhoshhtvgdrnhgvthenucfkphepledtrdefvddrkeekrddvvdejnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepledtrdefvddrkeekrddvvdejpdhhvghloheprghrrghgohhgpdhmrghilhhfrhhomhepkhgvrdhvihhgohhurhhouhigsehlrghpohhsthgvrdhnvghtpdhnsggprhgtphhtthhopedupdhrtghpthhtohepsghughdqghhnuhdqvghmrggtshesghhnuhdrohhrghdpmhhouggvpehsmhhtphhouhht Received: from aragog (arennes-656-1-400-227.w90-32.abo.wanadoo.fr [90.32.88.227]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by mlpnf0112.laposte.net (SMTP Server) with ESMTPSA id 4JqCWC36lBzSgpL for ; Thu, 3 Feb 2022 10:08:07 +0100 (CET) From: Kevin Vigouroux To: bug-gnu-emacs@gnu.org Subject: 27.2; [debbugs] soap-client.el: `string-search' (void function?) Date: Thu, 03 Feb 2022 10:08:06 +0100 Message-ID: <87fsp0fhc9.fsf@laposte.net> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=laposte.net; s=lpn-wlmd; t=1643879288; bh=UUKn7Br/s9xKxEozSitXJ1tFd0sFKy0+1t4DuZCngCw=; h=From:To:Subject:Date:Message-ID:MIME-Version:Content-Type:Content-Transfer-Encoding; b=Ny30QGfLa27g7f7tydskPi1t45xm+rJgQ89ym3D9+EmcpTc6RkTcvjmNSyBR8OvjUji4DUVH84mttyWkC0WzzlDqwcX/WCfr5wKiwQCGc/CDGR3rrooWN0A2VprfStHg/08lEvLnAWcXiHIC7L6z/xEFX2M39/uOV82BRTMddgV0mi4hvMMOvjXLFhYZFiIohdGqnJ0VlXwuOe66nf+MZkeq/vnIduXw4c4S8LyDHt7gZTXAkIQtOTsNwgV544fxm1QOvvsopBx9GBegzVyiijN0NBgfz2UPrRgBoEoSZPjRuZnoWUG3MLCGIPQqnEtOsk6PMtxEfSGyL9kCuCE84A==; Received-SPF: pass client-ip=160.92.124.110; envelope-from=ke.vigouroux@laposte.net; helo=smtp-outgoing-2003.laposte.net X-Spam_score_int: -27 X-Spam_score: -2.8 X-Spam_bar: -- X-Spam_report: (-2.8 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, FREEMAIL_FROM=0.001, RCVD_IN_DNSWL_LOW=-0.7, SPF_HELO_NONE=0.001, SPF_PASS=-0.001, T_SCC_BODY_TEXT_LINE=-0.01 autolearn=ham autolearn_force=no X-Spam_action: no action X-Spam-Score: 0.2 (/) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.4 (--) When I use the =E2=80=9Cdebbugs=E2=80=9D package [https://elpa.gnu.org/pack= ages/debbugs.html] to find keywords with `debbugs-gnu-search', it produces the following error. #+begin_quote error in process filter: soap-decode-xs-complex-type: Symbol=E2=80=99s func= tion definition is void: string-search #+end_quote --- `toggle-debug-on-error' generated the following backtrace: #+begin_quote Debugger entered--Lisp error: (void-function string-search) string-search(":" "s-gensym3") soap-decode-xs-complex-type(#s(soap-xs-complex-type :name "Map" :namespac= e-tag "ns2" :id nil :attributes nil :attribute-groups nil :indicator sequen= ce :base nil :elements ... :optional? nil :multiple? nil :is-group nil) (s-= gensym3 ... ... ... ... ... ... ... ... ... ... ... ... ... ...)) soap-decode-type(#s(soap-xs-complex-type :name "Map" :namespace-tag "ns2"= :id nil :attributes nil :attribute-groups nil :indicator sequence :base ni= l :elements ... :optional? nil :multiple? nil :is-group nil) (s-gensym3 ...