From unknown Fri Sep 05 08:19:38 2025 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 X-Mailer: MIME-tools 5.509 (Entity 5.509) Content-Type: text/plain; charset=utf-8 From: bug#39941 <39941@debbugs.gnu.org> To: bug#39941 <39941@debbugs.gnu.org> Subject: Status: Disk-image size increase on core-updates. Reply-To: bug#39941 <39941@debbugs.gnu.org> Date: Fri, 05 Sep 2025 15:19:38 +0000 retitle 39941 Disk-image size increase on core-updates. reassign 39941 guix submitter 39941 Mathieu Othacehe severity 39941 normal thanks From debbugs-submit-bounces@debbugs.gnu.org Fri Mar 06 02:38:00 2020 Received: (at submit) by debbugs.gnu.org; 6 Mar 2020 07:38:00 +0000 Received: from localhost ([127.0.0.1]:43993 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jA7YV-0002tB-St for submit@debbugs.gnu.org; Fri, 06 Mar 2020 02:38:00 -0500 Received: from lists.gnu.org ([209.51.188.17]:60196) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jA7YT-0002t2-Tl for submit@debbugs.gnu.org; Fri, 06 Mar 2020 02:37:58 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:44189) by lists.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1jA7YS-00048N-U2 for bug-guix@gnu.org; Fri, 06 Mar 2020 02:37:57 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=0.8 required=5.0 tests=BAYES_50,FREEMAIL_FROM autolearn=disabled version=3.3.2 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1jA7YQ-00053z-Sb for bug-guix@gnu.org; Fri, 06 Mar 2020 02:37:56 -0500 Received: from mail-wm1-x331.google.com ([2a00:1450:4864:20::331]:33866) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_128_CBC_SHA1:16) (Exim 4.71) (envelope-from ) id 1jA7YO-0004yu-VN for bug-guix@gnu.org; Fri, 06 Mar 2020 02:37:53 -0500 Received: by mail-wm1-x331.google.com with SMTP id x3so3619022wmj.1 for ; Thu, 05 Mar 2020 23:37:52 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=user-agent:from:to:subject:date:message-id:mime-version; bh=LXymbcPje0Okvl2TTl2ZPtBt9iQVecAKNs/rElmt8eA=; b=O6BX9xodWNrrStqvasH7bG+/dokgwIsKsg1FtA4unOTLo9KYWIWsXJgAr6malmEoKN /GziXawkWhLtScTsJll5xOPdfohISk1hld8nQWpUB58inT5Fgi3mo2O59vVic0IG2/Bp YSIpUUwRdYArq9fBZcVKSDTHQfQHh/P3PImpl3BuMwhkO+AtXlw+r1U71xasBLjFqlFF ESzKvmNga6BYsuGrKeaah0U/ZwiOXVX5TPw0sLNyvMNDGzqla9sfXWHxyztsSfgtVjeg +w5/n3RQ4zKeiBS967z11IfG1ZhWB4IcRmVRBiMdEQSnNRdSxUrl/bwU+uUb+PBOZaKv oKtw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:user-agent:from:to:subject:date:message-id :mime-version; bh=LXymbcPje0Okvl2TTl2ZPtBt9iQVecAKNs/rElmt8eA=; b=R75XMnEe2YKRfOwQdPskbUYYkUU428i1vsp5N1zerwuYN0UjTsJX7HK+xb9DAduEMA pTw0oyQ1eY6Sw3IE94Gz1Ru3Q4PEl5yYg7UZpNNyMPwXnhTVcWVP0SmKu2YuC32sAwVd ehqS0cFLoMeMaeFHx9L5P4xEAzI99EZbB7EiypA1hB320OxKwm4lxtfDmwIjt1AK1HRc b7NjOGvpns0ZjKyj/4M6RsMAEv98oWByzqT7IqOhD46aykNkeqatsHfnak3Md0w4PnsR uPWTjQc8vHgMbkWoesYT3jkoeoHKlHdDM8LRW+STazsNw2t7Dgof04CCR5Zs8gNPdvqW 7WXA== X-Gm-Message-State: ANhLgQ3NcfwOnOsw6bJ2VqLqNHBuzrqF+CBGmN1byaGIxPhH4Y6RC+hZ EcDinqRBD3ZZ5+2+f4bIlK6eMLxL X-Google-Smtp-Source: ADFU+vuWa5kb3m66H5qFId4bY2NTJFQS9A7O94kw2nIVzMRNnc8OgeI6UQ+BP6uJ51pjRj0gxCsCKA== X-Received: by 2002:a1c:25c1:: with SMTP id l184mr2461803wml.122.1583480270328; Thu, 05 Mar 2020 23:37:50 -0800 (PST) Received: from meru (lfbn-ann-1-269-240.w86-200.abo.wanadoo.fr. [86.200.224.240]) by smtp.gmail.com with ESMTPSA id w206sm13130819wmg.11.2020.03.05.23.37.49 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Thu, 05 Mar 2020 23:37:49 -0800 (PST) User-agent: mu4e 1.2.0; emacs 26.3 From: Mathieu Othacehe To: bug-guix@gnu.org Subject: Disk-image size increase on core-updates. Date: Fri, 06 Mar 2020 08:37:48 +0100 Message-ID: <87sgimdjcj.fsf@gmail.com> MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="=-=-=" X-detected-operating-system: by eggs.gnu.org: Genre and OS details not recognized. X-Received-From: 2a00:1450:4864:20::331 X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --=-=-= Content-Type: text/plain Hello, When building the attached operating-system (very close to bare-bones.tmpl) with