From debbugs-submit-bounces@debbugs.gnu.org Fri Jun 26 14:45:09 2020 Received: (at submit) by debbugs.gnu.org; 26 Jun 2020 18:45:09 +0000 Received: from localhost ([127.0.0.1]:43036 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jotLZ-0003E5-4q for submit@debbugs.gnu.org; Fri, 26 Jun 2020 14:45:09 -0400 Received: from lists.gnu.org ([209.51.188.17]:40164) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jotLV-0003Dt-EN for submit@debbugs.gnu.org; Fri, 26 Jun 2020 14:45:07 -0400 Received: from eggs.gnu.org ([2001:470:142:3::10]:35548) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1jotLV-0001nA-4D for bug-gnu-emacs@gnu.org; Fri, 26 Jun 2020 14:45:05 -0400 Received: from wout3-smtp.messagingengine.com ([64.147.123.19]:42741) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1jotLS-0000p3-8l for bug-gnu-emacs@gnu.org; Fri, 26 Jun 2020 14:45:04 -0400 Received: from compute2.internal (compute2.nyi.internal [10.202.2.42]) by mailout.west.internal (Postfix) with ESMTP id 0A677C11 for ; Fri, 26 Jun 2020 14:44:58 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute2.internal (MEProxy); Fri, 26 Jun 2020 14:44:59 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=warpmail.net; h= from:to:subject:date:message-id:mime-version:content-type :content-transfer-encoding; s=fm3; bh=RfeNm5CKyiM/e4yARWYpw+mQTI gONY+vhtiwHvbOgrs=; b=YoLcBwR4v6VDsRYZYQrHKzbKLx/CigPJGQJyxk+44e 7Ju1iKb0AQAbx8vE/sEt8yDfRbmeKfFMHcqbvKBexopaOrQw6L0C8aBbaba5Zzpb epkvyQnxh4tT9qAI5rRppD3eQuOjilirciqQw4NF8BtfiPt4SfgZSQ4BuO8dHMKD boLFsM3fIUwCUrVf8AfCNUkWC829AsLTknvkMJfsUhLOyWP5J+GXH9ywyauMSV3H WV7ucUSqGTo1oaW0HOrxxd//je8UFejyjaD1fU8svSOIo8tMtDXfjRnQQP6J6uqH pwdSSrBoOIjpIDO2HoVtbgTaq8/Tetrs9CgYBZS/QRkg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:content-type :date:from:message-id:mime-version:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=RfeNm5 CKyiM/e4yARWYpw+mQTIgONY+vhtiwHvbOgrs=; b=UDEHBalgrKqgZjtXwPmOfG C5qGbopzIewrD4NX5IDPi9rmsR4LCfYqVdzeIi1D1j5UOlly8xIv0x+QigfKn/Nm tQuH6/oUmM98XVc7T992AkQhpD3/e45o48cqwDokzdu2rtyiAV6D346RQlmaq/SV cx6nPfTepcXxaGiuxK2Rw074a5+vivVNgMCnccNp4gogwLRaxYhrv8gsAE3ShSKj rLM3DpH+GfDaIU0czsIUAcYxOjV9IItXT4H8IbZ3zArPm0d26ln/LA5V84XO5M64 Qi1IUj7jJ/Y6E0wuyuTnC/7paERNiPnUgtgIRcLJsWzguugPBZ3Jc55pzFo7CsIg == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduhedrudeluddgudefvdcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfgh necuuegrihhlohhuthemuceftddtnecunecujfgurhephffvufffkfggtgfgsehtqhertd dttdejnecuhfhrohhmpedfrfhhihhlihhpucfmrddfuceophhhihhlihhpseifrghrphhm rghilhdrnhgvtheqnecuggftrfgrthhtvghrnheptdffkeffuddvuddugfdugeetgeeihf evjefhkeegleelfeegieehffetheeuhedtnecukfhppeekjedrudeghedrudehrdeluden ucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehphhhilh hiphesfigrrhhpmhgrihhlrdhnvght X-ME-Proxy: Received: from localhost (p57910f5b.dip0.t-ipconnect.de [87.145.15.91]) by mail.messagingengine.com (Postfix) with ESMTPA id C433D3280064 for ; Fri, 26 Jun 2020 14:44:57 -0400 (EDT) From: "Philip K." To: bug-gnu-emacs@gnu.org Subject: 28.0.50; German "Sharp S" is capitalized inconsistenly Date: Fri, 26 Jun 2020 20:44:55 +0200 Message-ID: <87pn9lu0ns.fsf@warpmail.net> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Received-SPF: pass client-ip=64.147.123.19; envelope-from=philip@warpmail.net; helo=wout3-smtp.messagingengine.com X-detected-operating-system: by eggs.gnu.org: First seen = 2020/06/26 14:44:59 X-ACL-Warn: Detected OS = Linux 2.2.x-3.x [generic] [fuzzy] X-Spam_score_int: -27 X-Spam_score: -2.8 X-Spam_bar: -- X-Spam_report: (-2.8 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, FREEMAIL_FROM=0.001, RCVD_IN_DNSWL_LOW=-0.7, RCVD_IN_MSPIKE_H3=-0.01, RCVD_IN_MSPIKE_WL=-0.01, SPF_HELO_PASS=-0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001 autolearn=_AUTOLEARN X-Spam_action: no action X-Spam-Score: 0.4 (/) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.6 (--) The german "Sharp S" (=C3=9F), seems to be capitalized inconsistenly, depending on the system: - The german postfix input method, typing "SZ" inserts "=E1=BA=9E" - If a buffer already contains a "=C3=9F", running upcase-dwim generates "SS". Lowercasing this results in "ss" unsurprisingly, while "=E1=BA=9E" generates "=C3=9F". Both behaviours are fine in their own right, but don't seem to make a lot of sense together. In GNU Emacs 28.0.50 (build 5, x86_64-pc-linux-gnu, GTK+ Version 3.24.5, ca= iro version 1.16.0) of 2020-06-24 built on bulbul Repository revision: 9bff3127d70a220e8b63aaf89dce2d5e9e66b0f6 Repository branch: master Windowing system distributor 'The X.Org Foundation', version 