= ... ... ... ... ... ... ... ... ... ... ... ... ...)) soap-decode-xs-element(#s(soap-xs-element :name "s-gensym3" :namespace-ta= g "ns1" :id nil :type^ ... :optional? nil :multiple? nil :reference nil :su= bstitution-group nil :alternatives nil :is-group nil) (s-gensym3 ... ... ..= . ... ... ... ... ... ... ... ... ... ... ...)) soap-decode-type(#s(soap-xs-element :name "s-gensym3" :namespace-tag "ns1= " :id nil :type^ ... :optional? nil :multiple? nil :reference nil :substitu= tion-group nil :alternatives nil :is-group nil) (s-gensym3 ... ... ... ... = ... ... ... ... ... ... ... ... ... ...)) soap-parse-response((get_statusResponse ... ...) #s(soap-bound-operation = :operation ... :soap-action "Debbugs/SOAP" :soap-headers nil :soap-body nil= :use encoded) #s(soap-wsdl :origin "/home/kevin/.e..." :current-file "/hom= e/kevin/.e..." :xmlschema-imports nil :ports ... :alias-table ... :namespac= es ...) nil (soap:Body nil ...)) soap-parse-envelope((soap:Envelope ((soap:encodingStyle . "http://schemas= .xmlsoap.org...") (xmlns:apachens . "http://xml.apache.org/xml-...") (xmlns= :soap . "http://schemas.xmlsoap.org...") (xmlns:soapenc . "http://schemas.x= mlsoap.org...") (xmlns:xsd . "http://www.w3.org/2001/XML...") (xmlns:xsi . = "http://www.w3.org/2001/XML...")) (soap:Body nil (get_statusResponse ... ..= .))) #s(soap-bound-operation :operation #s(soap-operation :name "get_status= " :namespace-tag "ns1" :parameter-order (bugs) :input (in1 . ...) :output (= out1 . ...) :faults nil :input-action nil :output-action nil) :soap-action = "Debbugs/SOAP" :soap-headers nil :soap-body nil :use encoded) #s(soap-wsdl = :origin "/home/kevin/.emacs.d/strai..." :current-file "/home/kevin/.emacs.d= /strai..." :xmlschema-imports nil :ports (#s(soap-port :name "debian.org" := namespace-tag nil :service-url "https://bugs.debian.org/cg..." :binding ...= ) #s(soap-port :name "gnu.org" :namespace-tag nil :service-url "https://deb= bugs.gnu.org/cg..." :binding ...)) :alias-table (("ns3" . "urn:Debbugs/SOAP= /TYPES") ("ns2" . "http://xml.apache.org/xml-...") ("ns1" . "urn:Debbugs/SO= AP") ("soapenc" . "http://schemas.xmlsoap.org...") ("xsd" . "http://www.w3.= org/2001/XML...")) :namespaces (#s(soap-namespace :name "urn:Debbugs/SOAP" = :elements #) #s(soap-namespace :name= "http://xml.apache.org/xml-..." :elements #) #s(soap-namespace :name "urn:Debbugs/SOAP/TYPES" :elements #) #s(soap-namespace :name "http://schemas.x= mlsoap.org..." :elements #) #s(soap-= namespace :name "http://www.w3.org/2001/XML..." :elements #)))) #f(compiled-function (status) #)((:peer (:certif= icates ((:version 3 :serial-number "04:7e:f8:64:00:24:2b:50:fa:fd:33:cd:00:= aa:99:13:50..." :issuer "C=3DUS,O=3DLet's Encrypt,CN=3DR3" :valid-from "202= 1-12-18" :valid-to "2022-03-18" :subject "CN=3Ddebbugs.gnu.org" :public-key= -algorithm "EC/ECDSA" :certificate-security-level "Ultra" :signature-algori= thm "RSA-SHA256" :public-key-id "sha1:cd:cf:69:4d:91:55:10:fd:cb:df:27:77:6= 