the following command: guix system disk-image --target=aarch64-linux-gnu mini.scm --no-grafts the produced disk-image weights 2.6G (2717242368 bytes). On the same branch in January it was around 1.5G. I'll check the same command for a native x86_64 system and report back. Mathieu --=-=-= Content-Type: application/octet-stream Content-Disposition: attachment; filename=mini.scm Content-Transfer-Encoding: base64 KHVzZS1tb2R1bGVzIChnbnUpCiAgICAgICAgICAgICAoZ251IGJvb3Rsb2FkZXIgdS1ib290KQog ICAgICAgICAgICAgKHNyZmkgc3JmaS0xKSkKKHVzZS1zZXJ2aWNlLW1vZHVsZXMgbmV0d29ya2lu ZykKCihvcGVyYXRpbmctc3lzdGVtCiAgKGhvc3QtbmFtZSAidmlnbmVtYWxlIikKICAodGltZXpv bmUgIkV1cm9wZS9QYXJpcyIpCiAgKGxvY2FsZSAiZW5fVVMudXRmOCIpCgogIChib290bG9hZGVy IChib290bG9hZGVyLWNvbmZpZ3VyYXRpb24KICAgICAgICAgICAgICAgKGJvb3Rsb2FkZXIgdS1i b290LXBpbmU2NC1sdHMtYm9vdGxvYWRlcikKICAgICAgICAgICAgICAgKHRhcmdldCAiL2Rldi92 ZGEiKSkpCgogIChrZXJuZWwtYXJndW1lbnRzICcoKSkKICAoaW5pdHJkLW1vZHVsZXMKICAgKGNv bnMqICJzdW54aS1tbWMiCiAgICAgICAgICAic2RfbW9kIgogICAgICAgICAgImF4cDIweC1yc2Ii CiAgICAgICAgICAiYXhwMjB4LXJlZ3VsYXRvciIKICAgICAgICAgICViYXNlLWluaXRyZC1tb2R1 bGVzKSkKCiAgKGZpbGUtc3lzdGVtcyAoY29ucyAoZmlsZS1zeXN0ZW0KICAgICAgICAgICAgICAg ICAgICAgICAgKGRldmljZSAoZmlsZS1zeXN0ZW0tbGFiZWwgIm15LXJvb3QiKSkKICAgICAgICAg ICAgICAgICAgICAgICAgKG1vdW50LXBvaW50ICIvIikKICAgICAgICAgICAgICAgICAgICAgICAg KHR5cGUgImV4dDQiKSkKICAgICAgICAgICAgICAgICAgICAgICViYXNlLWZpbGUtc3lzdGVtcykp CgogICh1c2VycyAoY29ucyAodXNlci1hY2NvdW50CiAgICAgICAgICAgICAgICAobmFtZSAibWF0 aGlldSIpCiAgICAgICAgICAgICAgICAoZ3JvdXAgInVzZXJzIikKICAgICAgICAgICAgICAgIChz dXBwbGVtZW50YXJ5LWdyb3VwcyAnKCJ3aGVlbCIgImF1ZGlvIiAidmlkZW8iKSkpCiAgICAgICAg ICAgICAgICViYXNlLXVzZXItYWNjb3VudHMpKQoKICAocGFja2FnZXMgJWJhc2UtcGFja2FnZXMp CiAgKHNlcnZpY2VzIChjb25zIChzZXJ2aWNlIGFnZXR0eS1zZXJ2aWNlLXR5cGUKICAgICAgICAg ICAgICAgICAgICAgICAgICAgKGFnZXR0eS1jb25maWd1cmF0aW9uCiAgICAgICAgICAgICAgICAg ICAgICAgICAgICAoZXh0cmEtb3B0aW9ucyAnKCItTCIpKSA7IG5vIGNhcnJpZXIgZGV0ZWN0CiAg ICAgICAgICAgICAgICAgICAgICAgICAgICAoYmF1ZC1yYXRlICIxMTUyMDAiKQogICAgICAgICAg ICAgICAgICAgICAgICAgICAgKHRlcm0gInZ0MTAwIikKICAgICAgICAgICAgICAgICAgICAgICAg ICAgICh0dHkgInR0eVMwIikpKQogICAgICAgICAgICAgICAgICAlYmFzZS1zZXJ2aWNlcykpKQo= --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Tue Mar 10 05:22:56 2020 Received: (at 39941) by debbugs.gnu.org; 10 Mar 2020 09:22:56 +0000 Received: from localhost ([127.0.0.1]:51862 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jBb6G-0003QM-5j for submit@debbugs.gnu.org; Tue, 10 Mar 2020 05:22:56 -0400 Received: from mail-wr1-f53.google.com ([209.85.221.53]:45816) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jBb6E-0003Q0-BO for 39941@debbugs.gnu.org; Tue, 10 Mar 2020 05:22:54 -0400 Received: by mail-wr1-f53.google.com with SMTP id m9so5825446wro.12 for <39941@debbugs.gnu.org>; Tue, 10 Mar 2020 02:22:54 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=references:user-agent:from:to:subject:in-reply-to:date:message-id :mime-version; bh=Iab+Yjk0usftGtly4zEwQjYxWuzznLJJUL6ldNG9/Ng=; b=WsGWj7VbJwrg5GEm+snEswrA4F1qG0vfz2vaqTb5emAkslUPmgof9a7fZliQtgYvP+ gab1JbpnrSpg7x6rPZA+uoJ5TShwfiaRfyp4qDyvgtUxBc4+0b6cFlysFEEOzXUBqWkI sAFMl5dtXVJrYzLPZ0NActSxVCyHrw+ccrL0FgYwPzzQliGwVA8XQjOwRJYB0Od+sbG0 lOz69+jnWIl2RvGVJ0Ou7AhAeHBEvCw+ijDm8/+blFaVCgqc1U/cVtfsAqz0CxcH7+0j t+e+MSldDic2d8hZBlR1LkXRT4VCvnjOzrEQCd6/LFzWq4+EHgvArvN6rMMGRESnDRQW FZQw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:references:user-agent:from:to:subject :in-reply-to:date:message-id:mime-version; bh=Iab+Yjk0usftGtly4zEwQjYxWuzznLJJUL6ldNG9/Ng=; b=gxWt7v7ajxygpx9IH+KJqoErlJmD2El7YZ73/Alsur/gKFr2HwSDHLYoysUjTs154I Ners+mMAAC2zXUzG97gcOwHHW6A/TWBUqLhpXRMhjuKzD88gLxSF+vVyBHcZbwhHHOP5 qb5KmoCjwWkyPokZ2LeqiAfjpur2zjvlJDAb6bSfO9v448lixWHpibtGvJorlh9UVRi3 rMV2ksO07geS2+TTaiU40B+Z+P3DEN5qnLrqK9i2DVE7wqotQuYY2LSMgLfjjNMD0o6K I9jAOVq1nJs/yENy4V8gXz844Di3CKpd7GLq3pUlEtvZmYVIuUeF4uf4nYHxk0+kfPA3 C6tg== X-Gm-Message-State: ANhLgQ1Pm4S1WSTNN/5YPU4o91DRLVXQSA3tJDsanTfz0UkvBuNklQ0n