11.0.12004000 System Description: Debian GNU/Linux 10 (buster) Recent messages: Type C-c C-c to finish, or C-c C-k to cancel Saving file /home/phi/code/elisp/dumb-jump/.git/COMMIT_EDITMSG... Wrote /home/phi/code/elisp/dumb-jump/.git/COMMIT_EDITMSG Git finished Running git push -v origin master:refs/heads/master Quit Git finished Quit Mark set View mode: type C-h for help, h for commands, q to quit. Configured using: 'configure 'CFLAGS=3D-Wall -Wextra -Wformat -Wformat-security'' Configured features: XPM JPEG TIFF GIF PNG RSVG CAIRO SOUND GPM DBUS GSETTINGS GLIB NOTIFY INOTIFY ACL LIBSELINUX GNUTLS LIBXML2 FREETYPE HARFBUZZ M17N_FLT LIBOTF ZLIB TOOLKIT_SCROLL_BARS GTK3 X11 XDBE XIM MODULES THREADS LIBSYSTEMD PDUMPER LCMS2 GMP Important settings: value of $LANG: en_GB.UTF-8 locale-coding-system: utf-8-unix Major mode: Markdown Minor modes in effect: global-magit-file-mode: t magit-file-mode: t magit-auto-revert-mode: t auto-revert-mode: t global-git-commit-mode: t async-bytecomp-package-mode: t flyspell-mode: t TeX-PDF-mode: t shell-dirtrack-mode: t erc-list-mode: t erc-menu-mode: t erc-autojoin-mode: t erc-ring-mode: t erc-networks-mode: t erc-pcomplete-mode: t erc-track-mode: t erc-track-minor-mode: t erc-match-mode: t erc-button-mode: t erc-fill-mode: t erc-stamp-mode: t erc-netsplit-mode: t ivy-mode: t erc-irccontrols-mode: t erc-noncommands-mode: t erc-move-to-prompt-mode: t erc-readonly-mode: t display-time-mode: t electric-pair-mode: t recentf-mode: t save-place-mode: t savehist-mode: t show-paren-mode: t winner-mode: t tooltip-mode: t global-eldoc-mode: t eldoc-mode: t electric-indent-mode: t mouse-wheel-mode: t file-name-shadow-mode: t global-font-lock-mode: t font-lock-mode: t blink-cursor-mode: [## 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 = 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0] auto-composition-mode: t auto-encryption-mode: t auto-compression-mode: t line-number-mode: t auto-fill-function: do-auto-fill transient-mark-mode: t Load-path shadows: /home/phi/.emacs.d/elpa/swiper-0.13.0/swiper hides /home/phi/.emacs.d/elpa/= ivy-0.13.0/swiper Features: (shadow emacsbug markdown-mode geiser-mode geiser-xref geiser-compile geiser-debug geiser-gambit geiser-chibi geiser-mit geiser-chez geiser-chicken geiser-racket geiser-guile info-look geiser geiser-repl geiser-image geiser-company geiser-doc geiser-menu geiser-edit geiser-completion geiser-autodoc geiser-eval geiser-connection geiser-syntax geiser-log geiser-popup geiser-impl geiser-custom geiser-base scheme lisp-mnt timezone org-attach org-id calc-prog cal-china lunar solar cal-dst cal-bahai cal-islam cal-hebrew diary-lib diary-loaddefs cal-iso org-agenda org-duration org-clock debug backtrace flow-fill git-rebase man calc-cplx calc-math calc-frac calc-vec calcalg2 calc-comb calc-poly calccomp calc-arith calc-misc calc-aent slime-cl-indent cl-indent slime-hyperdoc slime-asdf grep slime-quicklisp slime-fancy slime-trace-dialog slime-fontifying-fu slime-package-fu slime-references slime-compiler-notes-tree slime-scratch slime-presentations bridge slime-macrostep slime-mdot-fu slime-enclosing-context slime-fuzzy slime-fancy-trace slime-fancy-inspector slime-c-p-c slime-editing-commands slime-autodoc slime-repl slime-parse rmailsum tabify whitespace magit-extras magit-bookmark magit-submodule magit-obsolete magit-blame magit-stash magit-bisect magit-push magit-pull magit-fetch magit-clone magit-remote magit-commit magit-sequence magit-notes magit-worktree magit-tag magit-merge magit-branch magit-reset magit-collab ghub-graphql treepy gsexp ghub url-http url-gw url-auth let-alist magit-files magit-refs magit-status magit magit-repos magit-apply magit-wip magit-log which-func magit-diff magit-core magit-autorevert autorevert filenotify magit-process magit-margin magit-mode git-commit magit-git magit-section log-edit with-editor async-bytecomp async server calc-alg calc-ext calc-menu calc calc-loaddefs calc-macs artist picture reporter rect reposition rng-xsd xsd-regexp rng-cmpct rng-nxml rng-valid nxml-mode nxml-outln nxml-rap ox-odt rng-loc rng-uri rng-parse rng-match rng-dt rng-util rng-pttrn nxml-parse nxml-ns nxml-enc xmltok nxml-util ox-latex ox-icalendar ox-html table ox-ascii ox-publish ox cdlatex misc find-dired smerge-mode diff add-log log-view pcvs-util cl-print help-at-pt ibuf-ext ibuffer ibuffer-loaddefs pulse bug-reference flyspell vc-mtn vc-src vc-sccs vc-svn vc-cvs vc-rcs vc vc-dispatcher quail ispell em-unix em-term term ehelp em-script em-prompt em-ls em-hist em-pred em-glob em-dirs