From debbugs-submit-bounces@debbugs.gnu.org Wed Mar 18 15:59:07 2020 Received: (at submit) by debbugs.gnu.org; 18 Mar 2020 19:59:07 +0000 Received: from localhost ([127.0.0.1]:41452 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jEeqJ-0005Oy-A2 for submit@debbugs.gnu.org; Wed, 18 Mar 2020 15:59:07 -0400 Received: from lists.gnu.org ([209.51.188.17]:40723) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jEeqH-0005Oo-7N for submit@debbugs.gnu.org; Wed, 18 Mar 2020 15:59:05 -0400 Received: from eggs.gnu.org ([2001:470:142:3::10]:48671) by lists.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1jEeqF-00012l-Ih for bug-guix@gnu.org; Wed, 18 Mar 2020 15:59:04 -0400 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=0.8 required=5.0 tests=BAYES_50,FREEMAIL_FROM, HTML_MESSAGE, RCVD_IN_DNSWL_NONE, URIBL_BLOCKED autolearn=disabled version=3.3.2 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1jEeqE-0007NT-41 for bug-guix@gnu.org; Wed, 18 Mar 2020 15:59:03 -0400 Received: from mail-vs1-f65.google.com ([209.85.217.65]:38646) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_128_CBC_SHA1:16) (Exim 4.71) (envelope-from ) id 1jEeqD-0007Mw-Vs for bug-guix@gnu.org; Wed, 18 Mar 2020 15:59:02 -0400 Received: by mail-vs1-f65.google.com with SMTP id x206so16183vsx.5 for ; Wed, 18 Mar 2020 12:59:01 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:reply-to:from:date:message-id :subject:to:cc; bh=1VtM7xlafyR21n/taI1PTe6+X2mcsDOEw69OuDbi/kk=; b=tuCRxH19tfMAgXEqHSJBBPO+ubjQq5iGVm4ZgyYMAMWjnTOwMmjBZzK2lz+gJgHzgC hHebZm0ZKwhr6dmQkUm79ZfCaaNOOHuM2PHV72McFCKSQAyoyPyJPh2ZVwYTqSQEt1it tyH7eZgrO4UEjULZBML1O58ZB/5qRD/9lst/KDk7KXlzEcKLeMJpNv/GCnuhfY3+iWtX ZqCJ45majRfjV6KRGEgtQ6k/5PZpCLaJAV7n4/gKvA2bsW1rn10mdIWEz5mZ3pH0Edgw oTXAQ171RM8sAy4hIUw7t0GpsMThFE7uUPJORedNEzUZb8IUt1r1ZY10TH6XvnoC58U0 Rvnw== X-Gm-Message-State: ANhLgQ1ZSsEFj95Ndr91buKSsoby/L7xH+pfxD4fqfkrbhe6JEbhL6i1 OEDjv0lzgo4bWc5nRSHE8vZSEi/fJ4qRc0k1P22/bxPX X-Google-Smtp-Source: ADFU+vsBVLVMF8fXudyOFU/B4zJOsVR3mtclP1AAt1pzNHNbSlJkn0PAoUEVBcjvnH3WxuET8VmWx1bPjr5VOQtrvfI= X-Received: by 2002:a05:6102:22e5:: with SMTP id b5mr4441601vsh.101.1584561541061; Wed, 18 Mar 2020 12:59:01 -0700 (PDT) MIME-Version: 1.0 From: Mikael Djurfeldt Date: Wed, 18 Mar 2020 20:58:49 +0100 Message-ID: Subject: Problem with guix offload: Remote channel closed To: bug-guix@gnu.org Content-Type: multipart/alternative; boundary="000000000000c7a0e105a1267bf1" X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] [fuzzy] X-Received-From: 209.85.217.65 X-Spam-Score: 0.5 (/) X-Debbugs-Envelope-To: submit Cc: Mikael Djurfeldt X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: mikael@djurfeldt.com Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.5 (/) --000000000000c7a0e105a1267bf1 Content-Type: text/plain; charset="UTF-8" Hi, I just installed guix on top of Debian Buster using the installation script at guix.gnu.org. I did this on two machines, hat and wand, with the hope that I could offload compilation to wand. This is what I get: root@hat:~# guix offload test guile: warning: failed to install locale hint: Consider installing the `glibc-utf8-locales' or `glibc-locales' package and defining `GUIX_LOCPATH', along these lines: guix package -i glibc-utf8-locales export GUIX_LOCPATH="$HOME/.guix-profile/lib/locale" See the "Application Setup" section in the manual, for more info. guix offload: testing 1 build machines defined in '/etc/guix/machines.scm'... guix offload: Guix is usable on 'wand.pdc.kth.se' (test returned "/gnu/store/883yjkl46dxw9mzykykmbs0yzwyxm17z-test") guix offload: 'wand.pdc.kth.se' is running GNU Guile 3.0.1 sending 1 store item (0 MiB) to 'wand.pdc.kth.se'... exporting path `/gnu/store/sd0wqvaffi1cbpvf0dq37mab34rmlnav-export-test' ;;; [2020/03/17 12:45:48.671038, 0] write_to_channel_port: [GSSH ERROR] Remote channel is closed: # Backtrace: 1 (primitive-load "/root/.config/guix/current/bin/guix") In guix/ui.scm: 1833:12 0 (run-guix-command _ . _) guix/ui.scm:1833:12: In procedure run-guix-command: Throw to key `guile-ssh-error' with args `("write_to_channel_port" "Remote channel is closed" # #f)'. Any hints about what could be wrong? Best regards, Mikael Djurfeldt --000000000000c7a0e105a1267bf1 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
Hi,

I just = installed guix on top of Debian Buster using the installation script at guix.gnu.org. I did this= on two machines, hat and wand, with the hope that I could offload compilat= ion to wand.

This is what I get:

root@hat:~# guix offload test
guile: warning: failed to install = locale
hint: Consider installing the `glibc-utf8-locales' or `glibc-= locales' package and
defining `GUIX_LOCPATH', along these lines:=

=C2=A0 =C2=A0 =C2=A0guix package -i glibc-utf8-locales
=C2=A0 = =C2=A0 =C2=A0export GUIX_LOCPATH=3D"$HOME/.guix-profile/lib/locale&quo= t;

See the "Application Setup" section in the manual, for = more info.

guix offload: testing 1 build machines defined in '/e= tc/guix/machines.scm'...
guix offload: Guix is usable on 'wand.pdc.kth.se' (te= st returned "/gnu/store/883yjkl46dxw9mzykykmbs0yzwyxm17z-test")guix offload: 'w= and.pdc.kth.se' is running GNU Guile 3.0.1
sending 1 store item = (0 MiB) to 'wand.p= dc.kth.se'...
exporting path `/gnu/store/sd0wqvaffi1cbpvf0dq37ma= b34rmlnav-export-test'
;;; [2020/03/17 12:45:48.671038, 0] write_to_channel_port: [GSSH ERROR]=20 Remote channel is closed: #<input-output: channel (open)=20 7f2c1c9831e0>
Backtrace:
=C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0= 1 (primitive-load "/root/.config/guix/current/bin/guix")
In gu= ix/ui.scm:
=C2=A0 1833:12 =C2=A00 (run-guix-command _ . _)

guix/u= i.scm:1833:12: In procedure run-guix-command:
Throw to key `guile-ssh-error' with args `("write_to_channel_port"= "Remote=20 channel is closed" #<input-output: channel (open) 7f2c1c9831e0>= =20 #f)'.

Any hints about what could be wrong?

Best regards,
Mikael Djurfeldt

--000000000000c7a0e105a1267bf1-- From debbugs-submit-bounces@debbugs.gnu.org Wed Mar 18 16:01:57 2020 Received: (at 40125) by debbugs.gnu.org; 18 Mar 2020 20:01:57 +0000 Received: from localhost ([127.0.0.1]:41457 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jEet2-0005V8-TT for submit@debbugs.gnu.org; Wed, 18 Mar 2020 16:01:57 -0400 Received: from mail-vs1-f66.google.com ([209.85.217.66]:33694) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jEet1-0005Uu-7n for 40125@debbugs.gnu.org; Wed, 18 Mar 2020 16:01:55 -0400 Received: by mail-vs1-f66.google.com with SMTP id y138so48846vsy.0 for <40125@debbugs.gnu.org>; Wed, 18 Mar 2020 13:01:55 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:reply-to:from:date:message-id :subject:to:cc; bh=NfkKulxdGmkvmFREl/G++LNPJA67JgHdhGRvKm63uQ0=; b=dUI18Ye0kmAJigTG9Zf83aFnQKKLOWIhyJZ2kITOBp/BD3YsP1+wcsNUByYy8mmuYs Bphjt5TGCnxjmGSA7+OuWoZrLO6IkpWJz8k78rGbs5uQOvxleQlmyhehn7uz6GmSeWgE b60c/zKCDcE8CbCXYEOwE0ITzpFXO463UfB4Qb+KrXkx2aeLSJ6ttT8jxGAiuNezV6kq Iym+3XS9ZaB3bgcBxUVk0Nxiqhi/v4mrOIXoOeZXE1I6qw/dInsAYCiifuwWw2frOXdS 0pCPtLT7VnBGZ8F+xXsAswy7SIwcFIcJONQWf70nJsIVVEdhXnx4yqlJ5It34lTeHlwq Yszw== X-Gm-Message-State: ANhLgQ3z9uAyZMxMm0snMb2AtzTXYeuCCLjcYxfj/97ihNEyZW1/SpUv aj5FbpMVKuNX9iCZHIC1GH7fAkV5vKEXkwZNKaIlw+yN X-Google-Smtp-Source: ADFU+vt2QJKyzp88km1i/rirsIoaLPEFR49JyKKbZFoWODR1Tw2Vv5IncMvidjQfsp7Lr+7FofP75Jcuz2qGs4m2Kio= X-Received: by 2002:a05:6102:22e5:: with SMTP id b5mr4453295vsh.101.1584561707940; Wed, 18 Mar 2020 13:01:47 -0700 (PDT) MIME-Version: 1.0 From: Mikael Djurfeldt Date: Wed, 18 Mar 2020 21:01:36 +0100 Message-ID: Subject: Problem with guix offload: Remote channel closed To: 40125@debbugs.gnu.org Content-Type: multipart/alternative; boundary="000000000000ba029a05a126856f" X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 40125 Cc: Mikael Djurfeldt X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: mikael@djurfeldt.com Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --000000000000ba029a05a126856f Content-Type: text/plain; charset="UTF-8" This is a more up-to-date log where a problem in my environment (both on local and build host) was fixed: mdj@hat:~$ guix offload test guix offload: testing 1 build machines defined in '/etc/guix/machines.scm'... guix offload: Guix is usable on 'wand.pdc.kth.se' (test returned "/gnu/store/883yjkl46dxw9mzykykmbs0yzwyxm17z-test") guix offload: 'wand.pdc.kth.se' is running GNU Guile 3.0.1 sending 1 store item (0 MiB) to 'wand.pdc.kth.se'... exporting path `/gnu/store/gl7dps3yx0vrxz16sj7q3w7gs3vdbxj4-export-test' ;;; [2020/03/18 20:53:04.930901, 0] write_to_channel_port: [GSSH ERROR] Remote channel is closed: # Backtrace: 1 (primitive-load "/home/mdj/.config/guix/current/bin/guix") In guix/ui.scm: 1833:12 0 (run-guix-command _ . _) guix/ui.scm:1833:12: In procedure run-guix-command: Throw to key `guile-ssh-error' with args `("write_to_channel_port" "Remote channel is closed" # #f)'. --000000000000ba029a05a126856f Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
This is a more up-to-date log where a problem in my e= nvironment (both on local and build host) was fixed:

mdj@hat:~$ guix offload test
guix offload: testing 1 build machines d= efined in '/etc/guix/machines.scm'...
guix offload: Guix is usab= le on 'wand.pdc.kth.se' (tes= t returned "/gnu/store/883yjkl46dxw9mzykykmbs0yzwyxm17z-test")guix offload: 'wand.pdc.kth.se&= #39; is running GNU Guile 3.0.1
sending 1 store item (0 MiB) to 'wand.pdc.kth.se'...
exporting pa= th `/gnu/store/gl7dps3yx0vrxz16sj7q3w7gs3vdbxj4-export-test'
;;; [20= 20/03/18 20:53:04.930901, 0] write_to_channel_port: [GSSH ERROR] Remote cha= nnel is closed: #<input-output: channel (open) 7f5ed680e780>
Backt= race:
=C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A01 (primitive-load "/= home/mdj/.config/guix/current/bin/guix")
In guix/ui.scm:
=C2=A0 = 1833:12 =C2=A00 (run-guix-command _ . _)

guix/ui.scm:1833:12: In pro= cedure run-guix-command:
Throw to key `guile-ssh-error' with args `(= "write_to_channel_port" "Remote channel is closed" #<= ;input-output: channel (open) 7f5ed680e780> #f)'.