chUX2bs/i+x7eO6yBR5zL0qI8wJ2 X-Google-Smtp-Source: ADFU+vsLsqi8tn271c1Rob/digfpR1Ois6gribEHOCwTx8DtWMs/f/9gFinSozW0+10dLqVhT98vzA== X-Received: by 2002:a5d:604f:: with SMTP id j15mr22621294wrt.35.1583832168140; Tue, 10 Mar 2020 02:22:48 -0700 (PDT) Received: from meru (lfbn-ann-1-269-240.w86-200.abo.wanadoo.fr. [86.200.224.240]) by smtp.gmail.com with ESMTPSA id r28sm68537016wra.16.2020.03.10.02.22.45 for <39941@debbugs.gnu.org> (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Tue, 10 Mar 2020 02:22:47 -0700 (PDT) References: <87sgimdjcj.fsf@gmail.com> User-agent: mu4e 1.2.0; emacs 26.3 From: Mathieu Othacehe To: 39941@debbugs.gnu.org Subject: Re: bug#39941: Disk-image size increase on core-updates. In-reply-to: <87sgimdjcj.fsf@gmail.com> Date: Tue, 10 Mar 2020 10:22:45 +0100 Message-ID: <87eeu0h8d6.fsf@gmail.com> MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="=-=-=" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 39941 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --=-=-= Content-Type: text/plain The "guix size" report is attached. Several issues appear: * Inclusion of gcc-cross-sans-libc-aarch64-linux-gnu-7.5.0 and gcc-cross-aarch64-linux-gnu-7.5.0. * Three different versions of guile-2.2.6. * Duplicated glibc, bash and coreutils. Thanks, Mathieu --=-=-= Content-Type: application/octet-stream Content-Disposition: attachment; filename=size_core Content-Transfer-Encoding: base64 L2dudS9zdG9yZS94Y3h5d3F6aHd6MGZibnl5NWNzZjNnbnFobjM1bmNncy1kaXNrLWltYWdlICAg ICAgICAgICAgMzQ2Ni44ICAxOTY2LjEgIDU2LjclCi9nbnUvc3RvcmUvZzhwNjR3MDBrbnM5NjZ6 ZmN2aW5obGNtOWRwZnE0MXctZ3VpeC0xLjAuMS0xNC5jMmY5ZWEyICAgOTA4LjggICAyMTkuMiAg IDYuMyUKL2dudS9zdG9yZS8wdzFzNjJjbHFmczJibXYxbHYwZG5tMmhuczgwejdxcy1saW51eC1s aWJyZS01LjQuMjMgICAgIDIxNy42ICAgMjE3LjYgICA2LjMlCi9nbnUvc3RvcmUvcmtxcHMyYXIz N3B6cDg5Z3NoaW5yNnBmY2x5cm1oY24tZ2NjLWNyb3NzLWFhcmNoNjQtbGludXgtZ251LTcuNS4w ICAgNTI0LjUgICAxMDMuMCAgIDMuMCUKL2dudS9zdG9yZS9nejVjaGdmZ21yeHFoc3c5OXY0aTN6 c3ZwMmloajM3aS1sb2NhbGUtMi4zMSAgICAgICAgICAgICA5MS45ICAgIDkxLjkgICAyLjclCi9n bnUvc3RvcmUvZjA3eW0wMDV4Z2dyMmxkOWw5bmk3OGRsZ21seHN2YWQtZ2NjLWNyb3NzLXNhbnMt bGliYy1hYXJjaDY0LWxpbnV4LWdudS03LjUuMCAgIDM0My41ICAgIDc2LjAgICAyLjIlCi9nbnUv c3RvcmUvbXk4MzA3djhkMzloeDBhbWc4aTk0aXFkbjFkbWR3cjMtZ2xpYmMtY3Jvc3MtYWFyY2g2 NC1saW51eC1nbnUtMi4zMSAgIDQyMS41ICAgIDcxLjQgICAyLjElCi9nbnUvc3RvcmUvN2FjYXd3 bmYxeXJuaG13eHg3YzR3a3cybjJuOTFpOGQtYmludXRpbHMtY3Jvc3MtYWFyY2g2NC1saW51eC1n bnUtMi4zNCAgIDEwNC4xICAgIDY1LjggICAxLjklCi9nbnUvc3RvcmUvemZ5bGpkYzByeXBpMWti MWk0a25heXpsamx4MG56bngtYmludXRpbHMtMi4zNCAgICAgICAgICAgOTMuMCAgICA1NC42ICAg MS42JQovZ251L3N0b3JlL2NsNTd6cGFmMmk5MDcyaWxhMmoyeWp2N3hxOHFzaTBrLWd1aWxlLXN0 YXRpYy1zdHJpcHBlZC0yLjIuNiAgICA0NC43ICAgIDQ0LjcgICAxLjMlCi9nbnUvc3RvcmUvMGxm OWhrNmtneXIxNjhyNzQ3OWR5azQ2czN5YTYwZ2otZ3VpbGUtMi4yLjYgICAgICAgICAgICAxMjUu MSAgICA0NC40ICAgMS4zJQovZ251L3N0b3JlL2QzOHA3YXo1cDY2YTdnMzZ5YXBzamtsM2cyY2du ems0LWd1aWxlLTIuMi42ICAgICAgICAgICAgMTI1LjEgICAgNDQuNCAgIDEuMyUKL2dudS9zdG9y ZS84MjlxcW53bDNjbmFqbHgxNjhhd3ZxbnpmbHFuYXN5cS1ndWlsZS0yLjIuNiAgICAgICAgICAg IDU3Ny43ICAgIDQ0LjMgICAxLjMlCi9nbnUvc3RvcmUvdzAwamIxNzRhYmlrcXB6bmFkd3p2dmd3 bDNyN3FmemQtZ2xpYmMtMi4zMSAgICAgICAgICAgICAgMzguNCAgICAzNi43ICAgMS4xJQovZ251 L3N0b3JlLzZ3NWkydzNybnZqNWMxNDg2emZtY2Y4d2puMzZrbGMxLWdsaWJjLTIuMzEgICAgICAg ICAgICAgNDU2LjAgICAgMzMuMiAgIDEuMCUKL2dudS9zdG9yZS8wOHZxZzBzNzdkbmZmN3J6OTBi MGg4N24ycmZ5YXN6Zy1nY2MtNy41LjAtbGliICAgICAgICAgICA3MS4wICAgIDMyLjYgICAwLjkl Ci9nbnUvc3RvcmUvNGZrZnBkbTNmdzIya2Zka3pmYjd5cng4YXZ3cTQybnMtY29yZXV0aWxzLTgu MzIgICAgICAgICAgODguMCAgICAxNy4wICAgMC41JQovZ251L3N0b3JlL3cweWc4aDJrNzNtNjh5 OGpnc2xmYzlreGJ6bWF5OHM2LWNvcmV1dGlscy04LjMyICAgICAgICAgNTQzLjcgICAgMTYuNiAg IDAuNSUKL2dudS9zdG9yZS9pMThscGY1N2k3eTBoczJhNXlyejEya2lkZHpjZm1qbC1nbGliYy11 dGY4LWxvY2FsZXMtMi4zMSAgICAxMy45ICAgIDEzLjkgICAwLjQlCi9nbnUvc3RvcmUvYnlwMmp5 c212N2w5ajJmMGpjM3k4aXkxZjZ3eDViNDItaXNjLWRoY3AtNC40LjIgICAgICAgICA1NzQuNCAg ICAxMS4xICAgMC4zJQovZ251L3N0b3JlL2x2emwyNHdraXdhcmJkanNsYXlheW1tYTlkcmZmM25i