2:ca:89:..." :certificate-id "sha1:58:b8:10:a2:8c:c2:56:e6:b5:da:9b:a2:34:4= 6:6e:..." :pem "-----BEGIN CERTIFICATE-----\nMIIEhjCCA26gAwIBAgISBH...") (:= version 3 :serial-number "00:91:2b:08:4a:cf:0c:18:a7:53:f6:d6:2e:25:a7:5f:5= a" :issuer "C=3DUS,O=3DInternet Security Research Group,CN=3DISRG Ro..." :v= alid-from "2020-09-04" :valid-to "2025-09-15" :subject "C=3DUS,O=3DLet's En= crypt,CN=3DR3" :public-key-algorithm "RSA" :certificate-security-level "Med= ium" :signature-algorithm "RSA-SHA256" :public-key-id "sha1:8a:93:82:f4:c8:= 04:08:34:5e:5b:c2:f8:d7:55:d3:..." :certificate-id "sha1:a0:53:37:5b:fe:84:= e8:b7:48:78:2c:7c:ee:15:82:..." :pem "-----BEGIN CERTIFICATE-----\nMIIFFjCC= Av6gAwIBAgIRAJ...") (:version 3 :serial-number "40:01:77:21:37:d4:e9:42:b8:= ee:76:aa:3c:64:0a:b7" :issuer "O=3DDigital Signature Trust Co.,CN=3DDST Roo= t CA X3" :valid-from "2021-01-20" :valid-to "2024-09-30" :subject "C=3DUS,O= =3DInternet Security Research Group,CN=3DISRG Ro..." :public-key-algorithm = "RSA" :certificate-security-level "High" :signature-algorithm "RSA-SHA256" = :public-key-id "sha1:f8:16:51:3c:fd:1b:44:9f:2e:6b:28:a1:97:22:1f:..." :cer= tificate-id "sha1:93:3c:6d:de:e9:5c:9c:41:a4:0f:9f:50:49:3d:82:..." :pem "-= ----BEGIN CERTIFICATE-----\nMIIFYDCCBEigAwIBAgIQQA...")) :certificate (:ver= sion 3 :serial-number "04:7e:f8:64:00:24:2b:50:fa:fd:33:cd:00:aa:99:13:50..= ." :issuer "C=3DUS,O=3DLet's Encrypt,CN=3DR3" :valid-from "2021-12-18" :val= id-to "2022-03-18" :subject "CN=3Ddebbugs.gnu.org" :public-key-algorithm "E= C/ECDSA" :certificate-security-level "Ultra" :signature-algorithm "RSA-SHA2= 56" :public-key-id "sha1:cd:cf:69:4d:91:55:10:fd:cb:df:27:77:62:ca:89:..." = :certificate-id "sha1:58:b8:10:a2:8c:c2:56:e6:b5:da:9b:a2:34:46:6e:..." :pe= m "-----BEGIN CERTIFICATE-----\nMIIEhjCCA26gAwIBAgISBH...") :key-exchange "= ECDHE-ECDSA" :protocol "TLS1.2" :cipher "AES-256-GCM" :mac "AEAD" :encrypt-= then-mac nil :safe-renegotiation t))) apply(#f(compiled-function (status) #) (:peer (:= certificates ((:version 3 :serial-number "04:7e:f8:64:00:24:2b:50:fa:fd:33:= cd:00:aa:99:13:50..." :issuer "C=3DUS,O=3DLet's Encrypt,CN=3DR3" :valid-fro= m "2021-12-18" :valid-to "2022-03-18" :subject "CN=3Ddebbugs.gnu.org" :publ= ic-key-algorithm "EC/ECDSA" :certificate-security-level "Ultra" :signature-= algorithm "RSA-SHA256" :public-key-id "sha1:cd:cf:69:4d:91:55:10:fd:cb:df:2= 7:77:62:ca:89:..." :certificate-id "sha1:58:b8:10:a2:8c:c2:56:e6:b5:da:9b:a= 2:34:46:6e:..." :pem "-----BEGIN CERTIFICATE-----\nMIIEhjCCA26gAwIBAgISBH..= .") (:version 3 :serial-number "00:91:2b:08:4a:cf:0c:18:a7:53:f6:d6:2e:25:a= 7:5f:5a" :issuer "C=3DUS,O=3DInternet Security Research Group,CN=3DISRG Ro.