--000000000000ba029a05a126856f-- From debbugs-submit-bounces@debbugs.gnu.org Sat Mar 21 11:50:52 2020 Received: (at 40125) by debbugs.gnu.org; 21 Mar 2020 15:50:52 +0000 Received: from localhost ([127.0.0.1]:47824 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jFgOh-0005Lq-Vv for submit@debbugs.gnu.org; Sat, 21 Mar 2020 11:50:52 -0400 Received: from eggs.gnu.org ([209.51.188.92]:56659) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jFgOf-0005Lb-7Y for 40125@debbugs.gnu.org; Sat, 21 Mar 2020 11:50:50 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:46879) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1jFgOZ-0006Z7-MY; Sat, 21 Mar 2020 11:50:43 -0400 Received: from [2a01:e0a:1d:7270:af76:b9b:ca24:c465] (port=55982 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1jFgOZ-0005Xj-6F; Sat, 21 Mar 2020 11:50:43 -0400 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Mikael Djurfeldt Subject: Re: bug#40125: Problem with guix offload: Remote channel closed References: X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 2 Germinal an 228 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Sat, 21 Mar 2020 16:50:41 +0100 In-Reply-To: (Mikael Djurfeldt's message of "Wed, 18 Mar 2020 21:01:36 +0100") Message-ID: <87eetl1zce.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 40125 Cc: 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Hi Mikael! Good to see you here. :-) Mikael Djurfeldt skribis: > mdj@hat:~$ guix offload test > guix offload: testing 1 build machines defined in > '/etc/guix/machines.scm'... > guix offload: Guix is usable on 'wand.pdc.kth.se' (test returned > "/gnu/store/883yjkl46dxw9mzykykmbs0yzwyxm17z-test") > guix offload: 'wand.pdc.kth.se' is running GNU Guile 3.0.1 > sending 1 store item (0 MiB) to 'wand.pdc.kth.se'... > exporting path `/gnu/store/gl7dps3yx0vrxz16sj7q3w7gs3vdbxj4-export-test' > ;;; [2020/03/18 20:53:04.930901, 0] write_to_channel_port: [GSSH ERROR] > Remote channel is closed: # > Backtrace: > 1 (primitive-load "/home/mdj/.config/guix/current/bin/guix") > In guix/ui.scm: > 1833:12 0 (run-guix-command _ . _) > > guix/ui.scm:1833:12: In procedure run-guix-command: > Throw to key `guile-ssh-error' with args `("write_to_channel_port" "Remote > channel is closed" # #f)'. Did you generate a signing key on wand.pdc.kth.se? Specifically with: sudo guix archive --generate-key (See = .) Error reporting in guix offload is currently suboptimal as you have seen. There=E2=80=99s a couple of bug reports open on that topic, so hopef= ully we=E2=80=99ll get there soon! Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Sat Mar 21 12:05:45 2020 Received: (at 40125) by debbugs.gnu.org; 21 Mar 2020 16:05:45 +0000 Received: from localhost ([127.0.0.1]:47835 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jFgd6-0005nt-VA for submit@debbugs.gnu.org; Sat, 21 Mar 2020 12:05:45 -0400 Received: from mail-vs1-f41.google.com ([209.85.217.41]:45881) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jFgd2-0005nZ-KT for 40125@debbugs.gnu.org; Sat, 21 Mar 2020 12:05:43 -0400 Received: by mail-vs1-f41.google.com with SMTP id x82so5916538vsc.12 for <40125@debbugs.gnu.org>; Sat, 21 Mar 2020 09:05:40 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:reply-to :from:date:message-id:subject:to:cc; bh=LeNVUMF8z/SG0U5OSLRUy7Xo5ipWbOLjxHmrLXv/b7Q=; b=Y0ZSJoc1FH+cw1zThmdLgV1DC+bR222Nxm9hMOX5IMrkEScC2ZZbqzwlJBSSHjhYs6 k6KsDLHMR5VVWU8IYAPnWaTH4NnnzSaraakX7rcr+v3XZBit4JnyrDBBSWL6KWNa/NWW kZNQIK6QI5JWNaGq6XOryfhlRaX7kwK9xdPByx2irC1q7xKKAGKwE/JRii3ZdDfqWM+q t3x+c4XyrXtkiRPMThQQlI+xcHPDTyXnsBjfyR4+RIjODsd7W+KGNwRnLiGmbr9W70rH Ejsd93kaBt+c+J+xHw+l0ssZ5Tt8i++ybVzS221ADAEOo57ItjFu48+37IoUABEmHqiN TkVg== X-Gm-Message-State: ANhLgQ2ySl2HhlxxL6jTZVyd6dkBskxEzXM3m8bp90ty+WBauSWXO+X7 vRKUEVef4/tx0Vei1n1trYVZNToH60RLgGZmxdJy0w== X-Google-Smtp-Source: ADFU+vsfLdIw0bpjgQPxLTJOW63zNz2MU80CV7foegc0JTFsQwY9x56YCPyqP91aU48ajsqwi51Ee7Qf0AjsG9YQeBc= X-Received: by 2002:a05:6102:22e5:: with SMTP id b5mr9783679vsh.101.1584806735237; Sat, 21 Mar 2020 09:05:35 -0700 (PDT) MIME-Version: 1.0 References: <87eetl1zce.fsf@gnu.org> In-Reply-To: <87eetl1zce.fsf@gnu.org> From: Mikael Djurfeldt Date: Sat, 21 Mar 2020 17:05:20 +0100 Message-ID: Subject: Re: bug#40125: Problem with guix offload: Remote channel closed To: =?UTF-8?Q?Ludovic_Court=C3=A8s?= Content-Type: multipart/alternative; boundary="0000000000007dd7cc05a15f92e2" X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 40125 Cc: Mikael Djurfeldt , 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: mikael@djurfeldt.com Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --0000000000007dd7cc05a15f92e2 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Hi Ludovic! :-) I did generate the signing key on wand. (But is this sensitive to what user I used? O might have done it as root rather than as the ssh user used to login on wand.) I will look at the other buh reports. Meanwhile, do you have any hint on where to look/insert logging code in order to see what is going on? Best regards, Mikael Den l=C3=B6r 21 mars 2020 16:50Ludovic Court=C3=A8s skrev: > Hi Mikael! > > Good to see you here. :-) > > Mikael Djurfeldt skribis: > > > mdj@hat:~$ guix offload test > > guix offload: testing 1 build machines defined in > > '/etc/guix/machines.scm'... > > guix offload: Guix is usable on 'wand.pdc.kth.se' (test returned > > "/gnu/store/883yjkl46dxw9mzykykmbs0yzwyxm17z-test") > > guix offload: 'wand.pdc.kth.se' is running GNU Guile 3.0.1 > > sending 1 store item (0 MiB) to 'wand.pdc.kth.se'... > > exporting path `/gnu/store/gl7dps3yx0vrxz16sj7q3w7gs3vdbxj4-export-test= ' > > ;;; [2020/03/18 20:53:04.930901, 0] write_to_channel_port: [GSSH ERROR] > > Remote channel is closed: # > > Backtrace: > > 1 (primitive-load "/home/mdj/.config/guix/current/bin/guix") > > In guix/ui.scm: > > 1833:12 0 (run-guix-command _ . _) > > > > guix/ui.scm:1833:12: In procedure run-guix-command: > > Throw to key `guile-ssh-error' with args `("write_to_channel_port" > "Remote > > channel is closed" # #f)'. > > Did you generate a signing key on wand.pdc.kth.se? Specifically with: > > sudo guix archive --generate-key > > (See > >.) > > Error reporting in guix offload is currently suboptimal as you have > seen. There=E2=80=99s a couple of bug reports open on that topic, so hop= efully > we=E2=80=99ll get there soon! > > Ludo=E2=80=99. > --0000000000007dd7cc05a15f92e2 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
Hi Ludovic! :-)
=
I did generate the signing key on wand. (But is this sensitive to= what user I used? O might have done it as root rather than as the ssh user= used to login on wand.)

I wil= l look at the other buh reports. Meanwhile, do you have any hint on where t= o look/insert logging code in order to see what is going on?

Best regards,
= Mikael

Den l=C3=B6r 21 mars 2020 16:50Ludovic Court=C3=A8s <ludo@gnu.org> skrev:
Hi Mikael!

Good to see you here.=C2=A0 :-)

Mikael Djurfeldt <mikael@djurfeldt.com> skribis:

> mdj@hat:~$ guix offload test
> guix offload: testing 1 build machines defined in
> '/etc/guix/machines.scm'...
> guix offload: Guix is usable on 'wand.pdc.kth.se' = (test returned
> "/gnu/store/883yjkl46dxw9mzykykmbs0yzwyxm17z-test")
> guix offload: 'wand.pdc.kth.se' is running GNU Gui= le 3.0.1
> sending 1 store item (0 MiB) to 'wand.pdc.kth.se'.= ..
> exporting path `/gnu/store/gl7dps3yx0vrxz16sj7q3w7gs3vdbxj4-export-tes= t'
> ;;; [2020/03/18 20:53:04.930901, 0] write_to_channel_port: [GSSH ERROR= ]
> Remote channel is closed: #<input-output: channel (open) 7f5ed680e7= 80>
> Backtrace:
>=C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 1 (primitive-load "/home= /mdj/.config/guix/current/bin/guix")
> In guix/ui.scm:
>=C2=A0 =C2=A01833:12=C2=A0 0 (run-guix-command _ . _)
>
> guix/ui.scm:1833:12: In procedure run-guix-command:
> Throw to key `guile-ssh-error' with args `("write_to_channel_= port" "Remote
> channel is closed" #<input-output: channel (open) 7f5ed680e780= > #f)'.

Did you generate a signing key on wand.pdc.kth.se?=C2=A0 Specif= ically with:

=C2=A0 sudo guix archive --generate-key

(See
<https://guix= .gnu.org/manual/devel/en/html_node/Invoking-guix-archive.html>.)

Error reporting in guix offload is currently suboptimal as you have
seen.=C2=A0 There=E2=80=99s a couple of bug reports open on that topic, so = hopefully
we=E2=80=99ll get there soon!

Ludo=E2=80=99.
--0000000000007dd7cc05a15f92e2-- From debbugs-submit-bounces@debbugs.gnu.org Sat Mar 21 16:00:39 2020 Received: (at 40125) by debbugs.gnu.org; 21 Mar 2020 20:00:39 +0000 Received: from localhost ([127.0.0.1]:48127 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jFkIR-0002B7-EQ for submit@debbugs.gnu.org; Sat, 21 Mar 2020 16:00:39 -0400 Received: from mail-ua1-f42.google.com ([209.85.222.42]:33162) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jFkIQ-0002Ac-L8 for 40125@debbugs.gnu.org; Sat, 21 Mar 2020 16:00:38 -0400 Received: by mail-ua1-f42.google.com with SMTP id i7so3573539uap.0 for <40125@debbugs.gnu.org>; Sat, 21 Mar 2020 13:00:38 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:reply-to :from:date:message-id:subject:to:cc; bh=mnA6XmjVbsUbJoO1B2zvfyF2e9giIb+DMyhwo/CLsng=; b=heeNSEBHjniXwXSJJzpqPFCLbvQATF/wUzXoODQG/ZuNxUNwQm/Lp5YilHtvBzTtmJ nBKFXrd9gXEjl/IjD+iCgYeE5A9xJGymyb+WeltNyaxNryDrjeuGR/FanexPt0X4ED0w IOEshXM/SZ1HvWa/HdJ6KdyOtw/qr6NBSiuOmUjfJZp4z4HooGl51eOUSlKYZNSSQFUi WVLlvGEfXT8Hc9f4CTTAH38veCv44DDLZ6EYBzTyXFxE7cIDXwfXjwFJgwLuHRwG9iBR KWjLmCDFJoRpW65QL7nGV+6kdhlwgzhAR9/Y1SNkcGKUoPRJ5Dv7/q6JliaUpP3SXnGr Q/9g== X-Gm-Message-State: ANhLgQ15KfM5XqIHG+IQZmZfJf+VFaKZYsrqIH8zP0x+buCPnMlmkrsQ Xa3ppXLbNQabGRsv6KaGl0TTWn1qdthKQ0fgpSs= X-Google-Smtp-Source: ADFU+vsVZich+TxgKdj+RZn4G/u5oFLg2u51bvHacv+P5gF15iRuS/GaMPJwfQE/L0mUsqXletd/PkP0O/Ep55Jd8VI= X-Received: by 2002:a9f:2310:: with SMTP id 16mr9579614uae.57.1584820833181; Sat, 21 Mar 2020 13:00:33 -0700 (PDT) MIME-Version: 1.0 References: <87eetl1zce.fsf@gnu.org> In-Reply-To: From: Mikael Djurfeldt Date: Sat, 21 Mar 2020 21:00:21 +0100 Message-ID: Subject: Re: bug#40125: Problem with guix offload: Remote channel closed To: =?UTF-8?Q?Ludovic_Court=C3=A8s?= Content-Type: multipart/alternative; boundary="000000000000cb624b05a162da6a" X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 40125 Cc: 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: mikael@djurfeldt.com Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --000000000000cb624b05a162da6a Content-Type: text/plain; charset="UTF-8" On Sat, Mar 21, 2020 at 5:05 PM Mikael Djurfeldt wrote: > Hi Ludovic! :-) > > I did generate the signing key on wand. (But is this sensitive to what > user I used? O might have done it as root rather than as the ssh user used > to login on wand.) > Sorry, I read your email on a cell phone and missed the "sudo" in front of the command. Yes, I did that. --000000000000cb624b05a162da6a Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable --000000000000cb624b05a162da6a-- From debbugs-submit-bounces@debbugs.gnu.org Sat Mar 21 18:16:55 2020 Received: (at 40125) by debbugs.gnu.org; 21 Mar 2020 22:16:55 +0000 Received: from localhost ([127.0.0.1]:48337 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jFmQJ-00028b-8d for submit@debbugs.gnu.org; Sat, 21 Mar 2020 18:16:55 -0400 Received: from eggs.gnu.org ([209.51.188.92]:43534) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jFmQI-00028J-4G for 40125@debbugs.gnu.org; Sat, 21 Mar 2020 18:16:54 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:51815) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1jFmQC-0002VT-Lx; Sat, 21 Mar 2020 18:16:48 -0400 Received: from [2a01:e0a:1d:7270:af76:b9b:ca24:c465] (port=56312 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1jFmQB-0006kM-LG; Sat, 21 Mar 2020 18:16:48 -0400 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Mikael Djurfeldt Subject: Re: bug#40125: Problem with guix offload: Remote channel closed References: <87eetl1zce.fsf@gnu.org> Date: Sat, 21 Mar 2020 23:16:45 +0100 In-Reply-To: (Mikael Djurfeldt's message of "Sat, 21 Mar 2020 17:05:20 +0100") Message-ID: <87pnd5wdyq.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 40125 Cc: 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Hi Mikael, Mikael Djurfeldt skribis: > I will look at the other buh reports. Meanwhile, do you have any hint on > where to look/insert logging code in order to see what is going on? On =E2=80=98wand=E2=80=99, can you run something like: sudo strace -s 500 -p $(pidof sshd) -f -o sshd.log After that, run =E2=80=98guix offload test=E2=80=99 from the other host, an= d check what =E2=80=98sshd.log=E2=80=99 contains. If would in particular look for all t= he =E2=80=98execve=E2=80=99 syscalls as well as what happens right before =E2=80=98exit_group=E2=80=99 = syscalls. There are probably error messages lurking there. :-) You can share excerpts of the log but note that it will contain sensitive crypto material, so beware. Thanks in advance, Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 22 14:21:21 2020 Received: (at 40125) by debbugs.gnu.org; 22 Mar 2020 18:21:21 +0000 Received: from localhost ([127.0.0.1]:50898 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG5Ds-00010B-UC for submit@debbugs.gnu.org; Sun, 22 Mar 2020 14:21:21 -0400 Received: from mail-ua1-f43.google.com ([209.85.222.43]:33841) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG5Dr-0000zr-6K for 40125@debbugs.gnu.org; Sun, 22 Mar 2020 14:21:20 -0400 Received: by mail-ua1-f43.google.com with SMTP id g21so4166069uaj.1 for <40125@debbugs.gnu.org>; Sun, 22 Mar 2020 11:21:19 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:reply-to :from:date:message-id:subject:to:cc; bh=TvWaV/NUHSY5WOra5j5EqVvPc+W3pClOJL9MHtR0Qtg=; b=fwAmTvhpPyVxmuBsgo6t66mTIIVh2754pM/ktJaLc+AlYScqn1ix5I+Bx3ZiK4kUGu UhONV795dK+mEML+0TN+yyop6JbR1fB9UbF0KpcPVNjFGXjjEO02hA0GiL5hU3jEiK05 xQpzvrKMvQtiKqI3lmXoZcmfGFZjj+C+MRUcWJD5ivz94DqYQV6dNmYCQZNyyIy+z/zt JEmSXo69tbOguma/qI/nJ3VeDMIa0A6wIjnjiWAYXw/cJoQYhfHrtLBu3rZVYy2EcQzh kbtPZb5z+9db3BhZarmh2cftjDDN7dSicnVMciuPtyeQ0FbGFr0agyAbdLEq4RpBDUUY ahHA== X-Gm-Message-State: ANhLgQ0sK6YvwE1QZubTeU94aoPonm2iexjj2BIjHJXgYlBTkth3EBM8 LAiR951/3dZNV0mV9bWxaM0xHZ9JzY6leKRj+HEOYx9f X-Google-Smtp-Source: ADFU+vuLhXBo0HNEDWj4nyxmw7lJeKgQ4e4FydRYgaKpW2bXVJmmtVPIW4igUlnSnR+VjHv+wAeYC70UnvUVx17May8= X-Received: by 2002:ab0:7089:: with SMTP id m9mr12186163ual.38.1584901273665; Sun, 22 Mar 2020 11:21:13 -0700 (PDT) MIME-Version: 1.0 References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> In-Reply-To: <87pnd5wdyq.fsf@gnu.org> From: Mikael Djurfeldt Date: Sun, 22 Mar 2020 19:21:02 +0100 Message-ID: Subject: Re: bug#40125: Problem with guix offload: Remote channel closed To: =?UTF-8?Q?Ludovic_Court=C3=A8s?= Content-Type: multipart/alternative; boundary="0000000000006bc56605a17595e8" X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 40125 Cc: 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: mikael@djurfeldt.com Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --0000000000006bc56605a17595e8 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable I did this. What is a bit strange is that the error message seemingly randomly alters between what I already reported above and the following: mdj@hat:~/prusa$ guix offload test guix offload: testing 1 build machines defined in '/etc/guix/machines.scm'... guix offload: Guix is usable on 'wand.pdc.kth.se' (test returned "/gnu/store/883yjkl46dxw9mzykykmbs0yzwyxm17z-test") guix offload: 'wand.pdc.kth.se' is running GNU Guile 3.0.1 sending 1 store item (0 MiB) to 'wand.pdc.kth.se'... exporting path `/gnu/store/kw12ny565xl5p05ag6ysgshc9mhh4rz2-export-test' guix offload: error: unknown error while sending files over SSH This error message is more common. In this case, I couldn't see anything obviously strange except the following backtrace which contains strange characters: 31963 write(2, "Backtrace:\n 13 (apply-smob/1 #)\nIn ice-9/boot-9.scm:\n 718:2 12 (call-with-prompt (\"prompt\") # \342\200\246)\nIn ice-9/eval.scm:\n 619:8 11 (_ #(#(#)))\nIn ice-9/command-line.scm:\n 181:18 10 (_ #)\nIn unknown file:\n 9 (eval (begin (use-modules (guix) (srfi srfi-34) # #) \342\200\246) #)\nIn ice-9/eval.scm:\n 721:20 8 (primitive-eval (begin (use-modules (guix) (srfi \342\200\246) \342"..., 1150 I have also noticed that the above (the error message) happens inside the function send-files. It is the last error clause at the end of the function which reports the error message. I'd like to be able to, e.g., modify the function send-files to give some debugging output. How can I easily do that? Should I checkout guix with git and try to run it in the source tree? Or do you have other suggestions? Best regards, Mikael On Sat, Mar 21, 2020 at 11:16 PM Ludovic Court=C3=A8s wrote: > Hi Mikael, > > Mikael Djurfeldt skribis: > > > I will look at the other buh reports. Meanwhile, do you have any hint o= n > > where to look/insert logging code in order to see what is going on? > > On =E2=80=98wand=E2=80=99, can you run something like: > > sudo strace -s 500 -p $(pidof sshd) -f -o sshd.log > > After that, run =E2=80=98guix offload test=E2=80=99 from the other host, = and check what > =E2=80=98sshd.log=E2=80=99 contains. If would in particular look for all= the =E2=80=98execve=E2=80=99 > syscalls as well as what happens right before =E2=80=98exit_group=E2=80= =99 syscalls. > There are probably error messages lurking there. :-) > > You can share excerpts of the log but note that it will contain > sensitive crypto material, so beware. > > Thanks in advance, > Ludo=E2=80=99. > --0000000000006bc56605a17595e8 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
I did this.