LXJhdy1pbml0cmQgICAgICAgICAgICAgIDU1LjMgICAgMTAuNiAgIDAuMyUKL2dudS9zdG9yZS8x NWhpcTQybjE1MG5sODRmcWprMjBmbXo5aHN4YTJ3MC11dGlsLWxpbnV4LXdpdGgtdWRldi0yLjM1 LjEtbGliICAgNTMzLjQgICAgIDguOSAgIDAuMyUKL2dudS9zdG9yZS9zNHF2a2cyMTFwd3lsODNi bWdhcmRmMm5id2FxeG01NS11dGlsLWxpbnV4LTIuMzUuMS1saWIgICA1MzMuNCAgICAgOC45ICAg MC4zJQovZ251L3N0b3JlLzYzbXYyZzZrbjZyOTB4bjNhbDg3Zmx5NzdkNDI4aXZuLWV1ZGV2LTMu Mi45ICAgICAgICAgICAgNTQyLjggICAgIDguMSAgIDAuMiUKL2dudS9zdG9yZS9sN2c3bno1bG1i eG15cXAwM3YxbnF4cjd6aWdnZDY2aC1iYXNoLTUuMC4xNiAgICAgICAgICAgIDEzOS4yICAgICA2 LjMgICAwLjIlCi9nbnUvc3RvcmUvaDUzY2t4M2E5ZDQ2MHlhbXBzYzJkd2l6N2dqczk1ZGotYmFz aC01LjAuMTYgICAgICAgICAgICA1MzcuNyAgICAgNi4xICAgMC4yJQovZ251L3N0b3JlL2txemFs MWZrcjNjMDVtcnhxMGpucmdiZ2hndm41aG15LW5jdXJzZXMtNi4yICAgICAgICAgICAgMTMxLjUg ICAgIDUuOSAgIDAuMiUKL2dudS9zdG9yZS9mNnMxdnBtbDQxcXNxcmFzcTI1eGM0MGk4MDQ5MWIy OS1vcGVuc3NsLTEuMS4xZCAgICAgICAgIDUzMC4yICAgICA1LjcgICAwLjIlCi9nbnUvc3RvcmUv OHl2N3diMzdtc3BtN3JnYng4ejE2a3dqcmo0MnFyM3ctbmN1cnNlcy02LjIgICAgICAgICAgICA1 MzAuMiAgICAgNS43ICAgMC4yJQovZ251L3N0b3JlL21pazk2cDYwNGhzbjJqdnNpOWwxaGszd3Fr NHEzaHp2LWx2bTItMi4wMy4wOCAgICAgICAgICAgNTQ4LjYgICAgIDUuNyAgIDAuMiUKL2dudS9z dG9yZS9wajc2MDlpOTVmaWo5cjY1ZzFqOHZhcThjMnFhNmE4MC1lMmZzcHJvZ3MtMS40NS41ICAg ICAgIDUzOC45ICAgICA1LjUgICAwLjIlCi9nbnUvc3RvcmUvaG5kc2ZqaHNjMG1naTU4cjVmcHlq bHcxanZ3emJhM3ctdXRpbC1saW51eC13aXRoLXVkZXYtMi4zNS4xICAgNTYyLjcgICAgIDUuMiAg IDAuMiUKL2dudS9zdG9yZS93dmpmYXhiZzV6Z3NrNDg4a2gyM21hZHNmM2wwOWs5bS11dGlsLWxp bnV4LTIuMzUuMSAgICAgIDU0NC41ICAgICA1LjIgICAwLjIlCi9nbnUvc3RvcmUvaTlnNDI1bG14 anhtenZmejh2c3JiOG04dzhteWc0NTgtbGludXgtbGlicmUtaGVhZGVycy01LjQuMjAgICAgIDUu MiAgICAgNS4yICAgMC4xJQovZ251L3N0b3JlLzF2Z2FweHJtajYxMjIxNnFkZzRxN2k1OHpnMzhu c3dzLWxpbnV4LWxpYnJlLWhlYWRlcnMtY3Jvc3MtYWFyY2g2NC1saW51eC1nbnUtNS40LjIwICAg ICA1LjEgICAgIDUuMSAgIDAuMSUKL2dudS9zdG9yZS9kdnpoZm5pcW1hemowZjZrMmRyOGNoNmti ZGMxamhjMi1taXQta3JiNS0xLjE4ICAgICAgICAgIDUyOS4yICAgICA0LjcgICAwLjElCi9nbnUv c3RvcmUvN2JreXBnN3JqMXFoOGtpMzl3MGJwa3ZmcXlmbnJka2MtZ251dGxzLTMuNi4xMiAgICAg ICAgICA1MzUuMCAgICAgNC42ICAgMC4xJQovZ251L3N0b3JlL3d4bHE4NG1mZGlxd2I3YTFmOWY0 NzUyM3YyMGdqMHpsLWd1aWxlLWdpdC0wLjMuMCAgICAgICAgNTUwLjQgICAgIDQuNCAgIDAuMSUK L2dudS9zdG9yZS93NDJzZHJqdzR6eDgwaWRxbnhibGF4cmxyYXBsaWw4cS1zaGFkb3ctNC44LjEg ICAgICAgICAgIDUzMC43ICAgICA0LjMgICAwLjElCi9nbnUvc3RvcmUvODQ5a2dsOXFkcWhiYjBs aTczbWE0YTB6ZDh3eXh6NWQtbW9kdWxlLWltcG9ydC1jb21waWxlZCAgICAgNC4yICAgICA0LjIg ICAwLjElCi9nbnUvc3RvcmUvZzdpbjBoajM0bWJuMWlnZng0bWpnaXN3aG1ubXhtemgtZ3JvZmYt bWluaW1hbC0xLjIyLjQgICA1MjguNyAgICAgNC4yICAgMC4xJQovZ251L3N0b3JlL2xnM3owM2pu bXFybGowaXFqODA3amRwNjhhNWpqeTFnLWxpYm5sLTMuNS4wICAgICAgICAgICAgNTI4LjMgICAg IDMuOCAgIDAuMSUKL2dudS9zdG9yZS9mOG1tYWIzbWoya3hxYjU2NHMxc3o2cW5jNHpjeGE2NC1w Y3JlMi0xMC4zNCAgICAgICAgICAgIDUzNS45ICAgICAzLjcgICAwLjElCi9nbnUvc3RvcmUvY2k2 NGJjNWc5MjJtcXJpMzhsNGpjZGQ5ZGc2eW45aDAtc3Vkby0xLjguMzEgICAgICAgICAgICA1NDcu MCAgICAgMy4zICAgMC4xJQovZ251L3N0b3JlL3F5M2IyMGJ5cWltNXZmNWZ3aWczNWQ5cmpnaDds YmpkLWdhd2stNS4wLjEgICAgICAgICAgICAgNTQxLjAgICAgIDMuMyAgIDAuMSUKL2dudS9zdG9y ZS94bjU5cjhmcmhjZzdpbDBoY3Y0aWl2Y3hsYWpsMGloNS1tb2R1bGUtaW1wb3J0LWNvbXBpbGVk ICAgICAzLjMgICAgIDMuMyAgIDAuMSUKL2dudS9zdG9yZS9wNXAxNDZ6YzB5bm4xeHgzcnB5ejRq MTlteHNpczRydi1pc2wtMC4yMi4xICAgICAgICAgICAgICA3Ni45ICAgICAzLjIgICAwLjElCi9n bnUvc3RvcmUvOHM1MTQ3amZpMXd2a2JwcWNkZHIzMHMxcmw0cDZoYmYtbGlic2FtcGxlcmF0ZS0w LjEuOSAgICA1MzMuNSAgICAgMy4wICAgMC4xJQovZ251L3N0b3JlL2wzc2FuNDZ4NTNucWsxYjg4 amcwNnYwOXJkNDlrMDN5LWtiZC0yLjAuNCAgICAgICAgICAgICAgNTMwLjcgICAgIDIuOSAgIDAu MSUKL2dudS9zdG9yZS94c3Z2czM3aWdia2tuMWlyaTN6aXF6eG5nNjA5cmd4ei1zcWxpdGUtMy4z MS4xICAgICAgICAgIDUzNC41ICAgICAyLjkgICAwLjElCi9nbnUvc3RvcmUvNnlkMDVhdnhkanFp Y2ZhaHlnNXk3NHh6ZmNsbTQ5NjgtdGFyLTEuMzIgICAgICAgICAgICAgICA1NDAuNiAgICAgMi45 ICAgMC4xJQovZ251L3N0b3JlL3BzMTlqMXhmaWZzM3JqMTV3bmpkdzJ3MjM0amEycmpxLWluZm8t cmVhZGVyLTYuNyAgICAgICAgNTMzLjAgICAgIDIuOCAgIDAuMSUKL2dudS9zdG9yZS83em4xOHc0 NzJ3ZHY5Y2loa2JkMDBsaXBrMWQyNmFnZi1nbXAtNi4yLjAgICAgICAgICAgICAgICA3My44ICAg