= .." :valid-from "2020-09-04" :valid-to "2025-09-15" :subject "C=3DUS,O=3DLe= t's Encrypt,CN=3DR3" :public-key-algorithm "RSA" :certificate-security-leve= l "Medium" :signature-algorithm "RSA-SHA256" :public-key-id "sha1:8a:93:82:= f4:c8:04:08:34:5e:5b:c2:f8:d7:55:d3:..." :certificate-id "sha1:a0:53:37:5b:= fe:84:e8:b7:48:78:2c:7c:ee:15:82:..." :pem "-----BEGIN CERTIFICATE-----\nMI= IFFjCCAv6gAwIBAgIRAJ...") (:version 3 :serial-number "40:01:77:21:37:d4:e9:= 42:b8:ee:76:aa:3c:64:0a:b7" :issuer "O=3DDigital Signature Trust Co.,CN=3DD= ST Root CA X3" :valid-from "2021-01-20" :valid-to "2024-09-30" :subject "C= =3DUS,O=3DInternet Security Research Group,CN=3DISRG Ro..." :public-key-alg= orithm "RSA" :certificate-security-level "High" :signature-algorithm "RSA-S= HA256" :public-key-id "sha1:f8:16:51:3c:fd:1b:44:9f:2e:6b:28:a1:97:22:1f:..= ." :certificate-id "sha1:93:3c:6d:de:e9:5c:9c:41:a4:0f:9f:50:49:3d:82:..." = :pem "-----BEGIN CERTIFICATE-----\nMIIFYDCCBEigAwIBAgIQQA...")) :certificat= e (:version 3 :serial-number "04:7e:f8:64:00:24:2b:50:fa:fd:33:cd:00:aa:99:= 13:50..." :issuer "C=3DUS,O=3DLet's Encrypt,CN=3DR3" :valid-from "2021-12-1= 8" :valid-to "2022-03-18" :subject "CN=3Ddebbugs.gnu.org" :public-key-algor= ithm "EC/ECDSA" :certificate-security-level "Ultra" :signature-algorithm "R= SA-SHA256" :public-key-id "sha1:cd:cf:69:4d:91:55:10:fd:cb:df:27:77:62:ca:8= 9:..." :certificate-id "sha1:58:b8:10:a2:8c:c2:56:e6:b5:da:9b:a2:34:46:6e:.= .." :pem "-----BEGIN CERTIFICATE-----\nMIIEhjCCA26gAwIBAgISBH...") :key-exc= hange "ECDHE-ECDSA" :protocol "TLS1.2" :cipher "AES-256-GCM" :mac "AEAD" :e= ncrypt-then-mac nil :safe-renegotiation t))) url-http-activate-callback() url-http-content-length-after-change-function(5637 5645 8) url-http-generic-filter(# " \345\26)\15\245\0\0") accept-process-output(#) debbugs-get-status(47766 10955 15247 15247 15247 14841 49959 25943 3303 2= 5943 16967 2401 49959 49959 950 25943 950 25511 950 21775 48413 25511 25943= 48413 45844 47244 16013 16967 17046 52677 29953 47244 47244 13594 37826 13= 594 17046 24091 24091 24091 32825 2199 24091 32825 2199 2199 37826) apply(debbugs-get-status (47766 10955 15247 15247 15247 14841 49959 25943= 3303 25943 16967 2401 49959 49959 950 25943 950 25511 950 21775 48413 2551= 1 25943 48413 45844 47244 16013 16967 17046 52677 29953 47244 47244 13594 3= 7826 13594 17046 24091 24091 24091 32825 2199 24091 32825 2199 2199 37826)) debbugs-gnu-show-reports() debbugs-gnu(nil ("emacs") nil) debbugs-gnu-search("invisible frame" nil nil ("emacs") nil) funcall-interactively(debbugs-gnu-search "invisible frame" nil nil ("emac= s") nil) call-interactively(debbugs-gnu-search record nil) command-execute(debbugs-gnu-search record) execute-extended-command(nil "debbugs-gnu-search" "debbugs-gnu-sear") funcall-interactively(execute-extended-command nil "debbugs-gnu-search" "= debbugs-gnu-sear") call-interactively(execute-extended-command nil nil) command-execute(execute-extended-command) #+end_quote In GNU Emacs 27.2 (build 1, aarch64-unknown-linux-gnu, GTK+ Version 3.24.27= , cairo version 1.17.4) of 