esh-var em-cmpl em-basic em-banner em-alias esh-mode eshell esh-cmd esh-ext esh-opt esh-proc esh-io esh-arg esh-module esh-groups esh-util tramp-cmds vc-hg vc-bzr mhtml-mode css-mode smie eww mm-url js imenu sgml-mode wdired magit-utils magit-popup dash tramp-cache elfeed-link latexenc eieio-opt speedbar ezimage dframe help-fns radix-tree two-column iso-transl pdf-view pdf-cache pdf-info tq pdf-util tar-mode dired-aux rmailmm mm-archive sort smiley gnus-cite mail-extr gnus-async gnus-bcklg qp gnus-ml disp-table windmove nndraft nnmh gnus-agent gnus-srvr gnus-score score-mode nnvirtual gnus-msg gnus-art mm-uu mml2015 mm-view mml-smime smime dig nntp gnus-cache bang macrostep-c cmacexp macrostep nroff-mode slime arc-mode archive-mode hyperspec cc-awk cc-mode cc-fonts cc-guess cc-menus cc-cmds cc-styles cc-align cc-engine cc-vars cc-defs preview prv-emacs tex-buf font-latex texmathp latex latex-flymake flymake-proc flymake warnings tex-ispell tex-style tex dbus crm tex-mode org-element ol-eww ol-rmail ol-mhe ol-irc ol-info ol-gnus nnir gnus-sum gnus-group gnus-undo gnus-start gnus-cloud nnimap nnmail mail-source utf7 netrc nnoo gnus-spec gnus-int gnus-range gnus-win ol-docview doc-view jka-compr image-mode exif ol-bibtex bibtex ol-bbdb ol-w3m org ob ob-tangle ob-ref ob-lob ob-table ob-exp org-macro org-footnote org-src ob-comint org-pcomplete org-list org-faces org-entities noutline outline org-version ob-emacs-lisp ob-core ob-eval org-table ol org-keys org-compat advice org-macs org-loaddefs find-func goto-addr view avy hl-line elfeed-show elfeed-search message rfc822 mml mml-sec mm-decode mm-bodies mm-encode mail-parse rfc2231 mailabbrev gmm-utils mailheader shr svg dom elfeed-csv elfeed elfeed-curl url url-proxy url-privacy url-expand url-methods url-history url-cookie url-domsuf mailcap elfeed-log elfeed-db elfeed-lib url-util avl-tree url-queue xml-query xml misearch multi-isearch mule-util time-stamp ffap etags fileloop generator xref project char-fold swiper vc-fossil python tramp-sh tramp tramp-loaddefs trampver tramp-integration files-x tramp-compat shell parse-time iso8601 ls-lisp bookmark vc-git diff-mode easy-mmode gnutls network-stream puny nsm rmc erc-list erc-menu erc-join erc-ring erc-networks erc-pcomplete pcomplete erc-track erc-match erc-button erc-fill erc-stamp erc-netsplit epa-file epa derived epg epg-config auth-source-pass cl-extra help-mode paredit init ivy delsel colir color ivy-overlay edmacro kmacro rx pcase dired-x dired dired-loaddefs holidays hol-loaddefs cal-menu calendar cal-loaddefs erc-goodies erc thingatpt pp erc-loaddefs erc-backend erc-compat format-spec gnus nnheader gnus-util text-property-search time-date time sendmail rmail rmail-loaddefs rfc2047 rfc2045 ietf-drums mm-util mail-prsvr mail-utils compile hippie-exp comint ansi-color elec-pair recentf tree-widget saveplace savehist paren winner ring cus-edit cus-start cus-load wid-edit finder-inf tex-site slime-autoloads info package easymenu browse-url url-handlers url-parse auth-source cl-seq eieio eieio-core cl-macs eieio-loaddefs password-cache json subr-x map url-vars seq byte-opt gv bytecomp byte-compile cconv cl-loaddefs cl-lib tooltip eldoc electric uniquify ediff-hook vc-hooks lisp-float-type mwheel term/x-win x-win term/common-win x-dnd tool-bar dnd fontset image regexp-opt fringe tabulated-list replace newcomment text-mode elisp-mode lisp-mode prog-mode register page tab-bar menu-bar rfn-eshadow isearch timer select scroll-bar mouse jit-lock font-lock syntax facemenu font-core term/tty-colors frame minibuffer cl-generic cham georgian utf-8-lang misc-lang vietnamese tibetan thai tai-viet lao korean japanese eucjp-ms cp51932 hebrew greek romanian slovak czech european ethiopic indian cyrillic chinese composite charscript charprop case-table epa-hook jka-cmpr-hook help simple abbrev obarray cl-preloaded nadvice loaddefs button faces cus-face macroexp files text-properties overlay sha1 md5 base64 format env code-pages mule custom widget hashtable-print-readable backquote threads dbusbind inotify lcms2 dynamic-setting system-font-setting font-render-setting cairo move-toolbar gtk x-toolkit x multi-tty make-network-process emacs) Memory information: ((conses 16 1004119 173255) (symbols 48 78455 1) (strings 32 340391 34833) (string-bytes 1 11933058) (vectors 16 123417) (vector-slots 8 2642525 213470) (floats 8 3839 1827) (intervals 56 37213 1474) (buffers 992 144)) --=20 Philip K. From debbugs-submit-bounces@debbugs.gnu.org Fri Jun 26 14:55:27 2020 Received: (at 42064) by debbugs.gnu.org; 26 Jun 2020 18:55:27 +0000 Received: from localhost ([127.0.0.1]:43041 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jotVX-0003T8-FB for submit@debbugs.gnu.org; Fri, 26 Jun 2020 14:55:27 -0400 Received: from eggs.gnu.org ([209.51.188.92]:51390) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jotVT-0003Rw-GY for 42064@debbugs.gnu.org; Fri, 26 Jun 2020 14:55:25 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:44295) by eggs.