ICAyLjcgICAwLjElCi9nbnUvc3RvcmUvZHJ5cGg5am5ha21iMGQ1YzJyZmk0a3F2bDF4NmliY2Yt Z21wLTYuMi4wICAgICAgICAgICAgICAgNzMuOCAgICAgMi43ICAgMC4xJQovZ251L3N0b3JlL25y ajQ0d2ppZDlzdnFxaGhremI4YjZ6ZHAzaHM5eGlhLWxpYnVuaXN0cmluZy0wLjkuMTAgICAgIDcz LjQgICAgIDIuNCAgIDAuMSUKL2dudS9zdG9yZS9sbW4wajN2cGluYTFhNmZxa213eHFhczE2Ymx5 c3BqeC1saWJ1bmlzdHJpbmctMC45LjEwICAgICA3My40ICAgICAyLjQgICAwLjElCi9nbnUvc3Rv cmUvaTc3bXd2ZHlhczFyaGk5ODgxcDhyd3Z4dzRzcGxkbGwtbmV0LXRvb2xzLTEuNjAtMC40Nzli YjRhICAgIDc4LjUgICAgIDIuMyAgIDAuMSUKL2dudS9zdG9yZS92bXNpeGd5bThyeGNuYThjOW14 ajNheHgycjl4bWRici1saWJ1bmlzdHJpbmctMC45LjEwICAgIDUyNi44ICAgICAyLjMgICAwLjEl Ci9nbnUvc3RvcmUvdzlhY2xuZnhna2l5bDZwajdtcXZqbm52YWpoZDUzMzktZmxhYy0xLjMuMyAg ICAgICAgICAgICA1MjcuMyAgICAgMi4zICAgMC4xJQovZ251L3N0b3JlL2owZnB4cTNxaDJ6bDRs NjdjbnFrZ2Zud3F3NDQ1MTBrLW1vZHVsZS1pbXBvcnQtY29tcGlsZWQgICAgIDIuMyAgICAgMi4z ICAgMC4xJQovZ251L3N0b3JlL2F3MmI3M2NxOWRodzlxbXI3ZmppeWZ3MWZqZ2pnN3N3LWFsc2Et dXRpbHMtMS4yLjEgICAgICAgNTQzLjIgICAgIDIuMiAgIDAuMSUKL2dudS9zdG9yZS9ncDhwOTVm M2pnZ215cTNpaTIycnBmeDV3dmlrd3o5OC1uYW5vLTQuOCAgICAgICAgICAgICAgIDUzMi40ICAg ICAyLjIgICAwLjElCi9nbnUvc3RvcmUveDFjZ2g2eDVtNTdmOXY1ZDU3c24xdzEzODIzZDBkcDAt aXByb3V0ZTItNS41LjAgICAgICAgICAgNzQuMiAgICAgMi4xICAgMC4xJQovZ251L3N0b3JlL3c4 YmhodmQxeGZxazZ5azk1YTd3MDRqbG5rbGgxdzVwLWluZXR1dGlscy0xLjkuNCAgICAgICAgNTMz LjcgICAgIDIuMSAgIDAuMSUKL2dudS9zdG9yZS9sY3JrbW5ubmZrc2doeXJ6M3g5ZGZheHh6anEz cDh4Mi1nbXAtNi4yLjAgICAgICAgICAgICAgIDUyNi41ICAgICAyLjEgICAwLjElCi9nbnUvc3Rv cmUveGtkYTE1OGt5OWJwM3lsNGgxNGtzajRsMHk5Yjdqd2gtZ3VpbGUtYnl0ZXN0cnVjdHVyZXMt MS4wLjcgICAgIDIuMCAgICAgMi4wICAgMC4xJQovZ251L3N0b3JlLzIwaDV3ZzAxbW0xcXlzczFs czQwMXk4MWQ2aHhmZ21uLXR6ZGF0YS0yMDE5YyAgICAgICAgICAgICAyLjAgICAgIDIuMCAgIDAu MSUKL2dudS9zdG9yZS9tOWRhMDBuMTBwbnFueHNkazI4d3o5ejM2Nzk3a243YS1saW51eC1wYW0t MS4zLjEgICAgICAgIDUyNi40ICAgICAxLjkgICAwLjElCi9nbnUvc3RvcmUvNzJ5bGQzcDV3NW0x bWZjMmpyZHA4cmpycnA4amNpaTYtZmluZHV0aWxzLTQuNy4wICAgICAgICA1NDMuNCAgICAgMS45 ICAgMC4xJQovZ251L3N0b3JlL2IwZDQybmIxeGk2Mnp5Yjd5YmZoOGh6emFiMGp6Z2JzLW1wZnIt NC4wLjIgICAgICAgICAgICAgIDc1LjYgICAgIDEuOCAgIDAuMSUKL2dudS9zdG9yZS9qNDN2Y3g1 d3JsbXc2ZDg0bXZnajNpemh6NTE2czI4bS1hbHNhLWxpYi0xLjIuMS4yICAgICAgIDUyNi4zICAg ICAxLjggICAwLjElCi9nbnUvc3RvcmUvOGs1ZGprZzM2Z2xzeHBjZ3N4MWdpMGFybTk4YWlmYmgt bWFuLWRiLTIuOS4wICAgICAgICAgICA1NTMuOCAgICAgMS43ICAgMC4xJQovZ251L3N0b3JlL2lz OWxnbGZqN3loczFjZDU1ZzA1Z3A4ZDdqOHBqcnhnLWxpYmdpdDItMC45OS4wICAgICAgICAgNTQ2 LjAgICAgIDEuNyAgIDAuMCUKL2dudS9zdG9yZS80ODRpeTJtY2M1bXJ6NDRta2d4YzFpa2s0ODNw OThxay1ndWlsZS1zc2gtMC4xMi4wICAgICAgIDYzNy4wICAgICAxLjcgICAwLjAlCi9nbnUvc3Rv cmUveTA3cWpoYmc1OWg1YTA3Zmlpa2swbTI1dnA3YTJnMmYtbGlic25kZmlsZS0xLjAuMjggICAg ICA1MzAuNSAgICAgMS43ICAgMC4wJQovZ251L3N0b3JlLzI2amg3Z3g4MzM0Njd5a2xwNGx3ZjFy Y3I1MDcycWNnLWJhc2gtc3RhdGljLTUuMC4xNiAgICAgICAxLjYgICAgIDEuNiAgIDAuMCUKL2du dS9zdG9yZS9udmMzcjU4ODc0NWtrajE1OWxtMXBhNHh6NWc5OXJxZC1iYXNoLXN0YXRpYy01LjAu MTYgICAgICAgMS42ICAgICAxLjYgICAwLjAlCi9nbnUvc3RvcmUvYzQxNDk1NHJ4enpmcWZ5aWk4 aHIwd2Z4YWcxc21kY2YtbGlidm9yYmlzLTEuMy42ICAgICAgICA1MjYuNSAgICAgMS42ICAgMC4w JQovZ251L3N0b3JlLzI4cDlmcTRzMXYyODdqYXZkcW00NXA5enA1aXp5MDE0LXByb2Nwcy0zLjMu MTYgICAgICAgICAgNTMxLjggICAgIDEuNSAgIDAuMCUKL2dudS9zdG9yZS9wcWF2Z2Y5dnc4c2Jq Mmp3amY5ZmRyeHgyOWFpY2hiYS1tb2R1bGUtaW1wb3J0LWNvbXBpbGVkICAgICAxLjUgICAgIDEu NSAgIDAuMCUKL2dudS9zdG9yZS82bmZnNHl2NDBsY2ZuMDhtNTlocmY2eHd4d2R4Z3E2Yi1wY3Jl LTguNDMgICAgICAgICAgICAgIDUyNi4wICAgICAxLjUgICAwLjAlCi9nbnUvc3RvcmUvbTQ0NG5w ejJkeWw0ZHdhYmloMXdyeWI0NGhqeHIycGstZGlmZnV0aWxzLTMuNyAgICAgICAgICA1NDMuMCAg ICAgMS41ICAgMC4wJQovZ251L3N0b3JlL3hoZGY5eDZxeDZ6Z3dyOTc1YmRtZ3IwYmNwd2NwcGM2 LXJlYWRsaW5lLTguMC40ICAgICAgICAgNTMxLjYgICAgIDEuNCAgIDAuMCUKL2dudS9zdG9yZS9j M2F4eDc0eWxrdzBzaG0xazJjcGxtMmJrOWI0cDJiai1yZWFkbGluZS04LjAuNCAgICAgICAgIDEz Mi45ICAgICAxLjQgICAwLjAlCi9nbnUvc3RvcmUvMDVqeGlkems2bGN4dzI4bjRrYWFoNDA5YXJn ejRuZm4tc2hlcGhlcmQtMC43LjAgICAgICAgICA1NzkuMCAgICAgMS40ICAgMC4wJQovZ251L3N0 b3JlL2djaGFrdmFibndhbHdhNms4YTBsbDc5Z21tYjZ6enpzLXBrZy1jb25maWctMC4yOS4yICAg ICAgIDcyLjMgICAgIDEuMyAgIDAuMCUKL2dudS9zdG9yZS96bGlkZzZuZ2xkOWszaHJzNDBkdnBq