2021-03-26 built on leming Windowing system distributor 'The X.Org Foundation', version 11.0.12101003 System Description: Manjaro ARM Recent messages: Quit Making completion list... Query bugs...done Get bug information...100%=20 Entering debugger... Checking new news... nnimap read 0k from imap.laposte.net Reading active file from archive via nnfolder...done Reading active file via nndraft...done Checking new news...done Configured using: 'configure --prefix=3D/usr --sysconfdir=3D/etc --libexecdir=3D/usr/lib --localstatedir=3D/var --with-x-toolkit=3Dgtk3 --with-xft --with-wide-int --with-modules --with-cairo --with-harfbuzz 'CFLAGS=3D-march=3Darmv8-a -O2 -pipe -fno-plt' CPPFLAGS=3D-D_FORTIFY_SOURCE=3D2 LDFLAGS=3D-Wl,-O1,--sort-common,--as-needed,-z,relro,-z,now' Configured features: XPM JPEG TIFF GIF PNG RSVG CAIRO SOUND GPM DBUS GSETTINGS GLIB NOTIFY INOTIFY ACL GNUTLS LIBXML2 FREETYPE HARFBUZZ M17N_FLT LIBOTF ZLIB TOOLKIT_SCROLL_BARS GTK3 X11 XDBE XIM MODULES THREADS LIBSYSTEMD JSON PDUMPER LCMS2 GMP Important settings: value of $LC_MONETARY: fr_FR.UTF-8 value of $LC_NUMERIC: fr_FR.UTF-8 value of $LC_TIME: fr_FR.UTF-8 value of $LANG: fr_FR.UTF-8 locale-coding-system: utf-8-unix Major mode: Summary Minor modes in effect: gnus-mailing-list-mode: t doom-modeline-mode: t display-time-mode: t leaf-key-override-global-mode: t straight-use-package-mode: t straight-package-neutering-mode: t global-eldoc-mode: t electric-indent-mode: t mouse-wheel-mode: t file-name-shadow-mode: t global-font-lock-mode: t font-lock-mode: t blink-cursor-mode: t auto-composition-mode: t auto-encryption-mode: t auto-compression-mode: t buffer-read-only: t line-number-mode: t transient-mark-mode: t Load-path shadows: /home/kevin/.emacs.d/straight/build/soap-client/soap-client hides /usr/shar= e/emacs/27.2/lisp/net/soap-client /home/kevin/.emacs.d/straight/build/soap-client/soap-inspect hides /usr/sha= re/emacs/27.2/lisp/net/soap-inspect Features: (shadow sort emacsbug sendmail help-fns radix-tree cl-print debug backtrace mm-archive url-cache crm debbugs-gnu add-log debbugs soap-client url-http url-auth url-gw warnings rng-xsd rng-dt rng-util xsd-regexp debbugs-autoloads soap-client-autoloads misearch multi-isearch vc-mtn vc-hg vc-git diff-mode vc-bzr vc-src vc-sccs vc-svn vc-cvs vc-rcs vc vc-dispatcher project org-element avl-tree generator ol-eww eww mm-url thingatpt url-queue ol-rmail ol-mhe ol-irc ol-info ol-gnus ol-docview doc-view jka-compr image-mode exif ol-bibtex bibtex ol-bbdb ol-w3m gnus-cite mail-extr nnir gnus-ml disp-table pp gnus-eform gnus-demon gnus-topic nndraft nnmh nnfolder utf-7 gnutls network-stream nsm gnus-agent gnus-srvr gnus-score score-mode nnvirtual gnus-msg gnus-art mm-uu mml2015 mm-view mml-smime smime dig nntp gnus-cache gnus-sum url url-proxy url-privacy url-expand url-methods url-history mailcap shr url-cookie url-domsuf url-util url-parse auth-source eieio