What is a bit st= range is that the error message seemingly randomly alters between what I al= ready reported above and the following:

mdj@hat:~/= prusa$ guix offload test
guix offload: testing 1 build machines defined = in '/etc/guix/machines.scm'...
guix offload: Guix is usable on &= #39;wand.pdc.kth.se' (test retur= ned "/gnu/store/883yjkl46dxw9mzykykmbs0yzwyxm17z-test")
guix o= ffload: 'wand.pdc.kth.se' is= running GNU Guile 3.0.1
sending 1 store item (0 MiB) to 'wand.pdc.kth.se'...
exporting path `/gn= u/store/kw12ny565xl5p05ag6ysgshc9mhh4rz2-export-test'
guix offload: = error: unknown error while sending files over SSH

<= div>This error message is more common. In this case, I couldn't see any= thing obviously strange except the following backtrace which contains stran= ge characters:

31963 write(2, "Backtrace:\n = =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A013 (apply-smob/1 #<catch-closure 56464= c2232a0>)\nIn ice-9/boot-9.scm:\n =C2=A0 =C2=A0718:2 12 (call-with-promp= t (\"prompt\") #<procedure 56464c2407e0 \342\200\246> \342\= 200\246)\nIn ice-9/eval.scm:\n =C2=A0 =C2=A0619:8 11 (_ #(#(#<directory = (guile-user) 56464c2c4750>)))\nIn ice-9/command-line.scm:\n =C2=A0 181:1= 8 10 (_ #<input: string 56464c2d2bd0>)\nIn unknown file:\n =C2=A0 =C2= =A0 =C2=A0 =C2=A0 =C2=A0 9 (eval (begin (use-modules (guix) (srfi srfi-34) = # #) \342\200\246) #)\nIn ice-9/eval.scm:\n =C2=A0 721:20 =C2=A08 (primitiv= e-eval (begin (use-modules (guix) (srfi \342\200\246) \342"..., 1150 &= lt;unfinished ...>

I have also noticed that the= above (the error message) happens inside the function send-files. It is th= e last error clause at the end of the function which reports the error mess= age.

I'd like to be able to, e.g., modify = the function send-files to give some debugging output. How can I easily do = that? Should I checkout guix with git and try to run it in the source tree?= Or do you have other suggestions?

Best regards,
Mikael

On Sat, Mar 21, 2020 at 11:16 PM Ludovic Court=C3= =A8s <ludo@gnu.org= > wrote:
Hi M= ikael,

Mikael Djurfeldt <mikael@djurfeldt.com> skribis:

> I will look at the other buh reports. Meanwhile, do you have any hint = on
> where to look/insert logging code in order to see what is going on?
On =E2=80=98wand=E2=80=99, can you run something like:

=C2=A0 sudo strace -s 500 -p $(pidof sshd) -f -o sshd.log

After that, run =E2=80=98guix offload test=E2=80=99 from the other host, an= d check what
=E2=80=98sshd.log=E2=80=99 contains.=C2=A0 If would in particular look for = all the =E2=80=98execve=E2=80=99
syscalls as well as what happens right before =E2=80=98exit_group=E2=80=99 = syscalls.
There are probably error messages lurking there.=C2=A0 :-)

You can share excerpts of the log but note that it will contain
sensitive crypto material, so beware.

Thanks in advance,
Ludo=E2=80=99.
--0000000000006bc56605a17595e8-- From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 22 16:46:08 2020 Received: (at 40125) by debbugs.gnu.org; 22 Mar 2020 20:46:08 +0000 Received: from localhost ([127.0.0.1]:51000 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG7Tz-0005Oh-Jk for submit@debbugs.gnu.org; Sun, 22 Mar 2020 16:46:08 -0400 Received: from eggs.gnu.org ([209.51.188.92]:53125) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG7Tx-0005Nl-AX for 40125@debbugs.gnu.org; Sun, 22 Mar 2020 16:46:05 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:40072) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1jG7Ts-0006mk-0S; Sun, 22 Mar 2020 16:46:00 -0400 Received: from [2a01:e0a:1d:7270:af76:b9b:ca24:c465] (port=38624 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1jG7Tr-0003X6-IF; Sun, 22 Mar 2020 16:45:59 -0400 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Mikael Djurfeldt Subject: Re: bug#40125: Problem with guix offload: Remote channel closed References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 3 Germinal an 228 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Sun, 22 Mar 2020 21:45:57 +0100 In-Reply-To: (Mikael Djurfeldt's message of "Sun, 22 Mar 2020 19:21:02 +0100") Message-ID: <8736a0uni2.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 40125 Cc: 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Hello! Mikael Djurfeldt skribis: > This error message is more common. In this case, I couldn't see anything > obviously strange except the following backtrace which contains strange > characters: > > 31963 write(2, "Backtrace:\n 13 (apply-smob/1 # 56464c2232a0>)\nIn ice-9/boot-9.scm:\n 718:2 12 (call-with-prompt > (\"prompt\") # \342\200\246)\nIn > ice-9/eval.scm:\n 619:8 11 (_ #(#(# 56464c2c4750>)))\nIn ice-9/command-line.scm:\n 181:18 10 (_ # string 56464c2d2bd0>)\nIn unknown file:\n 9 (eval (begin > (use-modules (guix) (srfi srfi-34) # #) \342\200\246) #)\nIn > ice-9/eval.scm:\n 721:20 8 (primitive-eval (begin (use-modules (guix) > (srfi \342\200\246) \342"..., 1150 We=E2=80=99re missing a tiny bit. :-) Could you run strace with =E2=80=98= -s 3000=E2=80=99 or similar so that it doesn=E2=80=99t truncate it? (The =E2=80=9Cstrange characters=E2=80=9D are Unicode HORIZONTAL ELLIPSIS.) > I have also noticed that the above (the error message) happens inside the > function send-files. It is the last error clause at the end of the functi= on > which reports the error message. > > I'd like to be able to, e.g., modify the function send-files to give some > debugging output. How can I easily do that? Should I checkout guix with g= it > and try to run it in the source tree? Or do you have other suggestions? Note that the problems happens on the remote machine, which is what makes it harder to debug. If you want to debug (guix ssh), you=E2=80=99ll then have to run the daemon= from your Git checkout to exercise that code: sudo -E ./pre-inst-env guix-daemon --build-users-group=3Dguixbuild HTH! Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 22 17:40:58 2020 Received: (at 40125) by debbugs.gnu.org; 22 Mar 2020 21:40:58 +0000 Received: from localhost ([127.0.0.1]:51073 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG8L3-0007Ax-Ug for submit@debbugs.gnu.org; Sun, 22 Mar 2020 17:40:58 -0400 Received: from mail-vs1-f51.google.com ([209.85.217.51]:39504) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG8L2-0007Af-Gx for 40125@debbugs.gnu.org; Sun, 22 Mar 2020 17:40:56 -0400 Received: by mail-vs1-f51.google.com with SMTP id j128so917580vsd.6 for <40125@debbugs.gnu.org>; Sun, 22 Mar 2020 14:40:56 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:reply-to :from:date:message-id:subject:to:cc; bh=2wyxH305LtjuFB6aokbBOpDJfZ0MFmEkXa7Ymaz9Taw=; b=gI1Sep4a7XdBvXLiawR30WDWYWDpErhDspTmCAJYkPV6wsdcqMDKz9xyHiJ9Sxi7JS ct++RUe4jRNDvyhySzMbkgAjpbE259Y5GqFEj0/QRlzSM0g6GCuvjyEgHgPTex+k4jR2 5MbwKhBjqYLG46kXGZ+RflL9/9uwo1tvcLODNJ+8KSalgaemz96VNdy1nD9tq/y0C5LR pR0qmeq1GmcD+5hhGJlS51OY+Ia0ojoV4tiW8Av4L1XW9wFmaX3BAN8RyeUXdvbHNU3a g7lKjyUAk/bmAwrdteuWyVFOgjTIArt7S4uN7B+/ArCl9IgDwCXNAzE6pwYo58Ax+yVl 2iWg== X-Gm-Message-State: ANhLgQ3jE+dO6IbAr3EXO//WdGpTz21fARG+jlhm/45F9IGfbeZHU1gu 8zKKOUZiUQWIW73Lf61CsKFMVT9bTpkhBXsT0hHYLbzS X-Google-Smtp-Source: ADFU+vteRSYvy/yfU/CZPY86NTCiTfyiHDEZMgfHhIyKcXbMAMVk566L4Ei467k9eBYmMQaNEgreRT7tFdJX6aScmrM= X-Received: by 2002:a05:6102:1081:: with SMTP id s1mr13389396vsr.24.1584913250994; Sun, 22 Mar 2020 14:40:50 -0700 (PDT) MIME-Version: 1.0 References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> <8736a0uni2.fsf@gnu.org> In-Reply-To: <8736a0uni2.fsf@gnu.org> From: Mikael Djurfeldt Date: Sun, 22 Mar 2020 22:40:39 +0100 Message-ID: Subject: Re: bug#40125: Problem with guix offload: Remote channel closed To: =?UTF-8?Q?Ludovic_Court=C3=A8s?= Content-Type: multipart/alternative; boundary="000000000000534dcd05a1785f1f" X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 40125 Cc: Mikael Djurfeldt , 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: mikael@djurfeldt.com Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --000000000000534dcd05a1785f1f Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable On Sun, Mar 22, 2020 at 9:46 PM Ludovic Court=C3=A8s wrote: > Mikael Djurfeldt skribis: > > We=E2=80=99re missing a tiny bit. :-) Could you run strace with =E2=80= =98-s 3000=E2=80=99 or > similar so that it doesn=E2=80=99t truncate it? > > (The =E2=80=9Cstrange characters=E2=80=9D are Unicode HORIZONTAL ELLIPSIS= .) > Ah... :) Here's a larger chunk of backtrace: 19530 read(20, "Backtrace:\n 13 (apply-smob/1 #)\nIn ice-9/boot-9.scm:\n 718:2 12 (call-with-prompt (\"prompt\") # \342\200\246)\nIn ice-9/eval.scm:\n 619:8 11 (_ #(#(#)))\nIn ice-9/command-line.scm:\n 181:18 10 (_ #)\nIn unknown file:\n 9 (eval (begin (use-modules (guix) (srfi srfi-34) # #) \342\200\246) #)\nIn ice-9/eval.scm:\n 721:20 8 (primitive-eval (begin (use-modules (guix) (srfi \342\200\246) \342\200\246) \342\200\246))\nIn ice-9/psyntax.scm:\n 1241:36 7 (expand-top-sequence ((begin (use-modules (guix) \342\200\246) \342\200\246)) \342\200\246)\n 1194:19 6 (parse _ ((\"placeholder\" placeholder)) ((top) #(# # \342\200\246)) \342\200\246)\n 1233:19 5 (parse _ ((\"placeholder\" placeholder)) ((top) #(# # \342\200\246)) \342\200\246)\n 285:10 4 (parse _ ((\"placeholder\" placeholder)) (()) _ c&e (eval) \342\200\246)\nIn ice-9/boot-9.scm:\n 3389:20 3 (process-use-modules _)\n 222:17 2 (map1 (((guix)) ((srfi srfi-34)) ((rnrs io ports)) (#)))\n 3390:31 1 (_ ((guix)))\n 2809:6 0 (resolve-interface (guix) #:select _ #:hide _ #:prefix _ \342\200\246)\n\nice-9/boot-9.scm:2809:6: In procedure resolve-interface:\nno code for module (guix)\n", 16384) =3D 1150 --000000000000534dcd05a1785f1f Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
On Sun, Mar 22, 2020 at 9:46 PM Ludovic C= ourt=C3=A8s <ludo@gnu.org> wrote:=
Mikael Djurfeldt <mikael@djurfeldt.com> skribis:

We=E2=80=99re missing a tiny bit.=C2=A0 :-)=C2=A0 Could you run strace with= =E2=80=98-s 3000=E2=80=99 or
similar so that it doesn=E2=80=99t truncate it?

(The =E2=80=9Cstrange characters=E2=80=9D are Unicode HORIZONTAL ELLIPSIS.)=

Ah... :)

Here= 's a larger chunk of backtrace:

19530 read(20,= "Backtrace:\n =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A013 (apply-smob/1 #<= ;catch-closure 563a9e2f92a0>)\nIn ice-9/boot-9.scm:\n =C2=A0 =C2=A0718:2= 12 (call-with-prompt (\"prompt\") #<procedure 563a9e3167e0 \3= 42\200\246> \342\200\246)\nIn ice-9/eval.scm:\n =C2=A0 =C2=A0619:8 11 (_= #(#(#<directory (guile-user) 563a9e39a750>)))\nIn ice-9/command-line= .scm:\n =C2=A0 181:18 10 (_ #<input: string 563a9e3a8bd0>)\nIn unknow= n file:\n =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 9 (eval (begin (use-modules (g= uix) (srfi srfi-34) # #) \342\200\246) #)\nIn ice-9/eval.scm:\n =C2=A0 721:= 20 =C2=A08 (primitive-eval (begin (use-modules (guix) (srfi \342\200\246) \= 342\200\246) \342\200\246))\nIn ice-9/psyntax.scm:\n =C2=A01241:36 =C2=A07 = (expand-top-sequence ((begin (use-modules (guix) \342\200\246) \342\200\246= )) \342\200\246)\n =C2=A01194:19 =C2=A06 (parse _ ((\"placeholder\&quo= t; placeholder)) ((top) #(# # \342\200\246)) \342\200\246)\n =C2=A01233:19 = =C2=A05 (parse _ ((\"placeholder\" placeholder)) ((top) #(# # \34= 2\200\246)) \342\200\246)\n =C2=A0 285:10 =C2=A04 (parse _ ((\"placeho= lder\" placeholder)) (()) _ c&e (eval) \342\200\246)\nIn ice-9/boo= t-9.scm:\n =C2=A03389:20 =C2=A03 (process-use-modules _)\n =C2=A0 222:17 = =C2=A02 (map1 (((guix)) ((srfi srfi-34)) ((rnrs io ports)) (#)))\n =C2=A033= 90:31 =C2=A01 (_ ((guix)))\n =C2=A0 2809:6 =C2=A00 (resolve-interface (guix= ) #:select _ #:hide _ #:prefix _ \342\200\246)\n\nice-9/boot-9.scm:2809:6: = In procedure resolve-interface:\nno code for module (guix)\n", 16384) = =3D 1150
--000000000000534dcd05a1785f1f-- From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 22 17:56:24 2020 Received: (at 40125) by debbugs.gnu.org; 22 Mar 2020 21:56:24 +0000 Received: from localhost ([127.0.0.1]:51090 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG8a0-0007cN-0b for submit@debbugs.gnu.org; Sun, 22 Mar 2020 17:56:24 -0400 Received: from mail-ua1-f42.google.com ([209.85.222.42]:46581) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG8Zz-0007cA-0o for 40125@debbugs.gnu.org; Sun, 22 Mar 2020 17:56:23 -0400 Received: by mail-ua1-f42.google.com with SMTP id y17so455895uap.13 for <40125@debbugs.gnu.org>; Sun, 22 Mar 2020 14:56:22 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:reply-to :from:date:message-id:subject:to:cc; bh=kMmsXpM4u+p4/ryE/amkgmfD55WN25flgjp0NpKUoow=; b=L42yhOSRldIIGO7sg26oKCCr6Xdib7L0IeJ3oLJSoJx7GyjXU1GM130/fUQUQSflEm 7eWNukWDanqfaTewWGqf/vUchHBTjrFzTYKN/heTzN5HjAmF3OA0oUY2NXujs2DxenSb 3coZiXdOV+pdDD4o9rpsfYwwHO6iV5OvjqwnMGVUNMG8aEgUIuRHfi10km00/cpQuGNM jhiMClKg6JBDr8SAHgjJfJb5/zNh1pYb9od688BiOW2NaNNPIPLhKMgdXF9xjbMEEFeD 5E7OzTA3Z/xviyYHYTTBlGGQHOqRek/1N3/fIk/4uDt4OOUfKzydG+Be4hfG+s9rVh75 oQsg== X-Gm-Message-State: ANhLgQ0v7BJ1SiGMuuyw8htIiqKnipgKf46WLqxqVxnUY0MC5bE4g8th n2grWogYQQgT6N3ySivCnV6X+q4GgKs/ttja5/s= X-Google-Smtp-Source: ADFU+vsRrVRw0bitISx9z3qoRRI5tp9lnRk6J1wNWWbcLwvYaayLJBIwm9+OXoAUX6JXGulyR+sM1ZM+kdE9NZXzslk= X-Received: by 2002:ab0:72c6:: with SMTP id g6mr4423843uap.24.1584914177449; Sun, 22 Mar 2020 14:56:17 -0700 (PDT) MIME-Version: 1.0 References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> <8736a0uni2.fsf@gnu.org> In-Reply-To: From: Mikael Djurfeldt Date: Sun, 22 Mar 2020 22:56:06 +0100 Message-ID: Subject: Re: bug#40125: Problem with guix offload: Remote channel closed To: =?UTF-8?Q?Ludovic_Court=C3=A8s?= Content-Type: multipart/alternative; boundary="0000000000008be27705a1789627" X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 40125 Cc: 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: mikael@djurfeldt.com Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --0000000000008be27705a1789627 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable On Sun, Mar 22, 2020 at 10:40 PM Mikael Djurfeldt wrote: > On Sun, Mar 22, 2020 at 9:46 PM Ludovic Court=C3=A8s wrote= : > >> Mikael Djurfeldt skribis: >> >> We=E2=80=99re missing a tiny bit. :-) Could you run strace with =E2=80= =98-s 3000=E2=80=99 or >> similar so that it doesn=E2=80=99t truncate it? >> >> (The =E2=80=9Cstrange characters=E2=80=9D are Unicode HORIZONTAL ELLIPSI= S.) >> > > Ah... :) > > Here's a larger chunk of backtrace: > > 19530 read(20, "Backtrace:\n 13 (apply-smob/1 # 563a9e2f92a0>)\nIn ice-9/boot-9.scm:\n 718:2 12 (call-with-prompt > (\"prompt\") # \342\200\246)\nIn > ice-9/eval.scm:\n 619:8 11 (_ #(#(# 563a9e39a750>)))\nIn ice-9/command-line.scm:\n 181:18 10 (_ # string 563a9e3a8bd0>)\nIn unknown file:\n 9 (eval (begin > (use-modules (guix) (srfi srfi-34) # #) \342\200\246) #)\nIn > ice-9/eval.scm:\n 721:20 8 (primitive-eval (begin (use-modules (guix) > (srfi \342\200\246) \342\200\246) \342\200\246))\nIn ice-9/psyntax.scm:\n > 1241:36 7 (expand-top-sequence ((begin (use-modules (guix) \342\200\246= ) > \342\200\246)) \342\200\246)\n 1194:19 6 (parse _ ((\"placeholder\" > placeholder)) ((top) #(# # \342\200\246)) \342\200\246)\n 1233:19 5 > (parse _ ((\"placeholder\" placeholder)) ((top) #(# # \342\200\246)) > \342\200\246)\n 285:10 4 (parse _ ((\"placeholder\" placeholder)) (())= _ > c&e (eval) \342\200\246)\nIn ice-9/boot-9.scm:\n 3389:20 3 > (process-use-modules _)\n 222:17 2 (map1 (((guix)) ((srfi srfi-34)) > ((rnrs io ports)) (#)))\n 3390:31 1 (_ ((guix)))\n 2809:6 0 > (resolve-interface (guix) #:select _ #:hide _ #:prefix _ > \342\200\246)\n\nice-9/boot-9.scm:2809:6: In procedure > resolve-interface:\nno code for module (guix)\n", 16384) =3D 1150 > I think I understand part of the problem. It's not guix guile which is invoked on wand but the guile which I have installed under /usr/local. But why is this? guix as well as guile-ssh is installed at wand. --0000000000008be27705a1789627 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
On Sun, Mar 22, 2020 at 10:40 PM Mikael D= jurfeldt <mikael@djurfeldt.com> wrote:
Mikael Djurfeldt <mikael@djurfeldt.com> skribis:

We=E2=80=99re missing a tiny bit.=C2=A0 :-)=C2=A0 Could you run strace with= =E2=80=98-s 3000=E2=80=99 or
similar so that it doesn=E2=80=99t truncate it?

(The =E2=80=9Cstrange characters=E2=80=9D are Unicode HORIZONTAL ELLIPSIS.)=

Ah... :)

Here= 's a larger chunk of backtrace:

19530 read(20,= "Backtrace:\n =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A013 (apply-smob/1 #<= ;catch-closure 563a9e2f92a0>)\nIn ice-9/boot-9.scm:\n =C2=A0 =C2=A0718:2= 12 (call-with-prompt (\"prompt\") #<procedure 563a9e3167e0 \3= 42\200\246> \342\200\246)\nIn ice-9/eval.scm:\n =C2=A0 =C2=A0619:8 11 (_= #(#(#<directory (guile-user) 563a9e39a750>)))\nIn ice-9/command-line= .scm:\n =C2=A0 181:18 10 (_ #<input: string 563a9e3a8bd0>)\nIn unknow= n file:\n =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 9 (eval (begin (use-modules (g= uix) (srfi srfi-34) # #) \342\200\246) #)\nIn ice-9/eval.scm:\n =C2=A0 721:= 20 =C2=A08 (primitive-eval (begin (use-modules (guix) (srfi \342\200\246) \= 342\200\246) \342\200\246))\nIn ice-9/psyntax.scm:\n =C2=A01241:36 =C2=A07 = (expand-top-sequence ((begin (use-modules (guix) \342\200\246) \342\200\246= )) \342\200\246)\n =C2=A01194:19 =C2=A06 (parse _ ((\"placeholder\&quo= t; placeholder)) ((top) #(# # \342\200\246)) \342\200\246)\n =C2=A01233:19 = =C2=A05 (parse _ ((\"placeholder\" placeholder)) ((top) #(# # \34= 2\200\246)) \342\200\246)\n =C2=A0 285:10 =C2=A04 (parse _ ((\"placeho= lder\" placeholder)) (()) _ c&e (eval) \342\200\246)\nIn ice-9/boo= t-9.scm:\n =C2=A03389:20 =C2=A03 (process-use-modules _)\n =C2=A0 222:17 = =C2=A02 (map1 (((guix)) ((srfi srfi-34)) ((rnrs io ports)) (#)))\n =C2=A033= 90:31 =C2=A01 (_ ((guix)))\n =C2=A0 2809:6 =C2=A00 (resolve-interface (guix= ) #:select _ #:hide _ #:prefix _ \342\200\246)\n\nice-9/boot-9.scm:2809:6: = In procedure resolve-interface:\nno code for module (guix)\n", 16384) = =3D 1150

I think I un= derstand part of the problem. It's not guix guile which is invoked on w= and but the guile which I have installed under /usr/local. But why is this?= guix as well as guile-ssh is installed at wand.=C2=A0
--0000000000008be27705a1789627-- From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 22 18:13:55 2020 Received: (at 40125) by debbugs.gnu.org; 22 Mar 2020 22:13:55 +0000 Received: from localhost ([127.0.0.1]:51104 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG8qx-0008A5-0m for submit@debbugs.gnu.org; Sun, 22 Mar 2020 18:13:55 -0400 Received: from mail-vk1-f175.google.com ([209.85.221.175]:43150) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG8qv-00089l-Fv for 40125@debbugs.gnu.org; Sun, 22 Mar 2020 18:13:53 -0400 Received: by mail-vk1-f175.google.com with SMTP id t3so3274159vkm.10 for <40125@debbugs.gnu.org>; Sun, 22 Mar 2020 15:13:53 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:reply-to :from:date:message-id:subject:to:cc; bh=NcfTVxzaIHTEy/V+1LZ5PhGu+ES+mXc1jautMQTwXt8=; b=YKsdZrI34KBHfyNvwK1goR3s4t3B9wPw78E+7it2CtYj8Fq9L4EEn8yL/GsbZ7B+Tg 9d07N4hOy3Z87pd/Kb840RpMvJhTTAdRGsEYVn8WvE2XI4k/Fsz/k7IokSEptxra5HG6 mtMZdgz2/o9R7B4sTMOuYtWq5NBnklmkw20PmFif/46s8nbbKYkeP9ah9dV93Eekagl6 s1Ji1nJ7rmrRsnsHtL45qzWheN9zJ9QCowNDhZlkQ8I2G7j2aHHyeu2DDWN37/J1TQYU fNXJW88i2YE8Cnfv0qA+bquIBo41ndvl0MvDcEbz4jBCnJZ1uELvil6//0wzwAl3SIlk /Omw== X-Gm-Message-State: ANhLgQ3oY2/IrKMYY/S4aVFHQiJd92pOfZnpkZI7hFISM6U4NUbpLrNg hJKacZK2gvX/W6PNxkiEcbsrUygkvNGGYY1FJkE= X-Google-Smtp-Source: ADFU+vuuGcml6b4CYGShTO/M0bU/A3sSo5heoZebo0ATk+tF+wkzzTa1mG8xOOG8UvhvOj+DmRankmMJRQDGeJz9xR0= X-Received: by 2002:a1f:7c45:: with SMTP id x66mr12373548vkc.45.1584915227968; Sun, 22 Mar 2020 15:13:47 -0700 (PDT) MIME-Version: 1.0 References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> <8736a0uni2.fsf@gnu.org> In-Reply-To: From: Mikael Djurfeldt Date: Sun, 22 Mar 2020 23:13:36 +0100 Message-ID: Subject: Re: bug#40125: Problem with guix offload: Remote channel closed To: =?UTF-8?Q?Ludovic_Court=C3=A8s?= Content-Type: multipart/alternative; boundary="00000000000029889605a178d59e" X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 40125 Cc: 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: mikael@djurfeldt.com Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --00000000000029889605a178d59e Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable On Sun, Mar 22, 2020 at 10:56 PM Mikael Djurfeldt wrote: > On Sun, Mar 22, 2020 at 10:40 PM Mikael Djurfeldt > wrote: > >> On Sun, Mar 22, 2020 at 9:46 PM Ludovic Court=C3=A8s wrot= e: >> >>> Mikael Djurfeldt skribis: >>> >>> We=E2=80=99re missing a tiny bit. :-) Could you run strace with =E2= =80=98-s 3000=E2=80=99 or >>> similar so that it doesn=E2=80=99t truncate it? >>> >>> (The =E2=80=9Cstrange characters=E2=80=9D are Unicode HORIZONTAL ELLIPS= IS.) >>> >> >> Ah... :) >> >> Here's a larger chunk of backtrace: >> >> 19530 read(20, "Backtrace:\n 13 (apply-smob/1 #> 563a9e2f92a0>)\nIn ice-9/boot-9.scm:\n 718:2 12 (call-with-prompt >> (\"prompt\") # \342\200\246)\nIn >> ice-9/eval.scm:\n 619:8 11 (_ #(#(#> 563a9e39a750>)))\nIn ice-9/command-line.scm:\n 181:18 10 (_ #> string 563a9e3a8bd0>)\nIn unknown file:\n 9 (eval (begin >> (use-modules (guix) (srfi srfi-34) # #) \342\200\246) #)\nIn >> ice-9/eval.scm:\n 721:20 8 (primitive-eval (begin (use-modules (guix) >> (srfi \342\200\246) \342\200\246) \342\200\246))\nIn ice-9/psyntax.scm:\= n >> 1241:36 7 (expand-top-sequence ((begin (use-modules (guix) \342\200\24= 6) >> \342\200\246)) \342\200\246)\n 1194:19 6 (parse _ ((\"placeholder\" >> placeholder)) ((top) #(# # \342\200\246)) \342\200\246)\n 1233:19 5 >> (parse _ ((\"placeholder\" placeholder)) ((top) #(# # \342\200\246)) >> \342\200\246)\n 285:10 4 (parse _ ((\"placeholder\" placeholder)) (()= ) _ >> c&e (eval) \342\200\246)\nIn ice-9/boot-9.scm:\n 3389:20 3 >> (process-use-modules _)\n 222:17 2 (map1 (((guix)) ((srfi srfi-34)) >> ((rnrs io ports)) (#)))\n 3390:31 1 (_ ((guix)))\n 2809:6 0 >> (resolve-interface (guix) #:select _ #:hide _ #:prefix _ >> \342\200\246)\n\nice-9/boot-9.scm:2809:6: In procedure >> resolve-interface:\nno code for module (guix)\n", 16384) =3D 1150 >> > > I think I understand part of the problem. It's not guix guile which is > invoked on wand but the guile which I have installed under /usr/local. Bu= t > why is this? guix as well as guile-ssh is installed at wand. > Which guile is it supposed to use? Which version and which "fusion of modules"? And how are these supposed to be found on the build machine. Looking in the strace, it seems like a bash shell with "guile -c" is started without any path information. (Not sure that I even ask the right questions.) --00000000000029889605a178d59e Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
On Sun, Mar 22, 2020 at 10:56 PM Mikael D= jurfeldt <mikael@djurfeldt.com> wrote:
On Sun, Mar 22, 2020 at 9:46 PM Ludovic Court=C3= =A8s <ludo@gnu.org= > wrote:
Mikael Djurfeldt <mikael@djurfeldt.com> skribis:

We=E2=80=99re missing a tiny bit.=C2=A0 :-)=C2=A0 Could you run strace with= =E2=80=98-s 3000=E2=80=99 or
similar so that it doesn=E2=80=99t truncate it?