YjJqcHE5ZG45aC1wa2ctY29uZmlnLTAuMjkuMiAgICAgICA3Mi4zICAgICAxLjMgICAwLjAlCi9n bnUvc3RvcmUveTdyYnk5ZDExNTVnbnIwODI3aWE0c3pqNTRqZDZjOHYtYmFzaC1zdGF0aWMtNS4w LjE2ICAgICAgIDEuMiAgICAgMS4yICAgMC4wJQovZ251L3N0b3JlL2MxNWZzeWw0czVqbW00azBq bDE4MHJzbHhjaDBmMGl3LWxpYmdjLTcuNi4xMiAgICAgICAgICAgIDcyLjkgICAgIDEuMiAgIDAu MCUKL2dudS9zdG9yZS92cjI5YnJkZnIwcG5pOGNqeTlmNjIycDF6djVjbGpzcC1saWJnYy03LjYu MTIgICAgICAgICAgICA3Mi45ICAgICAxLjIgICAwLjAlCi9nbnUvc3RvcmUvNjA5ZnJwcW43NmQ1 ajg1YWFsZno2MmNyaGZhNmJoN3YtbGliZ2MtNy42LjEyICAgICAgICAgICA1MjYuNCAgICAgMS4y ICAgMC4wJQovZ251L3N0b3JlLzA3Zmh2d2hoY3kzYzhhenFhbHlmbGd3NGgxeXB4Mnc2LWd1aWxl LWdjcnlwdC0wLjIuMSAgICAgNTI3LjYgICAgIDEuMSAgIDAuMCUKL2dudS9zdG9yZS80bmIzaTNj eTd4ZG56MXlpNWlwN3lmcWQ2ZzFjam0yaS1iYXNoLW1pbmltYWwtNS4wLjE2ICAgICA3Mi4wICAg ICAxLjAgICAwLjAlCi9nbnUvc3RvcmUvbThpdzRmY2QweWxmZDhoZ2lrN3pqcjYzNGsxNjl2Y2Qt YmFzaC1taW5pbWFsLTUuMC4xNiAgICAgMzkuNCAgICAgMS4wICAgMC4wJQovZ251L3N0b3JlL2Jk eGl2OHN4dmd4MWNrNW1zbG03ajNmczk0czU3eXE5LWxpYmdjcnlwdC0xLjguNSAgICAgICAgNTI2 LjUgICAgIDEuMCAgIDAuMCUKL2dudS9zdG9yZS9zdnNjYTB2MWF2aDR5czFyNGZhbHYxdm40NjJj aTFuMC1iYXNoLW1pbmltYWwtNS4wLjE2ICAgIDUyNS41ICAgICAxLjAgICAwLjAlCi9nbnUvc3Rv cmUveXlncTdoYWF3YmcyMmxwZ3NpZzIwaWRscXBrOTljbmstbGliZ3BnLWVycm9yLTEuMzcgICAg ICA1MjUuNCAgICAgMS4wICAgMC4wJQovZ251L3N0b3JlLzFiejNmdzBtYzdyejgxcG4wY2pzY2c1 djcwNmNhZGc1LXByb2ZpbGUgICAgICAgICAgICAgICAxMDY0LjUgICAgIDAuOSAgIDAuMCUKL2du dS9zdG9yZS9jeXJ6ejgzbXhrYjQydjdkNGh2eDVncTIyOGc3dmRiNy14ei01LjIuNCAgICAgICAg ICAgICAgICA3My4wICAgICAwLjkgICAwLjAlCi9nbnUvc3RvcmUvM3lxNDhjaTVjd24zaGlyajU3 eWJ4cTU2MTg1Z2R5Y2QtYmFzaC1jb21wbGV0aW9uLTIuOCAgICAgIDAuOSAgICAgMC45ICAgMC4w JQovZ251L3N0b3JlL2g1emw5NXBpZzNkY3ZjYjZ5NW5xczhjeWptazFha3IzLXh6LTUuMi40ICAg ICAgICAgICAgICAgNTI1LjQgICAgIDAuOSAgIDAuMCUKL2dudS9zdG9yZS83YTBibjM4bGdzdjk4 em1yd2FnbmM3d3lkbWY5azZuZC1uZXR0bGUtMy41LjEgICAgICAgICAgIDUyNy40ICAgICAwLjgg ICAwLjAlCi9nbnUvc3RvcmUvNGJsZHk4NG4zbDBxZGF2ZHlza3NzeGl4Z3BhOWI5OXMtZ3JlcC0z LjQgICAgICAgICAgICAgICAgNzIuOSAgICAgMC44ICAgMC4wJQovZ251L3N0b3JlL2ZtMWoxd2I2 cWlrMmljd3F6cmZzNmN2Ym15c2lkbmN4LWZ1c2UtMi45LjkgICAgICAgICAgICAgNTQ1LjMgICAg IDAuOCAgIDAuMCUKL2dudS9zdG9yZS9najQ5MjdxaWY1cGF6cHc2dzEyaTYxbGQ1Y3p2bmh2aC1n cmVwLTMuNCAgICAgICAgICAgICAgIDUyNi44ICAgICAwLjggICAwLjAlCi9nbnUvc3RvcmUvYmJx czNhaTlsZGlseWtpcmtkbjc1aXZwNXc2cTk3a2Ytc2VkLTQuOCAgICAgICAgICAgICAgICA1MjUu MyAgICAgMC44ICAgMC4wJQovZ251L3N0b3JlLzBxdm1xNmE3Y2J6OXFsZjZpZjhuZHp6cXZydjlx NGFhLWxpYnNzaC0wLjkuMyAgICAgICAgICAgNTMyLjEgICAgIDAuNyAgIDAuMCUKL2dudS9zdG9y ZS80dmQ5cjZ5emcwcmt3M2E0NW4zMWNuYmpmZjJkN3FpbC1saWJzc2gyLTEuOS4wICAgICAgICAg IDUyNy40ICAgICAwLjcgICAwLjAlCi9nbnUvc3RvcmUvNXdqcGM0ZjNkMWpqOTkyenpsMzJ5enNj MnZ4cnExMTgtbGliYXRvbWljLW9wcy03LjYuMTAgICAgIDAuNyAgICAgMC43ICAgMC4wJQovZ251 L3N0b3JlL2twejh6YTkwNnBxaHprYnFqc2JsaDBubTE5OGg1OGpsLWxpYmF0b21pYy1vcHMtNy42 LjEwICAgICAwLjcgICAgIDAuNyAgIDAuMCUKL2dudS9zdG9yZS8xcDNqeTV6OTcxdzgxNnYxdm0x a2hjYW16ZGxjcjQzZy1saWJhdG9taWMtb3BzLTcuNi4xMCAgICAgMC43ICAgICAwLjcgICAwLjAl Ci9nbnUvc3RvcmUvYTRseXNrMXl5NDk4cGM4MjZydnowbDZibjk5Zm5jcjUtcHNtaXNjLTIzLjMg ICAgICAgICAgICA1MzAuOCAgICAgMC42ICAgMC4wJQovZ251L3N0b3JlL3g0Z25kZzBneXl6dm45 OGgxeXB5eGIzMjlod2YxbGcwLXBjaXV0aWxzLTMuNi40ICAgICAgICAgNTI1LjMgICAgIDAuNSAg IDAuMCUKL2dudS9zdG9yZS93Zmc3ZHdwZ2FqcnAwNmM5eHk3aDFoNGx3M2t5eThrYy1nZGJtLTEu MTguMSAgICAgICAgICAgIDUyNS4wICAgICAwLjUgICAwLjAlCi9nbnUvc3RvcmUvMGk1OWN5aTc4 czRmMmZqMWZyaW5mbmE4OGE4bnI5MXktbGliaWRuMi0yLjMuMCAgICAgICAgICA1MjcuMyAgICAg MC41ICAgMC4wJQovZ251L3N0b3JlLzFnYjI5cnM4MjF6NWdidm0zMWJmMmhnaDIzeGMxY3gwLWxp Ym9nZy0xLjMuNCAgICAgICAgICAgNTI0LjkgICAgIDAuNCAgIDAuMCUKL2dudS9zdG9yZS9sczlh N3FxZHIwYnJkZnowNTZoNGtyaDdqaGpiZ2RqYS1iemlwMi0xLjAuOCAgICAgICAgICAgICA3Mi41 ICAgICAwLjQgICAwLjAlCi9nbnUvc3RvcmUvbHIycHNta3MyY24zeW12ZjBkNTNwejJoeWpwbGdq aTctbW9kdWxlLWltcG9ydC1jb21waWxlZCAgICAgMC40ICAgICAwLjQgICAwLjAlCi9nbnUvc3Rv cmUvemJyaXdicm55cTR2bm04aWdibjM3dzFkMGczcjdqbXctbXBjLTEuMS4wICAgICAgICAgICAg ICAgNzYuMCAgICAgMC40ICAgMC4wJQovZ251L3N0b3JlLzA3anBqZzVrc2FzcHZyaDhkcjFuM3I5 