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1jotVO-0007k9-3g; Fri, 26 Jun 2020 14:55:18 -0400 Received: from [176.228.60.248] (port=3603 helo=home-c4e4a596f7) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1jotVM-0008Eh-IL; Fri, 26 Jun 2020 14:55:17 -0400 Date: Fri, 26 Jun 2020 21:55:00 +0300 Message-Id: <83zh8pr723.fsf@gnu.org> From: Eli Zaretskii To: "Philip K." In-Reply-To: <87pn9lu0ns.fsf@warpmail.net> (philip@warpmail.net) Subject: Re: bug#42064: 28.0.50; German "Sharp S" is capitalized inconsistenly References: <87pn9lu0ns.fsf@warpmail.net> MIME-version: 1.0 Content-type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 42064 Cc: 42064@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > From: "Philip K." > Date: Fri, 26 Jun 2020 20:44:55 +0200 > > The german "Sharp S" (ß), seems to be capitalized inconsistenly, > depending on the system: > > - The german postfix input method, typing "SZ" inserts "ẞ" > - If a buffer already contains a "ß", running upcase-dwim generates > "SS". Lowercasing this results in "ss" unsurprisingly, while "ẞ" > generates "ß". > > Both behaviours are fine in their own right, but don't seem to make a > lot of sense together. Do you have a proposal for how to improve this? The problem, AFAIU, is that there are different preference, each one of which is legitimate, so the only way forward, it seems, is to introduce some user options to select the desired behavior. From debbugs-submit-bounces@debbugs.gnu.org Fri Jun 26 15:09:09 2020 Received: (at 42064) by debbugs.gnu.org; 26 Jun 2020 19:09:09 +0000 Received: from localhost ([127.0.0.1]:43047 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jotim-0003me-N8 for submit@debbugs.gnu.org; Fri, 26 Jun 2020 15:09:08 -0400 Received: from wout3-smtp.messagingengine.com ([64.147.123.19]:38735) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jotij-0003m9-6l for 42064@debbugs.gnu.org; Fri, 26 Jun 2020 15:09:07 -0400 Received: from compute2.internal (compute2.nyi.internal [10.202.2.42]) by mailout.west.internal (Postfix) with ESMTP id 74B05CA6; Fri, 26 Jun 2020 15:08:59 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute2.internal (MEProxy); Fri, 26 Jun 2020 15:08:59 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=warpmail.net; h= from:to:cc:subject:in-reply-to:date:message-id:mime-version :content-type:content-transfer-encoding; s=fm3; bh=GT/Z0kHYeDUoC gmrHA0HxSHgbSTrQDL84V7L67UfobQ=; b=WHmW+cjylOrItm4jc6NpBNpoRvMTK fV90PBwkFs4EPDOGXiUOi37FOmL1FUzip827GrY/ey62JFy6hNF+yVCtuitUl7Na B6wYOO2MNAN8tMpIHwOu3Gi8Ss35qRzms3lk2GPino03znzspomFi1LdcT6B15kh r527yV1lVtSNOZO/UegnX+MA8FbMRjPKolP2WXbZzuX8a8iKKo4zUc0DcJTO2VBg 31QzClL1qJ0WwG1tRdFBu+8yH9cNig/HK6iqIxo6l7A6BZTdxhFccTwEMwUY5hDX zcDZlT2Txd3oU1xderUMjxtByhZJob8QSF3NaAcqHb8gktxaPe6qHGvgg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-transfer-encoding:content-type :date:from:in-reply-to:message-id:mime-version:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm3; bh=GT/Z0kHYeDUoCgmrHA0HxSHgbSTrQDL84V7L67UfobQ=; b=mITPT59E IKuSm3gpnCXXC85KYVQnNzgPNzk/0XJo0wIom4Z2cNvW+SjcCMdUQ6PgaoYs2EKO ia50/7xP9y/ourjo0fo/kcjzzF4yD4zQf8x54q9oy745iHkEENXVmm0taIoW+9FD OEBsXwUIUtaSUzDmRjTP0nAbzg9SbnwTSQqN56FCF4HoSFSMiOcKxWqIiidn+x8b kz23/qw/LJI4qa9SdqKT1/qXktsLFxHHwPxtxJYBi5amqcUwNjlr9ne/97vmSpdy 1sK4rzPUqF9yzL4t0askXmxI1dcQKzGD/MflvdGaV1Ob86kB2QpAVFZMjlW3osum CS/8CI39Y4hwbQ== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduhedrudeluddgudefiecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfgh necuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmd enucfjughrpefhvffujgffkfggtgfgsehtqhertddttdejnecuhfhrohhmpedfrfhhihhl ihhpucfmrddfuceophhhihhlihhpseifrghrphhmrghilhdrnhgvtheqnecuggftrfgrth htvghrnheptdejgfffhfefvedtffehieduheduudehheduueegjeejueehgfetgeduvdei jeetnecuffhomhgrihhnpeifihhkihhpvgguihgrrdhorhhgnecukfhppeekjedrudeghe drudehrdeludenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhr ohhmpehphhhilhhiphesfigrrhhpmhgrihhlrdhnvght X-ME-Proxy: Received: from localhost (p57910f5b.dip0.t-ipconnect.de [87.145.15.91]) by mail.messagingengine.com (Postfix) with ESMTPA id 73B733067939; Fri, 26 Jun 2020 15:08:58 -0400 (EDT) From: "Philip K." To: Eli Zaretskii Subject: Re: bug#42064: 28.0.50; German "Sharp S" is capitalized inconsistenly In-Reply-To: <83zh8pr723.fsf@gnu.org> (message from Eli Zaretskii on Fri, 26 Jun 2020 21:55:00 +0300) Date: Fri, 26 Jun 2020 21:08:55 +0200 Message-ID: <87mu4ptzjs.fsf@warpmail.net> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 42064 Cc: 42064@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Eli Zaretskii writes: >> From: "Philip K." >> Date: Fri, 26 Jun 2020 20:44:55 +0200 >>=20 >> The german "Sharp S" (=C3=9F), seems to be capitalized inconsistenly, >> depending on the system: >>=20 >> - The german postfix input method, typing "SZ" inserts "=E1=BA=9E" >> - If a buffer already contains a "=C3=9F", running upcase-dwim generates >> "SS". Lowercasing this results in "ss" unsurprisingly, while "=E1=BA= =9E" >> generates "=C3=9F". >>=20 >> Both behaviours are fine in their own right, but don't seem to make a >> lot of sense together. > > Do you have a proposal for how to improve this? The problem, AFAIU, > is that there are different preference, each one of which is > legitimate, so the only way forward, it seems, is to introduce some > user options to select the desired behavior. First off, I'm not a german native speaker, so there might be things I don't know of. Otherwise, I think a user option would be a good idea. If it turns out to not be practical, for whatever reason, I would instead say that (upcase "=C3=9F") should evaluate to "=E1=BA=9E", as it appears to= the "more correct" of the two options ("ss" or "SS" is usually written when the "=C3=9F" cannot be used), at least according to some[0]: > In 2016, the Council for German Orthography proposed the introduction > of optional use of =E1=BA=9E in its ruleset (i.e. variants STRASSE vs. ST= RA=E1=BA=9EE > would be accepted as equally valid).[19] The rule was officially > adopted in 2017.[20] [0] https://en.wikipedia.org/wiki/%C3%9F#Capital_form --=20 Philip K. From debbugs-submit-bounces@debbugs.gnu.org Fri Jun 26 15:36:27 2020 Received: (at 42064) by debbugs.gnu.org; 26 Jun 2020 19:36:27 +0000 Received: from localhost ([127.0.0.1]:43099 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jou9D-0004Rr-En for submit@debbugs.gnu.org; Fri, 26 Jun 2020 15:36:27 -0400 Received: from eggs.gnu.org ([209.51.188.92]:32794) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jou9A-0004Rd-4E for 42064@debbugs.gnu.org; Fri, 26 Jun 2020 15:36:25 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:44767) by eggs.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1jou94-0006lv-QB; Fri, 26 Jun 2020 15:36:18 -0400 Received: from [176.228.60.248] (port=2149 helo=home-c4e4a596f7) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1jou94-00051I-4p; Fri, 26 Jun 2020 15:36:18 -0400 Date: Fri, 26 Jun 2020 22:36:02 +0300 Message-Id: <83y2o9r55p.fsf@gnu.org> From: Eli Zaretskii To: "Philip K." In-Reply-To: <87mu4ptzjs.fsf@warpmail.net> (philip@warpmail.net) Subject: Re: bug#42064: 28.0.50; German "Sharp S" is capitalized inconsistenly References: <87mu4ptzjs.fsf@warpmail.net> MIME-version: 1.0 Content-type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 42064 Cc: 42064@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) > From: "Philip K." > Cc: 42064@debbugs.gnu.org > Date: Fri, 26 Jun 2020 21:08:55 +0200 > > > In 2016, the Council for German Orthography proposed the introduction > > of optional use of ẞ in its ruleset (i.e. variants STRASSE vs. STRAẞE > > would be accepted as equally valid).[19] The rule was officially > > adopted in 2017.[20] > > [0] https://en.wikipedia.org/wiki/%C3%9F#Capital_form I know, but German input methods are not only for Germany, and AFAIR other German-speaking countries didn't follow suit. From debbugs-submit-bounces@debbugs.gnu.org Sat Oct 17 21:39:55 2020 Received: (at 42064) by debbugs.gnu.org; 18 Oct 2020 01:39:55 +0000 Received: from localhost ([127.0.0.1]:35897 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1kTxfv-0000j7-IJ for submit@debbugs.gnu.org; Sat, 17 Oct 2020 21:39:55 -0400 Received: from mail-ej1-f42.google.com ([209.85.218.42]:45488) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1kTxft-0000if-5e for 42064@debbugs.gnu.org; Sat, 17 Oct 2020 21:39:53 -0400 Received: by mail-ej1-f42.google.com with SMTP id dt13so8963503ejb.12 for <42064@debbugs.gnu.org>; Sat, 17 Oct 2020 18:39:53 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:in-reply-to:references:user-agent :mime-version:date:message-id:subject:to:cc :content-transfer-encoding; bh=o4F9Dwc2/D9wpIdm4x9YYvhcoLGF8JqsEJD/SJWaVww=; b=JG2FTAJj6N0GAlAoey2OhBFJZxcN6+Bbr1cxulUVFbexiOkmKse1r5EWe8OTGiS4n8 TF3TyrYFYT6BlYenT2xoGeAXeGWOmNcBiOgK5HhS6Hze9Kew/edhCPQUL9zZXRuR/iQY LuN09JGNjwZE6Y86lXFTpJtAZDC0U9o/Sl9LDMQlN3HuGTpz+HtEAl4MOwHgYcGt7Low 6+RYkmQ35f8gGJx0cwRNbRRR03/LDmpBtrpCrlu3ZFLG/7lqVIcFsiYMAHyDHW98vG2d EdLGu/JmWIJc1cpn2mJhGLoLekXBNmPhqYqXEBwO1BduIKkxYVvTOxEyDhzMVrWC6urS v+JQ== X-Gm-Message-State: AOAM531zjggqsAjLvAHx1JNmlpgZQl5Jh0tBj27BQ57+RgZPgx54j/GI 5cH/GbZHjnD5SacR47nGZB88oW9wXO4x/B2G6kc= X-Google-Smtp-Source: ABdhPJzLaF0mr/7OHxQGqzXITyRVA2ro4Nn7CUVrOxK+BR2qDwpLVc4bTn/YREgiRDprc1QnY8FxGYJgDg5vKt+SfTY= X-Received: by 2002:a17:906:1246:: with SMTP id u6mr10710972eja.432.1602985187374; Sat, 17 Oct 2020 18:39:47 -0700 (PDT) Received: from 753933720722 named unknown by gmailapi.google.com with HTTPREST; Sun, 18 Oct 2020 01:39:46 +0000 From: Stefan Kangas In-Reply-To: <83y2o9r55p.fsf@gnu.org> (Eli Zaretskii's message of "Fri, 26 Jun 2020 22:36:02 +0300") References: <87mu4ptzjs.fsf@warpmail.net> <83y2o9r55p.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/28.0.50 (gnu/linux) MIME-Version: 1.0 Date: Sun, 18 Oct 2020 01:39:46 +0000 Message-ID: Subject: Re: bug#42064: 28.0.50; German "Sharp S" is capitalized inconsistenly To: Eli Zaretskii Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Spam-Score: 0.5 (/) X-Debbugs-Envelope-To: 42064 Cc: "Philip K." , 42064@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.5 (/) Eli Zaretskii writes: >> From: "Philip K." >> Cc: 42064@debbugs.gnu.org >> Date: Fri, 26 Jun 2020 21:08:55 +0200 >> >> > In 2016, the Council for German Orthography proposed the introduction >> > of optional use of =E1=BA=9E in its ruleset (i.e. variants STRASSE vs.= STRA=E1=BA=9EE >> > would be accepted as equally valid).[19] The rule was officially >> > adopted in 2017.[20] >> >> [0] https://en.wikipedia.org/wiki/%C3%9F#Capital_form > > I know, but German input methods are not only for Germany, and AFAIR > other German-speaking countries didn't follow suit. So it sounds like this is something we can't do much about, at the very least not without help from a German language expert (presumably one familiar with German as written in Germany, Switzerland and Austria). Does that mean that this is a wontfix? From debbugs-submit-bounces@debbugs.gnu.org Sun Oct 18 23:42:53 2020 Received: (at 42064) by debbugs.gnu.org; 19 Oct 2020 03:42:53 +0000 Received: from localhost ([127.0.0.1]:39528 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1kUM4T-0001xX-Ep for submit@debbugs.gnu.org; Sun, 18 Oct 2020 23:42:53 -0400 Received: from eggs.gnu.org ([209.51.188.92]:34036) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1kUM4R-0001xI-NE for 42064@debbugs.gnu.org; Sun, 18 Oct 2020 23:42:52 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:54371) by eggs.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1kUM4L-0004sB-Q3; Sun, 18 Oct 2020 23:42:45 -0400 Received: from rms by fencepost.gnu.org with local (Exim 4.82) (envelope-from ) id 1kUM4K-0004QT-7B; Sun, 18 Oct 2020 23:42:44 -0400 Content-Type: text/plain; charset=Utf-8 From: Richard Stallman To: Stefan Kangas In-Reply-To: (message from Stefan Kangas on Sun, 18 Oct 2020 01:39:46 +0000) Subject: Re: bug#42064: 28.0.50; German "Sharp S" is capitalized inconsistenly References: <87mu4ptzjs.fsf@warpmail.net> <83y2o9r55p.fsf@gnu.org> Message-Id: Date: Sun, 18 Oct 2020 23:42:44 -0400 X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 42064 Cc: eliz@gnu.org, philip@warpmail.net, 42064@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: rms@gnu.org Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) [[[ To any NSA and FBI agents reading my email: please consider ]]] [[[ whether defending the US Constitution against all enemies, ]]] [[[ foreign or domestic, requires you to follow Snowden's example. ]]] > So it sounds like this is something we can't do much about, at the very > least not without help from a German language expert (presumably one > familiar with German as written in Germany, Switzerland and Austria). I know free software supporters in Switzerland and Austria. Would you like me to put you in touch? -- Dr Richard Stallman Chief GNUisance of the GNU Project (https://gnu.org) Founder, Free Software Foundation (https://fsf.org) Internet Hall-of-Famer (https://internethalloffame.org) From debbugs-submit-bounces@debbugs.gnu.org Mon Oct 19 02:32:00 2020 Received: (at 42064) by debbugs.gnu.org; 19 Oct 2020 06:32:00 +0000 Received: from localhost ([127.0.0.1]:39696 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1kUOi8-00008N-FY