(The =E2=80=9Cstrange characters=E2=80=9D are Unicode HORIZONTAL ELLIPSIS.)=

Ah... :)

Here= 's a larger chunk of backtrace:

19530 read(20,= "Backtrace:\n =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A013 (apply-smob/1 #<= ;catch-closure 563a9e2f92a0>)\nIn ice-9/boot-9.scm:\n =C2=A0 =C2=A0718:2= 12 (call-with-prompt (\"prompt\") #<procedure 563a9e3167e0 \3= 42\200\246> \342\200\246)\nIn ice-9/eval.scm:\n =C2=A0 =C2=A0619:8 11 (_= #(#(#<directory (guile-user) 563a9e39a750>)))\nIn ice-9/command-line= .scm:\n =C2=A0 181:18 10 (_ #<input: string 563a9e3a8bd0>)\nIn unknow= n file:\n =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 9 (eval (begin (use-modules (g= uix) (srfi srfi-34) # #) \342\200\246) #)\nIn ice-9/eval.scm:\n =C2=A0 721:= 20 =C2=A08 (primitive-eval (begin (use-modules (guix) (srfi \342\200\246) \= 342\200\246) \342\200\246))\nIn ice-9/psyntax.scm:\n =C2=A01241:36 =C2=A07 = (expand-top-sequence ((begin (use-modules (guix) \342\200\246) \342\200\246= )) \342\200\246)\n =C2=A01194:19 =C2=A06 (parse _ ((\"placeholder\&quo= t; placeholder)) ((top) #(# # \342\200\246)) \342\200\246)\n =C2=A01233:19 = =C2=A05 (parse _ ((\"placeholder\" placeholder)) ((top) #(# # \34= 2\200\246)) \342\200\246)\n =C2=A0 285:10 =C2=A04 (parse _ ((\"placeho= lder\" placeholder)) (()) _ c&e (eval) \342\200\246)\nIn ice-9/boo= t-9.scm:\n =C2=A03389:20 =C2=A03 (process-use-modules _)\n =C2=A0 222:17 = =C2=A02 (map1 (((guix)) ((srfi srfi-34)) ((rnrs io ports)) (#)))\n =C2=A033= 90:31 =C2=A01 (_ ((guix)))\n =C2=A0 2809:6 =C2=A00 (resolve-interface (guix= ) #:select _ #:hide _ #:prefix _ \342\200\246)\n\nice-9/boot-9.scm:2809:6: = In procedure resolve-interface:\nno code for module (guix)\n", 16384) = =3D 1150

I think I un= derstand part of the problem. It's not guix guile which is invoked on w= and but the guile which I have installed under /usr/local. But why is this?= guix as well as guile-ssh is installed at wand.=C2=A0

Which guile is it supposed to use? Which= version and which "fusion of modules"? And how are these suppose= d to be found on the build machine. Looking in the strace, it seems like a = bash shell with "guile -c" is started without any path informatio= n.

(Not sure that I even ask the right questions.)=
--00000000000029889605a178d59e-- From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 22 18:15:15 2020 Received: (at 40125) by debbugs.gnu.org; 22 Mar 2020 22:15:16 +0000 Received: from localhost ([127.0.0.1]:51108 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG8sF-0008DQ-H7 for submit@debbugs.gnu.org; Sun, 22 Mar 2020 18:15:15 -0400 Received: from mail-vk1-f176.google.com ([209.85.221.176]:33776) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG8sE-0008D5-9m for 40125@debbugs.gnu.org; Sun, 22 Mar 2020 18:15:14 -0400 Received: by mail-vk1-f176.google.com with SMTP id f63so1943610vkh.0 for <40125@debbugs.gnu.org>; Sun, 22 Mar 2020 15:15:14 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:reply-to :from:date:message-id:subject:to:cc; bh=/rt+QRmOJXGYrIm2OfJpemeKikkzMpuKJ2ga2RY0oOU=; b=VeiQ1Gyfm1DGov2WqBKxn23UStgHXtb3z/+cwxBunEZCRzjMc+Xdx4bN0D256UfqOh aWa4Y2by9FfDfax6A/tWWci4KRm9wUAJrAiw0/xgr6+7aqcmESLYlNOPgS+cvAFPbJiS hHsringiSypXzCcF9sLsvoTH+NDqt5qc5+xrmF6pQesk6m9xMbJ1ll6sUQiSssdtU6Ky Ynax9j9sAfMTxcwcVBO06FsSDt3aABze0ZHXvk6uimr0Qee5XuOdV56UaidCVEF0ezZ0 1KUHBo1UaIaJJtVQVB2YNx0PNFf43Km8K+O5lWq0Upo2Mf1IQCpgC2StzURKSwcQb2aZ //wA== X-Gm-Message-State: ANhLgQ2D9agvq2VAm6OOQEuB92j9XhvhMTu31GSDtS0+XqGDuO3NYd9V cOoTcfSOC7Ks/nCir0if6uVrtpGl+VJ8Xy40Pus= X-Google-Smtp-Source: ADFU+vsB892FeTw3k8FTP9LMUOgCvbazV+Se02bkgC7WdQC6fQ/a8aFBI09z01FVMTJhOZMNbVLKEn0/elGA/FEhkjI= X-Received: by 2002:a1f:6e4d:: with SMTP id j74mr13236355vkc.14.1584915308919; Sun, 22 Mar 2020 15:15:08 -0700 (PDT) MIME-Version: 1.0 References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> <8736a0uni2.fsf@gnu.org> In-Reply-To: From: Mikael Djurfeldt Date: Sun, 22 Mar 2020 23:14:56 +0100 Message-ID: Subject: Re: bug#40125: Problem with guix offload: Remote channel closed To: =?UTF-8?Q?Ludovic_Court=C3=A8s?= Content-Type: multipart/alternative; boundary="000000000000fcbfb105a178d96f" X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 40125 Cc: 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: mikael@djurfeldt.com Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --000000000000fcbfb105a178d96f Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable On Sun, Mar 22, 2020 at 11:13 PM Mikael Djurfeldt wrote: > On Sun, Mar 22, 2020 at 10:56 PM Mikael Djurfeldt > wrote: > >> On Sun, Mar 22, 2020 at 10:40 PM Mikael Djurfeldt >> wrote: >> >>> On Sun, Mar 22, 2020 at 9:46 PM Ludovic Court=C3=A8s wro= te: >>> >>>> Mikael Djurfeldt skribis: >>>> >>>> We=E2=80=99re missing a tiny bit. :-) Could you run strace with =E2= =80=98-s 3000=E2=80=99 or >>>> similar so that it doesn=E2=80=99t truncate it? >>>> >>>> (The =E2=80=9Cstrange characters=E2=80=9D are Unicode HORIZONTAL ELLIP= SIS.) >>>> >>> >>> Ah... :) >>> >>> Here's a larger chunk of backtrace: >>> >>> 19530 read(20, "Backtrace:\n 13 (apply-smob/1 #>> 563a9e2f92a0>)\nIn ice-9/boot-9.scm:\n 718:2 12 (call-with-prompt >>> (\"prompt\") # \342\200\246)\nIn >>> ice-9/eval.scm:\n 619:8 11 (_ #(#(#>> 563a9e39a750>)))\nIn ice-9/command-line.scm:\n 181:18 10 (_ #>> string 563a9e3a8bd0>)\nIn unknown file:\n 9 (eval (begin >>> (use-modules (guix) (srfi srfi-34) # #) \342\200\246) #)\nIn >>> ice-9/eval.scm:\n 721:20 8 (primitive-eval (begin (use-modules (guix= ) >>> (srfi \342\200\246) \342\200\246) \342\200\246))\nIn ice-9/psyntax.scm:= \n >>> 1241:36 7 (expand-top-sequence ((begin (use-modules (guix) \342\200\2= 46) >>> \342\200\246)) \342\200\246)\n 1194:19 6 (parse _ ((\"placeholder\" >>> placeholder)) ((top) #(# # \342\200\246)) \342\200\246)\n 1233:19 5 >>> (parse _ ((\"placeholder\" placeholder)) ((top) #(# # \342\200\246)) >>> \342\200\246)\n 285:10 4 (parse _ ((\"placeholder\" placeholder)) ((= )) _ >>> c&e (eval) \342\200\246)\nIn ice-9/boot-9.scm:\n 3389:20 3 >>> (process-use-modules _)\n 222:17 2 (map1 (((guix)) ((srfi srfi-34)) >>> ((rnrs io ports)) (#)))\n 3390:31 1 (_ ((guix)))\n 2809:6 0 >>> (resolve-interface (guix) #:select _ #:hide _ #:prefix _ >>> \342\200\246)\n\nice-9/boot-9.scm:2809:6: In procedure >>> resolve-interface:\nno code for module (guix)\n", 16384) =3D 1150 >>> >> >> I think I understand part of the problem. It's not guix guile which is >> invoked on wand but the guile which I have installed under /usr/local. B= ut >> why is this? guix as well as guile-ssh is installed at wand. >> > > Which guile is it supposed to use? Which version and which "fusion of > modules"? And how are these supposed to be found on the build machine. > Looking in the strace, it seems like a bash shell with "guile -c" is > started without any path information. > > (Not sure that I even ask the right questions.) > The PATH of the build machine user is: /home/guix/.guix-profile/bin:/home/guix/.config/guix/current/bin:/usr/local= /bin:/usr/bin:/bin:/usr/local/games:/usr/games:/usr/lib/jvm/java-8-oracle/b= in:/usr/lib/jvm/java-8-oracle/db/bin:/usr/lib/jvm/java-8-oracle/jre/bin:/op= t/thinlinc/bin --000000000000fcbfb105a178d96f Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
On Sun, Mar 22, 2020 at 11:13 PM Mikael D= jurfeldt <mikael@djurfeldt.com> wrote:
On Sun, Mar 22, 2020 at 10:40 PM Mikael Djurfeld= t <mikael@djur= feldt.com> wrote:
On Su= n, Mar 22, 2020 at 9:46 PM Ludovic Court=C3=A8s <ludo@gnu.org> wrote:
Mikael Djurfeldt <mikael@djurfeldt.com> skribis:

We=E2=80=99re missing a tiny bit.=C2=A0 :-)=C2=A0 Could you run strace with= =E2=80=98-s 3000=E2=80=99 or
similar so that it doesn=E2=80=99t truncate it?

(The =E2=80=9Cstrange characters=E2=80=9D are Unicode HORIZONTAL ELLIPSIS.)=

Ah... :)

Here= 's a larger chunk of backtrace:

19530 read(20,= "Backtrace:\n =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A013 (apply-smob/1 #<= ;catch-closure 563a9e2f92a0>)\nIn ice-9/boot-9.scm:\n =C2=A0 =C2=A0718:2= 12 (call-with-prompt (\"prompt\") #<procedure 563a9e3167e0 \3= 42\200\246> \342\200\246)\nIn ice-9/eval.scm:\n =C2=A0 =C2=A0619:8 11 (_= #(#(#<directory (guile-user) 563a9e39a750>)))\nIn ice-9/command-line= .scm:\n =C2=A0 181:18 10 (_ #<input: string 563a9e3a8bd0>)\nIn unknow= n file:\n =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 9 (eval (begin (use-modules (g= uix) (srfi srfi-34) # #) \342\200\246) #)\nIn ice-9/eval.scm:\n =C2=A0 721:= 20 =C2=A08 (primitive-eval (begin (use-modules (guix) (srfi \342\200\246) \= 342\200\246) \342\200\246))\nIn ice-9/psyntax.scm:\n =C2=A01241:36 =C2=A07 = (expand-top-sequence ((begin (use-modules (guix) \342\200\246) \342\200\246= )) \342\200\246)\n =C2=A01194:19 =C2=A06 (parse _ ((\"placeholder\&quo= t; placeholder)) ((top) #(# # \342\200\246)) \342\200\246)\n =C2=A01233:19 = =C2=A05 (parse _ ((\"placeholder\" placeholder)) ((top) #(# # \34= 2\200\246)) \342\200\246)\n =C2=A0 285:10 =C2=A04 (parse _ ((\"placeho= lder\" placeholder)) (()) _ c&e (eval) \342\200\246)\nIn ice-9/boo= t-9.scm:\n =C2=A03389:20 =C2=A03 (process-use-modules _)\n =C2=A0 222:17 = =C2=A02 (map1 (((guix)) ((srfi srfi-34)) ((rnrs io ports)) (#)))\n =C2=A033= 90:31 =C2=A01 (_ ((guix)))\n =C2=A0 2809:6 =C2=A00 (resolve-interface (guix= ) #:select _ #:hide _ #:prefix _ \342\200\246)\n\nice-9/boot-9.scm:2809:6: = In procedure resolve-interface:\nno code for module (guix)\n", 16384) = =3D 1150

I think I un= derstand part of the problem. It's not guix guile which is invoked on w= and but the guile which I have installed under /usr/local. But why is this?= guix as well as guile-ssh is installed at wand.=C2=A0

Which guile is it supposed to use? Which= version and which "fusion of modules"? And how are these suppose= d to be found on the build machine. Looking in the strace, it seems like a = bash shell with "guile -c" is started without any path informatio= n.

(Not sure that I even ask the right questions.)=

The PATH of the buil= d machine user is:

/home/guix/.guix-profile/bin:/h= ome/guix/.config/guix/current/bin:/usr/local/bin:/usr/bin:/bin:/usr/local/g= ames:/usr/games:/usr/lib/jvm/java-8-oracle/bin:/usr/lib/jvm/java-8-oracle/d= b/bin:/usr/lib/jvm/java-8-oracle/jre/bin:/opt/thinlinc/bin
--000000000000fcbfb105a178d96f-- From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 22 18:25:08 2020 Received: (at 40125) by debbugs.gnu.org; 22 Mar 2020 22:25:09 +0000 Received: from localhost ([127.0.0.1]:51113 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG91o-0008WA-LE for submit@debbugs.gnu.org; Sun, 22 Mar 2020 18:25:08 -0400 Received: from mail-vs1-f42.google.com ([209.85.217.42]:45003) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG91m-0008Vg-SN for 40125@debbugs.gnu.org; Sun, 22 Mar 2020 18:25:07 -0400 Received: by mail-vs1-f42.google.com with SMTP id e138so7524026vsc.11 for <40125@debbugs.gnu.org>; Sun, 22 Mar 2020 15:25:06 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:reply-to :from:date:message-id:subject:to:cc; bh=fJiAP9g0NlUKycG1Et9hI8WXvUkVQZv1eomeknmBtk4=; b=nCLsHKava+uKExvNPswWNcluO4oxIYZoVnz3Ec4xIjwwP65lIzz9wAxl2CgnJYKorH iP+J2fAY+6ESOsU2kg9APFwwYr1QT+gX/yKEgQ/77rBSAuTWD1k/oytt7tNON+5wicIX nCCvPmJHwDy4mS93BAvqSy4ICVtRjach/oU0ZIgRr9wgye9AGNNeACzKHs3VCaOe+ppP b7I+l+L1MZDf1+By+j4zXuu02d6STxSPSRL3uQgtO2l7F+fXdYFQL+EwCyyarUvH/X6s v0DtFhi/zBNI0XEJsauDcQyZWaXA3r+Wp8zQV0T4F/7D8uQAHi5pdRserI9x2BnzMreF XaYA== X-Gm-Message-State: ANhLgQ36HvsMa45q1jucl/3FMtnI7UAFuf8D3FW6tzSxZjmmBSmQMJwN DOvfm4WxQwFP0cs9z3B6NByHTxznDg+nErDBEUY= X-Google-Smtp-Source: ADFU+vuNMY+/hHXi74INUYD2jmT0zkEpGslfF2xqpprQEQLupkRFYGWOFcS9E0Lcr1RXP2u51d2uxHQykkx7qw7n8kU= X-Received: by 2002:a67:2904:: with SMTP id p4mr1341900vsp.101.1584915901370; Sun, 22 Mar 2020 15:25:01 -0700 (PDT) MIME-Version: 1.0 References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> <8736a0uni2.fsf@gnu.org> In-Reply-To: From: Mikael Djurfeldt Date: Sun, 22 Mar 2020 23:24:50 +0100 Message-ID: Subject: Re: bug#40125: Problem with guix offload: Remote channel closed To: =?UTF-8?Q?Ludovic_Court=C3=A8s?= Content-Type: multipart/alternative; boundary="0000000000004cd52005a178fda0" X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 40125 Cc: 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: mikael@djurfeldt.com Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --0000000000004cd52005a178fda0 Content-Type: text/plain; charset="UTF-8" On Sun, Mar 22, 2020 at 11:14 PM Mikael Djurfeldt wrote: > The PATH of the build machine user is: > > /home/guix/.guix-profile/bin:/home/guix/.config/guix/current/bin:/usr/local/bin:/usr/bin:/bin:/usr/local/games:/usr/games:/usr/lib/jvm/java-8-oracle/bin:/usr/lib/jvm/java-8-oracle/db/bin:/usr/lib/jvm/java-8-oracle/jre/bin:/opt/thinlinc/bin > > The build host is not a pure guix installation but also has guix on top of Debian Buster. It seems like the file transfer command is using an ssh call which doesn't setup the proper guix environment (as, e.g., the /usr/local/bin/guix script does). For example, PATH will have /usr/local/bin before the guix environment such that the wrong guile is selected. Not sure how the proper setup should look like on the build host side... --0000000000004cd52005a178fda0 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
On Sun, Mar 22, 2020 at 11:14 PM Mikael D= jurfeldt <mikael@djurfeldt.com> wrote:



--0000000000004cd52005a178fda0-- From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 22 18:30:56 2020 Received: (at 40125) by debbugs.gnu.org; 22 Mar 2020 22:30:56 +0000 Received: from localhost ([127.0.0.1]:51120 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG97Q-0000GS-AD for submit@debbugs.gnu.org; Sun, 22 Mar 2020 18:30:56 -0400 Received: from out2-smtp.messagingengine.com ([66.111.4.26]:46471) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG97O-0000G8-37 for 40125@debbugs.gnu.org; Sun, 22 Mar 2020 18:30:54 -0400 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id 007BF5C01E3; Sun, 22 Mar 2020 18:30:49 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute4.internal (MEProxy); Sun, 22 Mar 2020 18:30:48 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=OG2KiDHMQhS/GItudb53si2PoS RGBT2DcdCPDztfhjo=; b=X1D7wZwpxBRTCoJ3ADU+8LL/uRt1UEwX0B/iQE9DJk JCmbgCxuKBoAFHsbFj6ksWU2zZvqFOr7Qdj0bYLKgJOj/xoyMQoM83PCVeg95pKd z+OjHPBmygzM0peea8txyuGzOQAqzz2vKzq+6gHz+QAMKslCSdZpxCVrKS7u/3q+ CpJNDX9UDHBiVrDS9TGo14gcGZKe6ncF3+4tB4JG3eDfoJrg8j4VqoH8wEACCkiy 3Xn/NTJHwfuNf6d3fji24r1j0fzoj6+7kKxm0I8jXvu6x6Me+ZFqh2cnrx2ybX9T 8W3aBIxm0vj8SYfrzkgdieFwKeMTK0ft0wmkV9f+s69A== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=OG2KiD HMQhS/GItudb53si2PoSRGBT2DcdCPDztfhjo=; b=iwOGDs40/u6SqAn/UuNye9 dOKNi4aOma1G/4qhUq0JUMzEgzlxHu5snoJHrU99OYbGJRLw4X276wLaYulltFf9 SnoWCvw1kVTF2sGnftfxGf5wV4rYzFcev+SsbjN/qFs3qblAbzTzjXFNqGvYAaai rdXKxVuyPwj4VB0ASqr6JOvZJCitvbvISNoaPqtEhPwrxpThrE8QaKTXIhgSZMSX Py1GdmcV0AtKFxEuF/QoWoZYkcSZNFBftpEDGT1Yu0yIE5HBuqfp2VejD4thWGDP V08CdQkhhwO/AoPHZlLx06PDGQEOjdSJZGH3izBUpVv8bCsmzkYx1bf76ysSd6Tg == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedugedrudegiedgudeihecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfgh necuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmd enucfjughrpefhvffujghffgffkfggtgesghdtreertdertdenucfhrhhomhepofgrrhhi uhhsuceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheqnecukfhppe ekgedrvddtvddrieekrdejheenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhep mhgrihhlfhhrohhmpehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhm X-ME-Proxy: Received: from localhost (ti0006q161-2604.bb.online.no [84.202.68.75]) by mail.messagingengine.com (Postfix) with ESMTPA id 6280D3060FE7; Sun, 22 Mar 2020 18:30:48 -0400 (EDT) From: Marius Bakke To: mikael@djurfeldt.com, Ludovic =?utf-8?Q?Court=C3=A8s?= Subject: Re: bug#40125: Problem with guix offload: Remote channel closed In-Reply-To: References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> <8736a0uni2.fsf@gnu.org> User-Agent: Notmuch/0.29.3 (https://notmuchmail.org) Emacs/26.3 (x86_64-pc-linux-gnu) Date: Sun, 22 Mar 2020 23:30:45 +0100 Message-ID: <87d0943tuy.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 40125 Cc: 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain Mikael Djurfeldt writes: > The PATH of the build machine user is: > > /home/guix/.guix-profile/bin:/home/guix/.config/guix/current/bin:/usr/local/bin:/usr/bin:/bin:/usr/local/games:/usr/games:/usr/lib/jvm/java-8-oracle/bin:/usr/lib/jvm/java-8-oracle/db/bin:/usr/lib/jvm/java-8-oracle/jre/bin:/opt/thinlinc/bin Do you get the same result if you run: ssh wand 'echo $PATH' ? It might be .bashrc is configured not to source the relevant scripts when being invoked non-interactively, and/or through an SSH session. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl535xUACgkQoqBt8qM6 VPqfLQf/RMDIgSSsjITty+Q7DYmN5XSrvvs9c2pQA1WOOOfdmklMkwO/zzkf6Te5 YeF3MxtbySfEWnHP/n0JyyKoJszh/4+VkEyoTkh6+lcXblAap7W2JyNXsYqwdemh 5RSss9cy2/OZnUp/ns2ryptfb1bQLJ0Jq1mrWUx5SpCSpHst8CfwlPozTSSZm+Vi Hl+y7Lu4u5Xw6n4mDkzvO2dIo5iCCqjf8BA1C9YjunseHSsi87synHb4K+gIk/AX GwPqqiB9lfi08EC12/Q5/cn/neJRvBdXuVmWHBzmsgUZ7EsYVZBNQkkUG/bim3dY VS7O7NNZjMv0JCeTrOcHv/VkHKR2jA== =/Bxk -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 22 18:44:47 2020 Received: (at 40125) by debbugs.gnu.org; 22 Mar 2020 22:44:48 +0000 Received: from localhost ([127.0.0.1]:51125 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG9Kp-0000ej-Jh for submit@debbugs.gnu.org; Sun, 22 Mar 2020 18:44:47 -0400 Received: from mail-vs1-f41.google.com ([209.85.217.41]:39451) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG9Kn-0000eT-70 for 40125@debbugs.gnu.org; Sun, 22 Mar 2020 18:44:46 -0400 Received: by mail-vs1-f41.google.com with SMTP id j128so984137vsd.6 for <40125@debbugs.gnu.org>; Sun, 22 Mar 2020 15:44:45 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:reply-to :from:date:message-id:subject:to:cc; bh=SvkIjUhwFxGokjJ2jPPNWuYR5UOAvP/VFDdOMbetrpY=; b=S61rcA7DduvgCfoSQMtllXRveth76KGh6abM+X8W0DSVFyAkdrP5X2tIeEcsoBMB9f 16iKy+UnXyTHoPwWD3tzstBFpni91/ruJsinkLM7G7bHXJc99QAmANL0AP9wheCUsTer plzsY1iiQHv1d7Gx/vYMIMg83xils0C+sUfPcZij0Yc94GVNB136LfdsrQqKVrQTX4zV KnHfgaV2RK28RDIJr9fUIcvpLQ2c8FygnkkbJbB7ZVBSz8MbaUufUZa9yteNpqJ7rvlj SoJH1pMyNFe8v5tXT3ywlCnEOm4rQwAUKQyTO3tLoZ7eI36htNFoI806qbK8uv2+UPqZ jOHA== X-Gm-Message-State: ANhLgQ02WRQDTWgdRF6+YkpRXsxKrxRTaFabpsKkbFnnyd+fEkQYOUE+ v0la3b2O0CTk7YV8yoUeW91vReRupfSYPmkUZrU= X-Google-Smtp-Source: ADFU+vsNwKm+UTXazQg4wiaLtyRhlabEble3T41NSkiGyedw0kAnyiiPyV1PUuxXn09YTxQxNpz7L4FXhoTCcwhmFfw= X-Received: by 2002:a67:1303:: with SMTP id 3mr12811965vst.140.1584917079754; Sun, 22 Mar 2020 15:44:39 -0700 (PDT) MIME-Version: 1.0 References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> <8736a0uni2.fsf@gnu.org> <87d0943tuy.fsf@devup.no> In-Reply-To: <87d0943tuy.fsf@devup.no> From: Mikael Djurfeldt Date: Sun, 22 Mar 2020 23:44:28 +0100 Message-ID: Subject: Re: bug#40125: Problem with guix offload: Remote channel closed To: Marius Bakke Content-Type: multipart/alternative; boundary="000000000000898d1e05a1794360" X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 40125 Cc: =?UTF-8?Q?Ludovic_Court=C3=A8s?= , 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: mikael@djurfeldt.com Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --000000000000898d1e05a1794360 Content-Type: text/plain; charset="UTF-8" On Sun, Mar 22, 2020 at 11:30 PM Marius Bakke wrote: > Mikael Djurfeldt writes: > > > The PATH of the build machine user is: > > > > > /home/guix/.guix-profile/bin:/home/guix/.config/guix/current/bin:/usr/local/bin:/usr/bin:/bin:/usr/local/games:/usr/games:/usr/lib/jvm/java-8-oracle/bin:/usr/lib/jvm/java-8-oracle/db/bin:/usr/lib/jvm/java-8-oracle/jre/bin:/opt/thinlinc/bin > > Do you get the same result if you run: > > ssh wand 'echo $PATH' > > ? > > It might be .bashrc is configured not to source the relevant scripts > when being invoked non-interactively, and/or through an SSH session. > You're right. It doesn't source the scripts. The PATH only becomes /usr/local/bin:/usr/bin:/bin:/usr/games in this case. --000000000000898d1e05a1794360 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
Mikael Djurfeldt <mikael@djurfeldt.com> writes:

> The PATH of the build machine user is:
>
> /home/guix/.guix-profile/bin:/home/guix/.config/guix/current/bin:/usr/= local/bin:/usr/bin:/bin:/usr/local/games:/usr/games:/usr/lib/jvm/java-8-ora= cle/bin:/usr/lib/jvm/java-8-oracle/db/bin:/usr/lib/jvm/java-8-oracle/jre/bi= n:/opt/thinlinc/bin

Do you get the same result if you run:

=C2=A0 ssh wand 'echo $PATH'

?

It might be .bashrc is configured not to source the relevant scripts
when being invoked non-interactively, and/or through an SSH session.

You're right. It doesn't source the s= cripts. The PATH only becomes /usr/local/bin:/usr/bin:/bin:/usr/games in th= is case.
=C2=A0
--000000000000898d1e05a1794360-- From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 22 18:59:04 2020 Received: (at 40125) by debbugs.gnu.org; 22 Mar 2020 22:59:04 +0000 Received: from localhost ([127.0.0.1]:51136 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG9Ye-00013m-7N for submit@debbugs.gnu.org; Sun, 22 Mar 2020 18:59:04 -0400 Received: from out2-smtp.messagingengine.com ([66.111.4.26]:53409) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG9Yd-00013H-24 for 40125@debbugs.gnu.org; Sun, 22 Mar 2020 18:59:03 -0400 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id DE4DC5C0143; Sun, 22 Mar 2020 18:58:57 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute4.internal (MEProxy); Sun, 22 Mar 2020 18:58:57 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=JVCQ0YaMAm6Fiq8W9C8DqujfHY 5dmw69rmioP3NaCOI=; b=WrbuZfNpQ02eKEC8UPrrCkpPSmEmaTqLs+zYyaMHe2 XEaGL4ghU9IejcjGu3d+HQhD5KOXkK069eGZOkS9f6+47Tsg41jYV1jatcs1wsdv RMbVAY7oFc4LXWiva8AnT1BIK6DmB8/jHZapg8jHkpmP+QN6CdgQYiszg9Ayv/5N n8ZuqXFTP6cAKn/z2QNQjQTgFaLdGVnoQ4ygf2SJ50SrzZptB/lAhLDSPRbB3F6I Ewuaafi44UEFzwFCZD1tLvM28Hp2h3rKSc7agnq3p40T+QvDHHMresYWzJJxpFwC DCBX++QM+dL31uoLXET0ew8/XEgS9e2w8IwSvz419RAQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=JVCQ0Y aMAm6Fiq8W9C8DqujfHY5dmw69rmioP3NaCOI=; b=x3jkNZmEWaQHrZVrUqV1sl v0FLT75q8TVtWqji1k9Q7WGIXlH4q3so2kz7WbHD1uOu2jWAUTpBgVG2lIM071ZB BiUb7RcpWorKZN182GlSUvUZVn8uml2aLbpHoTNEBvhmVNggaNhHxDyHcmDzSWtL UxiGuKqWTgrbirjU+LSkNiQOyqeP1hiDqgNC8i6F0Z2hZaRMbopT+Qslkt9mhwVf gjsXmDZ56o1b2bGSQbJE9tZXxNV9RnpqZJCtGMi4Rl5RbdHmZXgdzWuubPZoDdfp GfDCaORc0i81UvknDh0c/gcujFHqaO8KeVoGAZWJdCGCBhUfoHPOeV6tyZx9ecPA == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedugedrudegiedgudejtdcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfgh necuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmd enucfjughrpefhvffujghffgffkfggtgesghdtreertdertdenucfhrhhomhepofgrrhhi uhhsuceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheqnecukfhppe ekgedrvddtvddrieekrdejheenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhep mhgrihhlfhhrohhmpehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhm X-ME-Proxy: Received: from localhost (ti0006q161-2604.bb.online.no [84.202.68.75]) by mail.messagingengine.com (Postfix) with ESMTPA id 438573061856; Sun, 22 Mar 2020 18:58:57 -0400 (EDT) From: Marius Bakke To: mikael@djurfeldt.com Subject: Re: bug#40125: Problem with guix offload: Remote channel closed In-Reply-To: References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> <8736a0uni2.fsf@gnu.org> <87d0943tuy.fsf@devup.no> User-Agent: Notmuch/0.29.3 (https://notmuchmail.org) Emacs/26.3 (x86_64-pc-linux-gnu) Date: Sun, 22 Mar 2020 23:58:55 +0100 Message-ID: <87a7483sk0.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 40125 Cc: Ludovic =?utf-8?Q?Court=C3=A8s?= , 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain Mikael Djurfeldt writes: >> It might be .bashrc is configured not to source the relevant scripts >> when being invoked non-interactively, and/or through an SSH session. >> > > You're right. It doesn't source the scripts. The PATH only becomes > /usr/local/bin:/usr/bin:/bin:/usr/games in this case. On Guix System, the default .bashrc does this: if [[ $- != *i* ]] then # We are being invoked from a non-interactive shell. If this # is an SSH session (as in "ssh host command"), source # /etc/profile so we get PATH and other essential variables. [[ -n "$SSH_CLIENT" ]] && source /etc/profile # Don't do anything else. return fi IIRC Debian does something similar to detect if being invoked non-interactively, but then just returns instead of sourcing anything. Adding a line that sources ~/.guix-profile/etc/profile before the check for an interactive shell might be enough in that case. HTH, Marius --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl537a8ACgkQoqBt8qM6 VPqDBAgAwpbTilYRyr7T54ErSvY1dMZyHojixTYvVT6JMWL67X0sJFkCxtH3YLW4 RDzmw6AzsFnsGypwNrz/QQ7a4ztyJTXzGs8N1Ay2+saNBqTbBLpUZIeQ6uYm/a02 efUCUnjZJorgep1ccvC6ipoZvyQjWejA4UFiGPXXPKtSUgvqPBoXqITYxDcre+oy 0w3Vw4BK6Fm3ogN1BNfkbUy/DhRDmQmxueTAytRHdEmTTBRRfPBeSndYM7dWo/Sk /qkHELtHdeR6Yk223IkYn97dWCmD9FH8nkC2obSZMEhpRCSQCDtodBgzEOW+lPbA otkoP2A7Xk+slfh2MhYTEqXNVwmykg== =qt7Z -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 22 19:13:13 2020 Received: (at 40125) by debbugs.gnu.org; 22 Mar 2020 23:13:14 +0000 Received: from localhost ([127.0.0.1]:51140 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG9mJ-0001T7-Fd for submit@debbugs.gnu.org; Sun, 22 Mar 2020 19:13:12 -0400 Received: from mail-ua1-f41.google.com ([209.85.222.41]:39658) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jG9mC-0001SR-8t for 40125@debbugs.gnu.org; Sun, 22 Mar 2020 19:13:06 -0400 Received: by mail-ua1-f41.google.com with SMTP id o16so4335322uap.6 for <40125@debbugs.gnu.org>; Sun, 22 Mar 2020 16:13:04 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:reply-to :from:date:message-id:subject:to:cc; bh=O6RmNp6Cx56AdAQhta+sj/2TYCZ1tX7F8fi/1VlgMxg=; b=lx/Sr/iZkhEeN/8/5vxWCAC4M8m2s7SvSI0cc0NnACoq7ihqeoULsNvH6wS7ACYpqY 1Bg8BLsCBpqgsK5Bfts0E5xOd8/oCK5OBcjCfEvmjaqFvwviptnadacVO6L4pb/58deH lVIqo5YqOFb9Jpp7642GLwEziHclga+iGOJr46pGEtOB1BMIRedKZI9JwDPzU024nnX8 rv1s1TV5z6NIKiIBdXz1I9pZQDZEtgVKNiBaqkItDtYbzxFYr4NhGOAOVe6itdXFmHJ/ xjS/0NxQr5O40xIXxE6I/Y8y+2jF5edDo9gw3w8jVIJ40rpsuuIqLT/U8zfe7zcEt0uq a04g== X-Gm-Message-State: ANhLgQ1xfZLJRhSiBBkw83+wNcNsONLcYZLF37cdQrGm4ksNkTiS9eKa znVtlWihrVddPKHfa1yXu16+4Qsx6J3P7yI41ho= X-Google-Smtp-Source: ADFU+vta9uN4ZfGKbaW6493x6/+Wrs+z98s6P8cCAyI/YOqeXDOqepgOqHoBItVAAn5ZfYzPWKaCi38WomA2ZSd/JWA= X-Received: by 2002:a9f:3b02:: with SMTP id i2mr11465538uah.33.1584918778858; Sun, 22 Mar 2020 16:12:58 -0700 (PDT) MIME-Version: 1.0 References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> <8736a0uni2.fsf@gnu.org> <87d0943tuy.fsf@devup.no> <87a7483sk0.fsf@devup.no> In-Reply-To: <87a7483sk0.fsf@devup.no> From: Mikael Djurfeldt Date: Mon, 23 Mar 2020 00:12:47 +0100 Message-ID: Subject: Re: bug#40125: Problem with guix offload: Remote channel closed To: Marius Bakke Content-Type: multipart/alternative; boundary="000000000000cfd22005a179a85e" X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 40125 Cc: =?UTF-8?Q?Ludovic_Court=C3=A8s?= , 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: mikael@djurfeldt.com Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --000000000000cfd22005a179a85e Content-Type: text/plain; charset="UTF-8" On Sun, Mar 22, 2020 at 11:59 PM Marius Bakke wrote: > Mikael Djurfeldt writes: > > >> It might be .bashrc is configured not to source the relevant scripts > >> when being invoked non-interactively, and/or through an SSH session. > >> > > > > You're right. It doesn't source the scripts. The PATH only becomes > > /usr/local/bin:/usr/bin:/bin:/usr/games in this case. > > On Guix System, the default .bashrc does this: > > if [[ $- != *i* ]] > then > # We are being invoked from a non-interactive shell. If this > # is an SSH session (as in "ssh host command"), source > # /etc/profile so we get PATH and other essential variables. > [[ -n "$SSH_CLIENT" ]] && source /etc/profile > > # Don't do anything else. > return > fi > > IIRC Debian does something similar to detect if being invoked > non-interactively, but then just returns instead of sourcing anything. > > Adding a line that sources ~/.guix-profile/etc/profile before the check > for an interactive shell might be enough in that case. > I examined this a bit. You're right about .bashrc. But sourcing that profile is not sufficient. Just as a test, I enabled user specified environments in sshd_config (such that ssh reads .ssh/environment) and added the following there: PATH=/gnu/store/0awhym5h0m890n0wq87y0dxznh14rk88-guile-next-3.0.1/bin:/home/guix/.guix-profile/bin:/usr/local/bin:/usr/bin:/bin:/usr/games GUILE_LOAD_COMPILED_PATH=/gnu/store/nkh7c4ygaivfxdq3zhccl4a5qxrn6s88-guix-module-union/lib/guile/3.0/site-ccache:/gnu/store/0awhym5h0m890n0wq87y0dxznh14rk88-guile-next-3.0.1/lib/guile/3.0/ccache GUILE_LOAD_PATH=/gnu/store/nkh7c4ygaivfxdq3zhccl4a5qxrn6s88-guix-module-union/share/guile/site/3.0:/gnu/store/0awhym5h0m890n0wq87y0dxznh14rk88-guile-next-3.0.1/share/guile/3.0 GUIX_PROFILE=/home/guix/.guix-profile GUIX_LOCPATH=/home/guix/.guix-profile/lib/locale This made the offload test work. Crucial here is the PATH to guile 3.0.1 as well as the GUILE_LOAD_* paths. But how are these *supposed* to be setup on the build host??? --000000000000cfd22005a179a85e Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
On Sun, Mar 22, 2020 at 11:59 PM Marius B= akke <mbakke@fastmail.com>= wrote:
Mikael Djurfeldt <mikael@djurfeldt.com> writes:

>> It might be .bashrc is configured not to source the relevant scrip= ts
>> when being invoked non-interactively, and/or through an SSH sessio= n.
>>
>
> You're right. It doesn't source the scripts. The PATH only bec= omes
> /usr/local/bin:/usr/bin:/bin:/usr/games in this case.

On Guix System, the default .bashrc does this:

if [[ $- !=3D *i* ]]
then
=C2=A0 =C2=A0 # We are being invoked from a non-interactive shell.=C2=A0 If= this
=C2=A0 =C2=A0 # is an SSH session (as in "ssh host command"), sou= rce
=C2=A0 =C2=A0 # /etc/profile so we get PATH and other essential variables.<= br> =C2=A0 =C2=A0 [[ -n "$SSH_CLIENT" ]] && source /etc/profi= le

=C2=A0 =C2=A0 # Don't do anything else.
=C2=A0 =C2=A0 return
fi

IIRC Debian does something similar to detect if being invoked
non-interactively, but then just returns instead of sourcing anything.

Adding a line that sources ~/.guix-profile/etc/profile before the check
for an interactive shell might be enough in that case.

I examined this a bit. You're right about .bashrc. But = sourcing that profile is not sufficient.

Just as a= test, I enabled user specified environments in sshd_config (such that ssh = reads .ssh/environment) and added the following there:

=
PATH=3D/gnu/store/0awhym5h0m890n0wq87y0dxznh14rk88-guile-next-3.0.1/bi= n:/home/guix/.guix-profile/bin:/usr/local/bin:/usr/bin:/bin:/usr/games
G= UILE_LOAD_COMPILED_PATH=3D/gnu/store/nkh7c4ygaivfxdq3zhccl4a5qxrn6s88-guix-= module-union/lib/guile/3.0/site-ccache:/gnu/store/0awhym5h0m890n0wq87y0dxzn= h14rk88-guile-next-3.0.1/lib/guile/3.0/ccache
GUILE_LOAD_PATH=3D/gnu/sto= re/nkh7c4ygaivfxdq3zhccl4a5qxrn6s88-guix-module-union/share/guile/site/3.0:= /gnu/store/0awhym5h0m890n0wq87y0dxznh14rk88-guile-next-3.0.1/share/guile/3.= 0
GUIX_PROFILE=3D/home/guix/.guix-profile
GUIX_LOCPATH=3D/home/guix/.= guix-profile/lib/locale

This made the offload test= work.

Crucial here is the PATH to guile 3.0.1 as = well as the GUILE_LOAD_* paths.

But how are these = *supposed* to be setup on the build host???
--000000000000cfd22005a179a85e-- From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 22 19:28:23 2020 Received: (at 40125) by debbugs.gnu.org; 22 Mar 2020 23:28:23 +0000 Received: from localhost ([127.0.0.1]:51147 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jGA11-0001tl-2n for submit@debbugs.gnu.org; Sun, 22 Mar 2020 19:28:23 -0400 Received: from mail-vs1-f41.google.com ([209.85.217.41]:46895) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jGA0z-0001tX-6p for 40125@debbugs.gnu.org; Sun, 22 Mar 2020 19:28:21 -0400 Received: by mail-vs1-f41.google.com with SMTP id z125so7574867vsb.13 for <40125@debbugs.gnu.org>; Sun, 22 Mar 2020 16:28:21 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:reply-to :from:date:message-id:subject:to:cc; bh=VPRg622Y8Gif/LqM1vGOlg5HAejFipetqo2Lvn0BE/Q=; b=ANxJqxpXYZq2mW0tmdSBC1ph3329zHVUNnmY/WlDKyADOTr2dHGKFD+kgPxgw+ItFp Zo4xRBP92SgJYmZC8nbDD5jS3Og/tboTk7FEFCZHB5BH6cHvlEVArCZFLNj5bZ4KJ1dj zJh70EQKMz8D3yduqpH+GfdyNVFMyZNEPQMcvEx/E4chpWv6frXt77aOlzdnsDpsyDQD Ab9p9hvwVFe0Zj5xtKKv6CGEEt7+H5K5Wa2SESDABoZRzbMenko92rWVrI72NgWH/pu/ VJWWP3U+ODAMgE8Jf+3it1V+Q4eKw1CPx8zf+VpqhWWjfS/gYZme33Lv9EK8Cou7cieP 9Dgg== X-Gm-Message-State: ANhLgQ1pm5zQU1i+8K00MJNdRfrhg/lbSW92W6GhE5YRaM+OF9FWbxqq Exf33IWppA92M2u8d8HBzNHNVC85lqHGQekF/Go= X-Google-Smtp-Source: ADFU+vsLCprD+l8pxqf9dqH0Gafa5c64xsCtX95F9lS+cXM928oV4gz5id6u8FNf7cpDfilNrICkaEQmImlP40p0QiM= X-Received: by 2002:a67:2904:: with SMTP id p4mr1468855vsp.101.1584919695741; Sun, 22 Mar 2020 16:28:15 -0700 (PDT) MIME-Version: 1.0 References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> <8736a0uni2.fsf@gnu.org> <87d0943tuy.fsf@devup.no> <87a7483sk0.fsf@devup.no> In-Reply-To: From: Mikael Djurfeldt Date: Mon, 23 Mar 2020 00:28:04 +0100 Message-ID: Subject: Re: bug#40125: Problem with guix offload: Remote channel closed To: Marius Bakke Content-Type: multipart/alternative; boundary="0000000000007657ea05a179df17" X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 40125 Cc: =?UTF-8?Q?Ludovic_Court=C3=A8s?= , 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: mikael@djurfeldt.com Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --0000000000007657ea05a179df17 Content-Type: text/plain; charset="UTF-8" On Mon, Mar 23, 2020 at 12:12 AM Mikael Djurfeldt wrote: > > Just as a test, I enabled user specified environments in sshd_config (such > that ssh reads .ssh/environment) and added the following there: > > > PATH=/gnu/store/0awhym5h0m890n0wq87y0dxznh14rk88-guile-next-3.0.1/bin:/home/guix/.guix-profile/bin:/usr/local/bin:/usr/bin:/bin:/usr/games > > GUILE_LOAD_COMPILED_PATH=/gnu/store/nkh7c4ygaivfxdq3zhccl4a5qxrn6s88-guix-module-union/lib/guile/3.0/site-ccache:/gnu/store/0awhym5h0m890n0wq87y0dxznh14rk88-guile-next-3.0.1/lib/guile/3.0/ccache > > GUILE_LOAD_PATH=/gnu/store/nkh7c4ygaivfxdq3zhccl4a5qxrn6s88-guix-module-union/share/guile/site/3.0:/gnu/store/0awhym5h0m890n0wq87y0dxznh14rk88-guile-next-3.0.1/share/guile/3.0 > GUIX_PROFILE=/home/guix/.guix-profile > GUIX_LOCPATH=/home/guix/.guix-profile/lib/locale > > This made the offload test work. > > Crucial here is the PATH to guile 3.0.1 as well as the GUILE_LOAD_* paths. > > But how are these *supposed* to be setup on the build host??? > Just to be clear: You're right that this can be done without .ssh/environment and just using a modified .bashrc. But how am I supposed to retrieve all those PATHS in a way that doesn't have to be modified as I update guix? --0000000000007657ea05a179df17 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
On Mon, Mar 23, 2020 at 12:12 AM Mikael D= jurfeldt <mikael@djurfeldt.com> wrote:
=C2=A0
=
Just as a test, I enabled user specified environments in sshd_config (= such that ssh reads .ssh/environment) and added the following there:
<= div>
PATH=3D/gnu/store/0awhym5h0m890n0wq87y0dxznh14rk88-guile= -next-3.0.1/bin:/home/guix/.guix-profile/bin:/usr/local/bin:/usr/bin:/bin:/= usr/games
GUILE_LOAD_COMPILED_PATH=3D/gnu/store/nkh7c4ygaivfxdq3zhccl4a5= qxrn6s88-guix-module-union/lib/guile/3.0/site-ccache:/gnu/store/0awhym5h0m8= 90n0wq87y0dxznh14rk88-guile-next-3.0.1/lib/guile/3.0/ccache
GUILE_LOAD_P= ATH=3D/gnu/store/nkh7c4ygaivfxdq3zhccl4a5qxrn6s88-guix-module-union/share/g= uile/site/3.0:/gnu/store/0awhym5h0m890n0wq87y0dxznh14rk88-guile-next-3.0.1/= share/guile/3.0
GUIX_PROFILE=3D/home/guix/.guix-profile
GUIX_LOCPATH= =3D/home/guix/.guix-profile/lib/locale

This made t= he offload test work.

Crucial here is the PATH to = guile 3.0.1 as well as the GUILE_LOAD_* paths.