YWE1Y2JtcDlxLWxpYnVzYi0xLjAuMjMgICAgICAgICAgNTI0LjkgICAgIDAuNCAgIDAuMCUKL2du dS9zdG9yZS9wN2dpeDMwem5taHE5eGx2cmN3Z2ZtZ2E1aWFkN2ltNi1iemlwMi0xLjAuOCAgICAg ICAgICAgIDUyNC45ICAgICAwLjQgICAwLjAlCi9nbnUvc3RvcmUvYTh5OTk5aDM3NjN3czVqNTcw MGluZHl2aWRpczZpM3Etd2lyZWxlc3MtdG9vbHMtMzAucHJlOSAgIDUyNC44ICAgICAwLjQgICAw LjAlCi9nbnUvc3RvcmUvbHdjMjEwYXAzbDdtNDF4empjOWE2NjJobWcxenhkYnYtZ3VpbGUtcmVh ZGxpbmUtMi4yLjYgICA1ODUuMSAgICAgMC4zICAgMC4wJQovZ251L3N0b3JlL2FhNmgzaTR2MGlj aWduM3Jwc2d2czcyZ3pqOHhwM3F5LW1vZHVsZS1pbXBvcnQgICAgICAgICAgICAwLjMgICAgIDAu MyAgIDAuMCUKL2dudS9zdG9yZS92MGQ4cXdwam5nNDRoZGpwNmc3N3psaDg0amRpY2EyZi1hY2wt Mi4yLjUzICAgICAgICAgICAgIDUyNS4xICAgICAwLjMgICAwLjAlCi9nbnUvc3RvcmUvbTBscW1s ejE1eGQybml2bG5pNTFtcnY0aWQ4aXprNWstemlsZS0yLjQuMTQgICAgICAgICAgICA1MzkuOSAg ICAgMC4zICAgMC4wJQovZ251L3N0b3JlL2NhbjNpYXgycWcxZ20weXdjMndmNzZxZDNycTloY2xo LWttb2QtMjYgICAgICAgICAgICAgICAgNTI1LjkgICAgIDAuMyAgIDAuMCUKL2dudS9zdG9yZS9o cjM2NG54OW5xbGo3OG1jN2Z3NmgyemI4cXFybjF3aS1tb2R1bGUtaW1wb3J0ICAgICAgICAgICAg MC4zICAgICAwLjMgICAwLjAlCi9nbnUvc3RvcmUvOXgxbGxkcnh6MTZwdjc2Y2R2MWFsc3k5MjNk Y3IxMXctZ3VpbGUtanNvbi0zLjIuMCAgICAgICAgIDAuMyAgICAgMC4zICAgMC4wJQovZ251L3N0 b3JlLzQwYzdiYTFqank0MGFxMTc5NjQ0Z3E2MnBmeWNyczM1LXVzYnV0aWxzLTAxMiAgICAgICAg ICAgNTQzLjUgICAgIDAuMyAgIDAuMCUKL2dudS9zdG9yZS9wbnluY3FwazhscjUzZ2FmbnA5cmIw YWlwNTM1MXZmcy1ndWlsZS1zcWxpdGUzLTAuMS4wICAgIDUzNC44ICAgICAwLjMgICAwLjAlCi9n bnUvc3RvcmUvODkxMjN3MDc0bjlzOTkxazE0cXlsODh3YTYxMzl5eDMtbWFudWFsLWRhdGFiYXNl ICAgICAgIDEwNTkuMiAgICAgMC4zICAgMC4wJQovZ251L3N0b3JlL3IweHdwaGY2MmxkemFwbHBt aXI1MGtjZGt3YjRqenlyLWxlc3MtNTUxICAgICAgICAgICAgICAgNTMwLjUgICAgIDAuMyAgIDAu MCUKL2dudS9zdG9yZS9kYTVkbDBhcDcybGNoNWg5Zm1teDF6azN4aGlyYzE3NS1hdHRyLTIuNC40 OCAgICAgICAgICAgIDUyNC43ICAgICAwLjIgICAwLjAlCi9nbnUvc3RvcmUvcDM2ZjlyMTE5cTVj MXJtcThnbHEzMGI5YjJ6ZGZrbGctZ3VpbGUtY29sb3JpemVkLTAuMSAgICAgIDAuMiAgICAgMC4y ICAgMC4wJQovZ251L3N0b3JlL2NsOTMweDAwczRtbWE3eHp3YWJkNnhsODZudjRqbW1sLXpsaWIt MS4yLjExICAgICAgICAgICAgIDcxLjIgICAgIDAuMiAgIDAuMCUKL2dudS9zdG9yZS9nMXNxMjc3 czFid3dsaTRneXFwanhjMmo1YXhrOTFuci16bGliLTEuMi4xMSAgICAgICAgICAgIDUyNC43ICAg ICAwLjIgICAwLjAlCi9nbnUvc3RvcmUvaXdkcHk2NjUwOGJpaWpmdnZreWt6Z3k5dzNkZjU2bXEt cGF0Y2gtMi43LjYgICAgICAgICAgICA1MjQuOCAgICAgMC4yICAgMC4wJQovZ251L3N0b3JlL3pz bnF6anl2amdnbDJqZ2Y0c2E5MHo0YTZtaGpjOTZiLWNyZGEtMy4xOCAgICAgICAgICAgICAgNTI4 LjUgICAgIDAuMiAgIDAuMCUKL2dudS9zdG9yZS82ejdhZHk3eW5nczNteTBwcndxcjZrZ3k1ZjJh MzZxYy1tb2R1bGUtaW1wb3J0ICAgICAgICAgICAgMC4yICAgICAwLjIgICAwLjAlCi9nbnUvc3Rv cmUvanI5OHdpM3A4M3cwMmM0bGMyNnJ5bnhrYTV6cno3bHItbGlidGFzbjEtNC4xNi4wICAgICAg ICA1MjQuNyAgICAgMC4yICAgMC4wJQovZ251L3N0b3JlL3djZzQyMHczNTdwejFtcmg2OHl4N3px cnFrbmtrN2tmLW1vZHVsZS1pbXBvcnQtY29tcGlsZWQgICAgIDAuMiAgICAgMC4yICAgMC4wJQov Z251L3N0b3JlL3czNDl4Mmp4YWdtOHBja3Z5NWxnbXJncGh2aTl2MjFzLWd6aXAtMS4xMCAgICAg ICAgICAgICAgIDczLjEgICAgIDAuMiAgIDAuMCUKL2dudS9zdG9yZS92djNhaGd2Y3h3MGxnZjdz eTV5YmxmbnM3c2o3c2JueS1nemlwLTEuMTAgICAgICAgICAgICAgIDUyNS41ICAgICAwLjIgICAw LjAlCi9nbnUvc3RvcmUvOTZta204MG5sbWhtY3hjd2IxbWE1YTJhNnM0MHFybG4taXctNC4xNCAg ICAgICAgICAgICAgICA1MjguNCAgICAgMC4yICAgMC4wJQovZ251L3N0b3JlL3FzY2drdmwwa25z OHh3OHhzMjhxaTk1Ymhjbm5wZHY0LWxpYmZmaS0zLjMgICAgICAgICAgICAgIDcxLjIgICAgIDAu MiAgIDAuMCUKL2dudS9zdG9yZS9yNGkzZDg3a3lhY3YxNm5reG5weDF6c3hjanBuYzI3Mi1saWJm ZmktMy4zICAgICAgICAgICAgICA3MS4yICAgICAwLjIgICAwLjAlCi9nbnUvc3RvcmUvajVqcDJp NzVjbmJyNXd2azByNTl6eTR2ajZpNnc3YXgtbHppcC0xLjIxICAgICAgICAgICAgICAgNzEuMiAg ICAgMC4yICAgMC4wJQovZ251L3N0b3JlLzhwNnEycTRkMDBtMm41eHZ2ZjJmM3NoenZuYTAzbDc1 LWxpYmx0ZGwtMi40LjYgICAgICAgICAgIDcxLjIgICAgIDAuMiAgIDAuMCUKL2dudS9zdG9yZS9w ZzZuaXl4Z3k2djdmNG5qd2E3ZjYzM2ZnY2E5aHByMC1saWJsdGRsLTIuNC42ICAgICAgICAgICA3 MS4yICAgICAwLjIgICAwLjAlCi9nbnUvc3RvcmUvZnpjeG40NnM5OWp3cTkxMzg2M3ZjNzkzNG1m czMzc2MtbGlibHRkbC0yLjQuNiAgICAgICAgICA1MjQuNiAgICAgMC4xICAgMC4wJQovZ251L3N0 b3JlLzcyeGtqc254cHowcG1iZGN3NnB2ZzYwanA4eHNxNGJ2LWxpYmZmaS0zLjMgICAgICAgICAg ICAgNTI0LjYgICAgIDAuMSAgIDAuMCUKL2dudS9zdG9yZS96M3EwZDVmcGYwMmZ5amlxeTE3aXY1 bnhxdnhjemdtcS1saWJwaXBlbGluZS0xLjUuMSAgICAgIDUyNC42ICAgICAwLjEgICAwLjAlCi9n