for submit@debbugs.gnu.org; Mon, 19 Oct 2020 02:32:00 -0400 Received: from mout02.posteo.de ([185.67.36.66]:51829) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1kUOi6-000089-Rh for 42064@debbugs.gnu.org; Mon, 19 Oct 2020 02:31:59 -0400 Received: from submission (posteo.de [89.146.220.130]) by mout02.posteo.de (Postfix) with ESMTPS id 903AE2400FF for <42064@debbugs.gnu.org>; Mon, 19 Oct 2020 08:31:52 +0200 (CEST) Received: from customer (localhost [127.0.0.1]) by submission (posteo.de) with ESMTPSA id 4CF6Nl3JBnz6tnY; Mon, 19 Oct 2020 08:31:51 +0200 (CEST) Date: Mon, 19 Oct 2020 08:31:45 +0200 (CEST) Message-Id: <20201019.083145.1926465227104280220.wl@gnu.org> To: stefan@marxist.se Subject: Re: bug#42064: 28.0.50; German "Sharp S" is capitalized inconsistenly From: Werner LEMBERG In-Reply-To: References: <87mu4ptzjs.fsf@warpmail.net> <83y2o9r55p.fsf@gnu.org> X-Mailer: Mew version 6.8 on Emacs 28.0.50 / Mule 6.0 (HANACHIRUSATO) Mime-Version: 1.0 Content-Type: Text/Plain; charset=utf-8 Content-Transfer-Encoding: base64 X-Spam-Score: -2.1 (--) X-Debbugs-Envelope-To: 42064 Cc: eliz@gnu.org, philip@warpmail.net, 42064@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.1 (---) DQo+Pj4gPiBJbiAyMDE2LCB0aGUgQ291bmNpbCBmb3IgR2VybWFuIE9ydGhvZ3JhcGh5IHByb3Bv c2VkIHRoZQ0KPj4+ID4gaW50cm9kdWN0aW9uIG9mIG9wdGlvbmFsIHVzZSBvZiDhup4gaW4gaXRz IHJ1bGVzZXQgKGkuZS4gdmFyaWFudHMNCj4+PiA+IFNUUkFTU0UgdnMuIFNUUkHhup5FIHdvdWxk IGJlIGFjY2VwdGVkIGFzIGVxdWFsbHkgdmFsaWQpLlsxOV0gVGhlDQo+Pj4gPiBydWxlIHdhcyBv ZmZpY2lhbGx5IGFkb3B0ZWQgaW4gMjAxNy5bMjBdDQo+Pj4NCj4+PiBbMF0gaHR0cHM6Ly9lbi53 aWtpcGVkaWEub3JnL3dpa2kvJUMzJTlGI0NhcGl0YWxfZm9ybQ0KPj4NCj4+IEkga25vdywgYnV0 IEdlcm1hbiBpbnB1dCBtZXRob2RzIGFyZSBub3Qgb25seSBmb3IgR2VybWFueSwgYW5kDQo+PiBB RkFJUiBvdGhlciBHZXJtYW4tc3BlYWtpbmcgY291bnRyaWVzIGRpZG4ndCBmb2xsb3cgc3VpdC4N Cj4gDQo+IFNvIGl0IHNvdW5kcyBsaWtlIHRoaXMgaXMgc29tZXRoaW5nIHdlIGNhbid0IGRvIG11 Y2ggYWJvdXQsIGF0IHRoZQ0KPiB2ZXJ5IGxlYXN0IG5vdCB3aXRob3V0IGhlbHAgZnJvbSBhIEdl cm1hbiBsYW5ndWFnZSBleHBlcnQNCj4gKHByZXN1bWFibHkgb25lIGZhbWlsaWFyIHdpdGggR2Vy bWFuIGFzIHdyaXR0ZW4gaW4gR2VybWFueSwNCj4gU3dpdHplcmxhbmQgYW5kIEF1c3RyaWEpLg0K DQpBRkFJQ1MsIHRoZSBiZWhhdmlvdXIgb2YgdGhlIEdlcm1hbiBwb3N0Zml4IGlucHV0IG1ldGhv ZCBpcyBmdWxseQ0KY29ycmVjdC4gIFRoZSBkZWZhdWx0IGxvd2VyY2FzZS91cHBlcmNhc2UgcGFp cmluZyBpcyAnw58vU1MnLiAn4bqeJw0Kc2hvdWxkIG5vdCBiZSBhIHRhcmdldCBvZiAndXBwZXJj YXNlLWZpY2F0aW9uJzsgaXRzIHVzZSBpcyB2ZXJ5DQpzcGVjaWFsLlsqXQ0KDQo+IERvZXMgdGhh dCBtZWFuIHRoYXQgdGhpcyBpcyBhIHdvbnRmaXg/DQoNCkkgc3VnZ2VzdCBzby4NCg0KDQogICAg V2VybmVyDQoNCg0KWypdIE1haW5seSBhIHNvbHV0aW9uIHRvIGluZGljYXRlICfDnycgaW4gbmFt ZXMgdGhhdCBoYXZlIHRvIGJlIHdyaXR0ZW4NCiAgICBpbiB1cHBlcmNhc2UgbGV0dGVycy4gIENv bnNpZGVyIHRoZSBuYW1lcyAnU3RyYXVzcycgYW5kICdTdHJhdcOfJywNCiAgICB3aGljaCBib3Ro IG9jY3VyIGluIEdlcm1hbiBhbmQgaGF2ZSB0byBiZSBkaXN0aW5ndWlzaGVkIGluDQogICAgcGFz c3BvcnRzLCB3aGVyZSBmYW1pbHkgbmFtZXMgYXJlIHRvIGJlIHdyaXR0ZW4gaW4gdXBwZXJjYXNl Og0KICAgICdTVFJBVVNTJyBhbmQgJ1NUUkFV4bqeJy4gIEhvd2V2ZXIsIGluIGV2ZXJ5IG90aGVy IGNvbnRleHQsIHRoZXkNCiAgICBzaG91bGQgYmUgYm90aCB1cHBlcmNhc2VkIGFzICdTVFJBVVNT Jy4NCg== From debbugs-submit-bounces@debbugs.gnu.org Mon Oct 19 04:57:36 2020 Received: (at 42064) by debbugs.gnu.org; 19 Oct 2020 08:57:36 +0000 Received: from localhost ([127.0.0.1]:39972 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1kUQz2-0006Io-Ix for submit@debbugs.gnu.org; Mon, 19 Oct 2020 04:57:36 -0400 Received: from mail-ej1-f44.google.com ([209.85.218.44]:36466) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1kUQyx-0006ID-I7 for 42064@debbugs.gnu.org; Mon, 19 Oct 2020 04:57:31 -0400 Received: by mail-ej1-f44.google.com with SMTP id qp15so12795239ejb.3 for <42064@debbugs.gnu.org>; Mon, 19 Oct 2020 01:57:31 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:in-reply-to:references:mime-version:date :message-id:subject:to:cc; bh=P+OPSKIIcfdJMXio1WMjI47EAcxcqgGuS5bX367vxRI=; b=Bvu+Bx0CZWdMm39oyWL7rblIRXXcMSDfRD6pKRzBIk6mJIkSaT/SxuN+E0aKW/oWG3 HeDLVzFQhB6b3r2XeP0g9SBzauerrUxY5SRLTbDgCfsA0Z99sWM3wFsRK1+UaPAZnqJM HU0JG/jmNiyoRdMM1mBcv0pzyezvXPwUcA25t+9t6msljOA4m9TnAx+HgyKqjR7jBoPK awJFg//TcGjnoNL2CFbQrnfwYwWNcandhG4YJLddGUqdEBTK6yvbgLCm2C+n9tRKfgrj fzm1pYhbwWme81dmttPVvrbkN6RTSJ4P8QRw4c4QPJo4pVISgxq9QAAemqbKlG36+hPb g44Q== X-Gm-Message-State: AOAM5314PlxJWZ9MrIeO/6nMNXtLmdePTFNlJnTO6YszxaBiiC+hOTVz 4+5xmiSwVljgFJz+evBsvdnXctr6iWfPqSnTt4Y= X-Google-Smtp-Source: ABdhPJztv99u9AwF8sLwClHWBnso6lEqfw9Hkd8kc5nBtfdzGAh5nBdEYddVXlAawYe7j+HE91dsGkySzTDmts+g9sU= X-Received: by 2002:a17:906:bc91:: with SMTP id lv17mr16746299ejb.249.1603097845799; Mon, 19 Oct 2020 01:57:25 -0700 (PDT) Received: from 753933720722 named unknown by gmailapi.google.com with HTTPREST; Mon, 19 Oct 2020 08:57:25 +0000 From: Stefan Kangas In-Reply-To: References: <87mu4ptzjs.fsf@warpmail.net> <83y2o9r55p.fsf@gnu.org> MIME-Version: 1.0 Date: Mon, 19 Oct 2020 08:57:25 +0000 Message-ID: Subject: Re: bug#42064: 28.0.50; German "Sharp S" is capitalized inconsistenly To: rms@gnu.org Content-Type: text/plain; charset="UTF-8" X-Spam-Score: 0.5 (/) X-Debbugs-Envelope-To: 42064 Cc: eliz@gnu.org, philip@warpmail.net, 42064@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.5 (/) Richard Stallman writes: > > So it sounds like this is something we can't do much about, at the very > > least not without help from a German language expert (presumably one > > familiar with German as written in Germany, Switzerland and Austria). > > I know free software supporters in Switzerland and Austria. > Would you like me to put you in touch? Thanks for offering to find help. Werner Lemberg commented and explained that the current behavior is correct. So I've now closed this bug. From debbugs-submit-bounces@debbugs.gnu.org Mon Oct 19 04:57:39 2020 Received: (at 42064) by debbugs.gnu.org; 19 Oct 2020 08:57:39 +0000 Received: from localhost ([127.0.0.1]:39976 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1kUQz4-0006J8-S0 for submit@debbugs.gnu.org; Mon, 19 Oct 2020 04:57:39 -0400 Received: from mail-ej1-f49.google.com ([209.85.218.49]:35317) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1kUQz3-0006Ia-G3 for 42064@debbugs.gnu.org; Mon, 19 Oct 2020 04:57:37 -0400 Received: by mail-ej1-f49.google.com with SMTP id p5so12812798ejj.2 for <42064@debbugs.gnu.org>; Mon, 19 Oct 2020 01:57:37 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:in-reply-to:references:mime-version:date :message-id:subject:to:cc:content-transfer-encoding; bh=kvAo+U2Nqg9u8YgF4sGkeBSmWBRczoSLJlKJL5YLK4A=; b=O64q5CfI8wJRNQ1Nz8vmOghhNwrXksH1A19Y+qymxXm1ftJKkWhoFxHVNvWDeRgPZe VE76gzVqeRYVHmtTSgFUMHq3dWy7RJSttng1mFUy4TFA2LjQDgKsOU6daJ2qASpldfDl opXjL58bdhA4Zv2ODuW2te2c7tEJwHHY+g0ctJC/kZns8f6aqt1t34LVtEPYL0QoOrSS pd7EYKMtEt9aFBoK00BFiX7hGi89VRlHIA6UAPeW13Lx/mS+uRWy/UzGTCNNuJPCLACY 9gzLlM4Usm3YxqacY7ZOIs4smP3xeMcNuoa6nBfUZNp56sHYBBYlQXaOJemqaayNSFSl 7H2A== X-Gm-Message-State: AOAM533IBa2UvnzzlqXhD9iWzDn4qzo5hA6QK+fWP1N10MzHLVER0Ev3 MELPT5WQNd9lCd5LvJL4i8eFnwq7ht0aCBCHa41ver4z X-Google-Smtp-Source: ABdhPJxXPZQ1FF2Xw5yPEZjeH78YBohksmMO0qX3+rDTSj5/OO0zFkxDB3djMUQvC/SOKTI9Zoue63xpLdRvGIihGr8= X-Received: by 2002:a17:906:3cd:: with SMTP id c13mr15977108eja.25.1603097851809; Mon, 19 Oct 2020 01:57:31 -0700 (PDT) Received: from 753933720722 named unknown by gmailapi.google.com with HTTPREST; Mon, 19 Oct 2020 08:57:31 +0000 From: Stefan Kangas In-Reply-To: <20201019.083145.1926465227104280220.wl@gnu.org> References: <87mu4ptzjs.fsf@warpmail.net> <83y2o9r55p.fsf@gnu.org> <20201019.083145.1926465227104280220.wl@gnu.org> MIME-Version: 1.0 Date: Mon, 19 Oct 2020 08:57:31 +0000 Message-ID: Subject: Re: bug#42064: 28.0.50; German "Sharp S" is capitalized inconsistenly To: Werner LEMBERG Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Spam-Score: 0.5 (/) X-Debbugs-Envelope-To: 42064 Cc: eliz@gnu.org, philip@warpmail.net, 42064@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.5 (/) tags 42064 + wontfix notabug close 42064 thanks Werner LEMBERG writes: > AFAICS, the behaviour of the German postfix input method is fully > correct. The default lowercase/uppercase pairing is '=C3=9F/SS'. '=E1=BA= =9E' > should not be a target of 'uppercase-fication'; its use is very > special.[*] > >> Does that mean that this is a wontfix? > > I suggest so. Thanks Werner, your explanation was both interesting and helpful. Based on that, I'm closing this bug report now. > [*] Mainly a solution to indicate '=C3=9F' in names that have to be writt= en > in uppercase letters. Consider the names 'Strauss' and 'Strau=C3=9F'= , > which both occur in German and have to be distinguished in > passports, where family names are to be written in uppercase: > 'STRAUSS' and 'STRAU=E1=BA=9E'. However, in every other context, the= y > should be both uppercased as 'STRAUSS'. From unknown Sun Jun 22 04:27:11 2025 Received: (at fakecontrol) by fakecontrolmessage; To: internal_control@debbugs.gnu.org From: Debbugs Internal Request Subject: Internal Control Message-Id: bug archived. Date: Mon, 16 Nov 2020 12:24:07 +0000 User-Agent: Fakemail v42.6.9 # This is a fake control message. # # The action: # bug archived. thanks # This fakemail brought to you by your local debbugs # administrator