But= how are these *supposed* to be setup on the build host???
<= /div>

--0000000000007657ea05a179df17-- From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 22 19:41:09 2020 Received: (at 40125) by debbugs.gnu.org; 22 Mar 2020 23:41:09 +0000 Received: from localhost ([127.0.0.1]:51178 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jGADM-0002Je-Lr for submit@debbugs.gnu.org; Sun, 22 Mar 2020 19:41:08 -0400 Received: from out2-smtp.messagingengine.com ([66.111.4.26]:34187) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jGADK-0002Iy-25 for 40125@debbugs.gnu.org; Sun, 22 Mar 2020 19:41:07 -0400 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id DE1C75C01EB; Sun, 22 Mar 2020 19:41:00 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute4.internal (MEProxy); Sun, 22 Mar 2020 19:41:00 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=ltXYuUdXS4utmTFiuC7m/xP68L XrqZreV2j451UwC4A=; b=RSkJvVY9PVjLZZtlQxl/+kHZGp64jYMeicVz/it2hh 4QwF54/iX3aB1Gd4cyznKncf1x7WqVPf6PbyYAMv2yxO19+ophlID8FNHU+Yk8VR fyAh3rnmeoRYETE1A9KtunWHFWnNKum93ZkBl5Vu45/OFx/A9aNORWdbbfc5bE9v orNjae7Q8yKU/jxW3yqc+SifGRN+wUMGaVO796nPnNUQ9vxKBgPKmsQuTM9O/quA +XpgBIQSSltV1UCdMNxhhKwW/W3jiz470O1MG5TERaVD/I0Atli4jmRGvrt2iB5V ixZnPm7BqjLgZleum4/E2UyGqNnRnuJ7qktliNI/iyrA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=ltXYuU dXS4utmTFiuC7m/xP68LXrqZreV2j451UwC4A=; b=GrsAlPJ91c/B9Iu0tnAC6K AHsHCT7OzOowgQOC6SgPP8FKs810QE2VK/WNLZvj8O8lkp6GABp6f7p6zxdAxGjP BzLx3T+y4Hp2SLEM1WQ0MV5RTBhzA3YNUXctvakmpYyNH4fD1nkbzo/LlnF2waaI c4sJ4NhdWBuDkw6uLBu9zPBKpkx79NEJz1cxIWtDI6jaJfqCjtWIoRm4xPUNaYwn nNOiuTWP9savg6P67blg+UlCBwQcHwb1ZXWBtLwHaAs23NEzSu7f3P7hJxtjpL4+ XOg6fVQxydk6CJ0jQOusYKz8QwMd3X0Jf+rNM6SFeUgkZm+68lgM1hBKK/x+IaJg == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedugedrudegjedgtdduucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmne cujfgurhephffvufgjfhgffffkgggtsehgtderredtredtnecuhfhrohhmpeforghrihhu shcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeenucfkphepke egrddvtddvrdeikedrjeehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehm rghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrghilhdrtghomh X-ME-Proxy: Received: from localhost (ti0006q161-2604.bb.online.no [84.202.68.75]) by mail.messagingengine.com (Postfix) with ESMTPA id 1A7503061856; Sun, 22 Mar 2020 19:40:59 -0400 (EDT) From: Marius Bakke To: mikael@djurfeldt.com Subject: Re: bug#40125: Problem with guix offload: Remote channel closed In-Reply-To: References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> <8736a0uni2.fsf@gnu.org> <87d0943tuy.fsf@devup.no> <87a7483sk0.fsf@devup.no> User-Agent: Notmuch/0.29.3 (https://notmuchmail.org) Emacs/26.3 (x86_64-pc-linux-gnu) Date: Mon, 23 Mar 2020 00:40:53 +0100 Message-ID: <874kug3qm2.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 40125 Cc: Ludovic =?utf-8?Q?Court=C3=A8s?= , 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain Mikael Djurfeldt writes: > Just as a test, I enabled user specified environments in sshd_config (such > that ssh reads .ssh/environment) and added the following there: > > PATH=/gnu/store/0awhym5h0m890n0wq87y0dxznh14rk88-guile-next-3.0.1/bin:/home/guix/.guix-profile/bin:/usr/local/bin:/usr/bin:/bin:/usr/games > GUILE_LOAD_COMPILED_PATH=/gnu/store/nkh7c4ygaivfxdq3zhccl4a5qxrn6s88-guix-module-union/lib/guile/3.0/site-ccache:/gnu/store/0awhym5h0m890n0wq87y0dxznh14rk88-guile-next-3.0.1/lib/guile/3.0/ccache > GUILE_LOAD_PATH=/gnu/store/nkh7c4ygaivfxdq3zhccl4a5qxrn6s88-guix-module-union/share/guile/site/3.0:/gnu/store/0awhym5h0m890n0wq87y0dxznh14rk88-guile-next-3.0.1/share/guile/3.0 > GUIX_PROFILE=/home/guix/.guix-profile > GUIX_LOCPATH=/home/guix/.guix-profile/lib/locale > > This made the offload test work. > > Crucial here is the PATH to guile 3.0.1 as well as the GUILE_LOAD_* paths. > > But how are these *supposed* to be setup on the build host??? Installing 'guile' and 'guix' (or their Guile 3.0 equivalents) into the user profile is the simplest solution. Then you can just source ~/.guix-profile/etc/profile early in .bashrc, because it will contain all the relevant variables. Otherwise manipulating PATH and GUILE_LOAD_PATH directly seems like a fine solution to me, but you should refer to ~/.config/guix/current/share/guile and friends instead of /gnu/store/...guix-module-union/share/guile because the latter is prone to being garbage collected. Does that make sense? It might be useful to create a dedicated user account for this to avoid clobbering your regular dotfiles/profiles. I don't think there is an established practice here, so your feedback on this is very valuable! Offloading to a Guix System will just work, of course. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl5394UACgkQoqBt8qM6 VPouHAf9G/2RWj2jsX+tTCZbX1gIB7TsgVsYqWS/jKWLYJYp3czTLv3ElxoiX4kj J6Yjynk8ebU5YqrDLCSGkhzUGQS+WIPrlhs2JYPySzo9Snrujergx/cmYITB/dKO YgNdMF005lMbsBYBl0TFGQqfi+KkQtvAcCKgCFTOWu89+fWTA6+f8mfOwsuKWukC JCN4itFeGEbLRucwrR9frtE17Mcd6uGBnpzEqGfJuZQul0MlxOMkO4xuSTMge/OI BMYYpvNLfOH5vXWbt/QTPo5A7bLkFWdLsaYF4wjF6sbPfBdkPzOd875VdkJlCaUu SKbzVzze3foFu17PZcXzje6ZQFvtvA== =L/kB -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Mon Mar 23 05:50:12 2020 Received: (at 40125) by debbugs.gnu.org; 23 Mar 2020 09:50:12 +0000 Received: from localhost ([127.0.0.1]:51470 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jGJim-0001KY-Hm for submit@debbugs.gnu.org; Mon, 23 Mar 2020 05:50:12 -0400 Received: from eggs.gnu.org ([209.51.188.92]:41255) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jGJil-0001K7-E3 for 40125@debbugs.gnu.org; Mon, 23 Mar 2020 05:50:11 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:49674) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1jGJif-00021F-SL; Mon, 23 Mar 2020 05:50:05 -0400 Received: from [2a01:e0a:1d:7270:af76:b9b:ca24:c465] (port=41526 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1jGJif-0001Uf-0y; Mon, 23 Mar 2020 05:50:05 -0400 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Mikael Djurfeldt Subject: Re: bug#40125: Problem with guix offload: Remote channel closed References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> <8736a0uni2.fsf@gnu.org> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 4 Germinal an 228 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Mon, 23 Mar 2020 10:50:03 +0100 In-Reply-To: (Mikael Djurfeldt's message of "Sun, 22 Mar 2020 22:40:39 +0100") Message-ID: <87o8snqu2c.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 40125 Cc: 40125@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Hi Mikael, Mikael Djurfeldt skribis: > On Sun, Mar 22, 2020 at 9:46 PM Ludovic Court=C3=A8s wrote: > >> Mikael Djurfeldt skribis: >> >> We=E2=80=99re missing a tiny bit. :-) Could you run strace with =E2=80= =98-s 3000=E2=80=99 or >> similar so that it doesn=E2=80=99t truncate it? >> >> (The =E2=80=9Cstrange characters=E2=80=9D are Unicode HORIZONTAL ELLIPSI= S.) >> > > Ah... :) > > Here's a larger chunk of backtrace: > > 19530 read(20, "Backtrace:\n 13 (apply-smob/1 # 563a9e2f92a0>)\nIn ice-9/boot-9.scm:\n 718:2 12 (call-with-prompt > (\"prompt\") # \342\200\246)\nIn > ice-9/eval.scm:\n 619:8 11 (_ #(#(# 563a9e39a750>)))\nIn ice-9/command-line.scm:\n 181:18 10 (_ # string 563a9e3a8bd0>)\nIn unknown file:\n 9 (eval (begin > (use-modules (guix) (srfi srfi-34) # #) \342\200\246) #)\nIn > ice-9/eval.scm:\n 721:20 8 (primitive-eval (begin (use-modules (guix) > (srfi \342\200\246) \342\200\246) \342\200\246))\nIn ice-9/psyntax.scm:\n > 1241:36 7 (expand-top-sequence ((begin (use-modules (guix) \342\200\246) > \342\200\246)) \342\200\246)\n 1194:19 6 (parse _ ((\"placeholder\" > placeholder)) ((top) #(# # \342\200\246)) \342\200\246)\n 1233:19 5 > (parse _ ((\"placeholder\" placeholder)) ((top) #(# # \342\200\246)) > \342\200\246)\n 285:10 4 (parse _ ((\"placeholder\" placeholder)) (())= _ > c&e (eval) \342\200\246)\nIn ice-9/boot-9.scm:\n 3389:20 3 > (process-use-modules _)\n 222:17 2 (map1 (((guix)) ((srfi srfi-34)) > ((rnrs io ports)) (#)))\n 3390:31 1 (_ ((guix)))\n 2809:6 0 > (resolve-interface (guix) #:select _ #:hide _ #:prefix _ > \342\200\246)\n\nice-9/boot-9.scm:2809:6: In procedure > resolve-interface:\nno code for module (guix)\n", 16384) =3D 1150 Thanks! Commit 8f53d73493a2949e2db28cd7d689a690b2d9479a improves error reporting in this case. This can be tested by running =E2=80=9Cguix copy --to=3DHOST coreutils=E2= =80=9D for a host where Guix modules are missing. Thanks, Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Wed Aug 02 11:10:05 2023 Received: (at 40125-done) by debbugs.gnu.org; 2 Aug 2023 15:10:05 +0000 Received: from localhost ([127.0.0.1]:49962 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1qRDUD-0002bw-Cf for submit@debbugs.gnu.org; Wed, 02 Aug 2023 11:10:05 -0400 Received: from mail-qk1-x72d.google.com ([2607:f8b0:4864:20::72d]:53499) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1qRDUB-0002bK-4O for 40125-done@debbugs.gnu.org; Wed, 02 Aug 2023 11:10:03 -0400 Received: by mail-qk1-x72d.google.com with SMTP id af79cd13be357-76c7eb57c0bso379987985a.2 for <40125-done@debbugs.gnu.org>; Wed, 02 Aug 2023 08:10:03 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20221208; t=1690988997; x=1691593797; h=content-transfer-encoding:mime-version:user-agent:message-id :in-reply-to:date:references:subject:cc:to:from:from:to:cc:subject :date:message-id:reply-to; bh=2b8PFnY6Fgq1/DX24hf4QyzwP+6o37om/DPaXnxMw54=; b=F/R+ymxCwyV+76Ztmoh2jyKCta3JOCZsTyTWuov7Unkst4b8letrW/5Etg1gbrkS4Q XWmrfulaBInKCF4vBCiO+80vHYW0JmqkfCylu6r/vJvPFQlh85oQ6+dYzruomUTKKVus HDBGCfcbxgJ8sD7dJ0XY0+w3de4nELkQHlhSFWgyI99zB5/GNqg+oc2R48TVR2xhxF1/ SPeUAq5sGllD66uvAdSqPcGtFBs9B2vvFGWynQxHRYb9w+CaYyrHjk6+K5TBdTP68UKZ j6XnxZ6ziOMfr67j8zkdQ6U2/O3KcYGblLPu369REqEOg2dkpDtMO84vqw3LkqRi8Lxy Xw/g== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20221208; t=1690988997; x=1691593797; h=content-transfer-encoding:mime-version:user-agent:message-id :in-reply-to:date:references:subject:cc:to:from:x-gm-message-state :from:to:cc:subject:date:message-id:reply-to; bh=2b8PFnY6Fgq1/DX24hf4QyzwP+6o37om/DPaXnxMw54=; b=U1JJ1AwCZx5jxfm7an77P/9nmWjs4dJIaf0TxHY5d91hugc0MV3nqoVe3ATye5TxTq Pir9ax6qG3j4RMojSH4z2SU4AfylUuyqq4nap9Nq9z2u5P0Ncv29bQaIZNX7Tp/k6jPJ ZzdA4wxj3c0Ey50eMP6UUgCMR5EYi0ocFkCQAV5qdEWQaFSIsmCuPsnEoG0cGRBotOht 83yYb5VWiGAvGfsJ6yhDpF+jdrnFc0+FfdZcLkL4VmnTeI426qqDydiTh4gNKxnYkvC+ rdo2r6YA7q+HnUBHAxuSS4LSQ4t5x6sp9nr52ztE8Oi1fQC/+gVmDjH2NpTFsAQ1zFp+ oCiw== X-Gm-Message-State: ABy/qLbPK+hB1ldAd8ZKTG//5smz807OuvzUIVB29ehGwe8qZ0XgYLIg 7mMNN2zpSOl1EmMK1eO5VqTi2mCuw9IaDw== X-Google-Smtp-Source: APBJJlEMfrAsb/eLoLBwcqtZaJV9Dle25YyFu8LR+6qYMs2ya/WvDyIUsPt4TWkPSkkeiauYecxXLQ== X-Received: by 2002:a05:620a:2687:b0:76c:4388:faa7 with SMTP id c7-20020a05620a268700b0076c4388faa7mr19828252qkp.4.1690988997047; Wed, 02 Aug 2023 08:09:57 -0700 (PDT) Received: from hurd (dsl-10-141-235.b2b2c.ca. [72.10.141.235]) by smtp.gmail.com with ESMTPSA id t9-20020a05620a004900b00767c8308329sm272274qkt.25.2023.08.02.08.09.52 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Wed, 02 Aug 2023 08:09:56 -0700 (PDT) From: Maxim Cournoyer To: Ludovic =?utf-8?Q?Court=C3=A8s?= Subject: Re: bug#40125: Problem with guix offload: Remote channel closed References: <87eetl1zce.fsf@gnu.org> <87pnd5wdyq.fsf@gnu.org> <8736a0uni2.fsf@gnu.org> <87o8snqu2c.fsf@gnu.org> Date: Wed, 02 Aug 2023 11:09:45 -0400 In-Reply-To: <87o8snqu2c.fsf@gnu.org> ("Ludovic =?utf-8?Q?Court=C3=A8s=22'?= =?utf-8?Q?s?= message of "Mon, 23 Mar 2020 10:50:03 +0100") Message-ID: <871qglscp2.fsf@gmail.com> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/28.2 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 40125-done Cc: Mikael Djurfeldt , 40125-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hello, Ludovic Court=C3=A8s writes: > Hi Mikael, > > Mikael Djurfeldt skribis: > >> On Sun, Mar 22, 2020 at 9:46 PM Ludovic Court=C3=A8s wrot= e: >> >>> Mikael Djurfeldt skribis: >>> >>> We=E2=80=99re missing a tiny bit. :-) Could you run strace with =E2= =80=98-s 3000=E2=80=99 or >>> similar so that it doesn=E2=80=99t truncate it? >>> >>> (The =E2=80=9Cstrange characters=E2=80=9D are Unicode HORIZONTAL ELLIPS= IS.) >>> >> >> Ah... :) >> >> Here's a larger chunk of backtrace: >> >> 19530 read(20, "Backtrace:\n 13 (apply-smob/1 #> 563a9e2f92a0>)\nIn ice-9/boot-9.scm:\n 718:2 12 (call-with-prompt >> (\"prompt\") # \342\200\246)\nIn >> ice-9/eval.scm:\n 619:8 11 (_ #(#(#> 563a9e39a750>)))\nIn ice-9/command-line.scm:\n 181:18 10 (_ #> string 563a9e3a8bd0>)\nIn unknown file:\n 9 (eval (begin >> (use-modules (guix) (srfi srfi-34) # #) \342\200\246) #)\nIn >> ice-9/eval.scm:\n 721:20 8 (primitive-eval (begin (use-modules (guix) >> (srfi \342\200\246) \342\200\246) \342\200\246))\nIn ice-9/psyntax.scm:\n >> 1241:36 7 (expand-top-sequence ((begin (use-modules (guix) \342\200\24= 6) >> \342\200\246)) \342\200\246)\n 1194:19 6 (parse _ ((\"placeholder\" >> placeholder)) ((top) #(# # \342\200\246)) \342\200\246)\n 1233:19 5 >> (parse _ ((\"placeholder\" placeholder)) ((top) #(# # \342\200\246)) >> \342\200\246)\n 285:10 4 (parse _ ((\"placeholder\" placeholder)) (()= ) _ >> c&e (eval) \342\200\246)\nIn ice-9/boot-9.scm:\n 3389:20 3 >> (process-use-modules _)\n 222:17 2 (map1 (((guix)) ((srfi srfi-34)) >> ((rnrs io ports)) (#)))\n 3390:31 1 (_ ((guix)))\n 2809:6 0 >> (resolve-interface (guix) #:select _ #:hide _ #:prefix _ >> \342\200\246)\n\nice-9/boot-9.scm:2809:6: In procedure >> resolve-interface:\nno code for module (guix)\n", 16384) =3D 1150 > > Thanks! Commit 8f53d73493a2949e2db28cd7d689a690b2d9479a improves error > reporting in this case. > > This can be tested by running =E2=80=9Cguix copy --to=3DHOST coreutils=E2= =80=9D for a host > where Guix modules are missing. Great, closing! --=20 Thanks, Maxim From unknown Wed Jun 25 00:22:51 2025 Received: (at fakecontrol) by fakecontrolmessage; To: internal_control@debbugs.gnu.org From: Debbugs Internal Request Subject: Internal Control Message-Id: bug archived. Date: Thu, 31 Aug 2023 11:24:07 +0000 User-Agent: Fakemail v42.6.9 # This is a fake control message. # # The action: # bug archived. thanks # This fakemail brought to you by your local debbugs # administrator