eieio-core eieio-loaddefs json map url-vars svg xml dom browse-url gnus-group gnus-undo gnus-start gnus-cloud nnimap nnmail mail-source utf7 netrc nnoo parse-time iso8601 gnus-spec gnus-int gnus-range message rmc puny dired dired-loaddefs rfc822 mml mml-sec password-cache epa derived epg epg-config mm-decode mm-bodies mm-encode mail-parse rfc2231 mailabbrev gmm-utils mailheader gnus-win gnus nnheader gnus-util rmail rmail-loaddefs rfc2047 rfc2045 ietf-drums text-property-search mail-utils mm-util mail-prsvr face-remap vterm-autoloads edmacro kmacro doom-modeline doom-modeline-segments doom-modeline-env doom-modeline-core shrink-path rx f s dash doom-modeline-autoloads shrink-path-autoloads f-autoloads dash-autoloads s-autoloads all-the-icons all-the-icons-faces data-material data-weathericons data-octicons data-fileicons data-faicons data-alltheicons hydra-autoloads lv-autoloads time cus-edit cus-start cus-load wid-edit doom-solarized-dark-theme doom-themes doom-themes-base doom-themes-autoloads finder-inf leaf-keywords leaf org ob ob-tangle ob-ref ob-lob ob-table ob-exp org-macro org-footnote org-src ob-comint org-pcomplete pcomplete comint ansi-color ring org-list org-faces org-entities time-date noutline outline easy-mmode org-version ob-emacs-lisp ob-core ob-eval org-table ol org-keys org-compat advice org-macs org-loaddefs format-spec find-func cal-menu calendar cal-loaddefs all-the-icons-autoloads elpher-autoloads leaf-keywords-autoloads leaf-autoloads straight-autoloads info cl-seq cl-extra help-mode easymenu seq byte-opt straight subr-x cl-macs gv cl-loaddefs cl-lib bytecomp byte-compile cconv tooltip eldoc electric uniquify ediff-hook vc-hooks lisp-float-type mwheel term/x-win x-win term/common-win x-dnd tool-bar dnd fontset image regexp-opt fringe tabulated-list replace newcomment text-mode elisp-mode lisp-mode prog-mode register page tab-bar menu-bar rfn-eshadow isearch timer select scroll-bar mouse jit-lock font-lock syntax facemenu font-core term/tty-colors frame minibuffer cl-generic cham georgian utf-8-lang misc-lang vietnamese tibetan thai tai-viet lao korean japanese eucjp-ms cp51932 hebrew greek romanian slovak czech european ethiopic indian cyrillic chinese composite charscript charprop case-table epa-hook jka-cmpr-hook help simple abbrev obarray cl-preloaded nadvice loaddefs button faces cus-face macroexp files text-properties overlay sha1 md5 base64 format env code-pages mule custom widget hashtable-print-readable backquote threads dbusbind inotify lcms2 dynamic-setting system-font-setting font-render-setting cairo move-toolbar gtk x-toolkit x multi-tty make-network-process emacs) Memory information: ((conses 16 605558 47540) (symbols 48 30141 1) (strings 32 106055 14318) (string-bytes 1 3311045) (vectors 16 44619) (vector-slots 8 644938 27816) (floats 8 954 513) (intervals 56 3573 722) (buffers 1000 34)) ------------=_1643904242-23670-1--