bnUvc3RvcmUvNmk0cjd3YThrcW4wamtyY3poczEzM2pua3pqbDg5amctbW9kdWxlLWltcG9ydCAg ICAgICAgICAgIDAuMSAgICAgMC4xICAgMC4wJQovZ251L3N0b3JlL3huZDFnNnN2bmJkZmI4Mzdj bHozazRjZHgxeXp3dnp6LWF0aDlrLWh0Yy1maXJtd2FyZS0xLjQuMCAgICAgMC4xICAgICAwLjEg ICAwLjAlCi9nbnUvc3RvcmUvNnF4M2FiMGxkOTNtczhmcXljOGdzd2hjczVia3g0anItZWQtMS4x NiAgICAgICAgICAgICAgICAgNzIuMiAgICAgMC4xICAgMC4wJQovZ251L3N0b3JlLzN3YnF2bWI2 bHhrNzNmbGtkMGcweHBxeWwwZDN5a3o1LWxkLXdyYXBwZXItYWFyY2g2NC1saW51eC1nbnUtMCAg IDI1OS4xICAgICAwLjEgICAwLjAlCi9nbnUvc3RvcmUvMDQ0Zmg1eHJrZmxrcWdhY2FtaWxtbWd5 ejkxeHdxOWEtc2hlcGhlcmQtdXNlci1wcm9jZXNzZXMuZ28gICAgIDEuNyAgICAgMC4xICAgMC4w JQovZ251L3N0b3JlLzFhYzZpcmh6bjliNTBzZjQzMDJ6M2YzeWp6cTRjandjLXNoZXBoZXJkLW5z Y2QuZ28gICAgICAgNDU3LjYgICAgIDAuMSAgIDAuMCUKL2dudS9zdG9yZS80YnA3ZjRzOG05c3h5 ejIzZmI1MWJsbnljaXZnNXkzcy1zaGVwaGVyZC11ZGV2LmdvICAgICAgIDU4MS4wICAgICAwLjEg ICAwLjAlCi9nbnUvc3RvcmUvZGpoM3lxNjFkcm1xNjZubGd5YXA4cDJocDhnbjhnMXktc2hlcGhl cmQtdXJhbmRvbS1zZWVkLmdvICAgICAxLjcgICAgIDAuMSAgIDAuMCUKL2dudS9zdG9yZS8xbnNu d2JnODlqeXhtbmQ2YWEzcG1mN2xzaWtkazVoay1zaGVwaGVyZC1maWxlLXN5c3RlbS0tZGV2LXNo bS5nbyAgICAgMi42ICAgICAwLjEgICAwLjAlCi9nbnUvc3RvcmUvcnJybnk1bWNjbGNwdzJkcHhn Z2RxeDh6ZDFjd3N3eGktc2hlcGhlcmQtZmlsZS1zeXN0ZW0tLWdudS1zdG9yZS5nbyAgICAgMi42 ICAgICAwLjEgICAwLjAlCi9nbnUvc3RvcmUvZ244eGFwYWttOHoxcTdwa3BoZzZ2M2htbnkxczh5 bXAtc2hlcGhlcmQtZmlsZS1zeXN0ZW0tLWRldi1wdHMuZ28gICAgIDIuNiAgICAgMC4xICAgMC4w JQovZ251L3N0b3JlLzl2N2d4bnlpZHZ3ZnhiZ2o5ajFsNzRoY2YxOXN6cndqLXNoZXBoZXJkLXVz ZXItaG9tZXMuZ28gICA1NDguNiAgICAgMC4xICAgMC4wJQovZ251L3N0b3JlL244bXFkMWo5a2c2 ZHo5a3NhYXdzNWx2cnY1NzgxMzkwLXNoZXBoZXJkLXRlcm0tYXV0by5nbyAgIDU1NC40ICAgICAw LjEgICAwLjAlCi9nbnUvc3RvcmUvY2o2OXBrY3ZrbGo3ejVxeXhwdjd2aG41MjVscXA5Yngtc2hl cGhlcmQtdXNlci1maWxlLXN5c3RlbXMuZ28gICAgIDEuNyAgICAgMC4xICAgMC4wJQovZ251L3N0 b3JlL241dnJsOHFkdzlnaHNpamY4M3ZiYWxhMzR3c3l4bjVkLXNoZXBoZXJkLXJvb3QtZmlsZS1z eXN0ZW0uZ28gICAgIDEuNyAgICAgMC4xICAgMC4wJQovZ251L3N0b3JlLzR6NTYzMDMyMDZ2Ymky eWkwcmk1Ymx4cnMwc2hncmZpLXNoZXBoZXJkLWNvbnNvbGUtZm9udC10dHkzLmdvICAgNTMyLjQg ICAgIDAuMSAgIDAuMCUKL2dudS9zdG9yZS82aDA2bTR2Z2lxMjAxYW5qNWNzMDQ4eDB5Zzk0NjV6 Yi1zaGVwaGVyZC1jb25zb2xlLWZvbnQtdHR5Ni5nbyAgIDUzMi40ICAgICAwLjEgICAwLjAlCi9n bnUvc3RvcmUvNzNoOXhtcW1oeWY0MXl3Z2theDI5bGJmazE1eHBpZnItc2hlcGhlcmQtY29uc29s ZS1mb250LXR0eTUuZ28gICA1MzIuNCAgICAgMC4xICAgMC4wJQovZ251L3N0b3JlLzhmZ3Jma2xh YzBrNTNoeTB5aDN3aWg0d3E4eGZmZ2M3LXNoZXBoZXJkLWNvbnNvbGUtZm9udC10dHk0LmdvICAg NTMyLjQgICAgIDAuMSAgIDAuMCUKL2dudS9zdG9yZS9obHM4cWlpNmlhNHEwbjkyeTN3ZnczeWR5 N2tzNXNiZC1zaGVwaGVyZC1jb25zb2xlLWZvbnQtdHR5MS5nbyAgIDUzMi40ICAgICAwLjEgICAw LjAlCi9nbnUvc3RvcmUvc2lwMWk2a2p6ZG5seDhzM3JhN2dra2o0MW0zanpzamotc2hlcGhlcmQt Y29uc29sZS1mb250LXR0eTIuZ28gICA1MzIuNCAgICAgMC4xICAgMC4wJQovZ251L3N0b3JlLzF3 eHY4cXltYnA0eDJnYndxN2J4eDAzYjF5bThkeTdxLXNoZXBoZXJkLWd1aXgtZGFlbW9uLmdvICAg OTEwLjUgICAgIDAuMSAgIDAuMCUKL2dudS9zdG9yZS9rcW1heTIwbjdjZDQ1cTR5OGNkM2F3M2s0 OHF3c3lxOS1zaGVwaGVyZC1sb29wYmFjay5nbyAgICAgMS43ICAgICAwLjEgICAwLjAlCi9nbnUv c3RvcmUvem4yMDh4YTViY3h2cmwwNWdzdnd6empueTR3OHNicWQtd2hpY2gtMi4yMSAgICAgICAg ICAgICA1MjQuNiAgICAgMC4xICAgMC4wJQovZ251L3N0b3JlL3FzNnI4c2sxc2xqdzkyZjhubTNh emFhM2tqYTFoMHl3LXNoZXBoZXJkLXZpcnR1YWwtdGVybWluYWwuZ28gICAgIDEuNyAgICAgMC4x ICAgMC4wJQovZ251L3N0b3JlLzFxbjd5dnFwOXM1N2gxNTgxcWswNXlnejYwNXZ3MnNyLXNoZXBo ZXJkLXRlcm0tdHR5NC5nbyAgIDUzMi40ICAgICAwLjEgICAwLjAlCi9nbnUvc3RvcmUvNXpkbmFk NGNqd2xxemtjODZyaHZ3aGJiMnI5OTQ0OXMtc2hlcGhlcmQtdGVybS10dHkzLmdvICAgNTMyLjQg ICAgIDAuMSAgIDAuMCUKL2dudS9zdG9yZS82enM0MnpkYnlzczNpaHZwemJoMjRhZmFycmpoend3 My1zaGVwaGVyZC10ZXJtLXR0eTIuZ28gICA1MzIuNCAgICAgMC4xICAgMC4wJQovZ251L3N0b3Jl LzhyeHNxN3oxcjVzenIxYnc0N3hqemgzcWxpYWxhZ2ppLXNoZXBoZXJkLXRlcm0tdHR5NS5nbyAg IDUzMi40ICAgICAwLjEgICAwLjAlCi9nbnUvc3RvcmUvZmsxMG5objMya2hkNmNjMm5jcmNxMzV5 d2Z5Y2F3d2stc2hlcGhlcmQtdGVybS10dHk2LmdvICAgNTMyLjQgICAgIDAuMSAgIDAuMCUKL2du dS9zdG9yZS9nMnJtNmo4aGFnbnk0c2R3Y2s2YjRhaTdxM2h5eGFoai1zaGVwaGVyZC10ZXJtLXR0 eTEuZ28gICA1MzIuNCAgICAgMC4xICAgMC4wJQovZ251L3N0b3JlL3F6dmdza2xzaDg1NWxkcG1n ZHpoeTdydjB2aXJwa3FnLXNoZXBoZXJkLXRlcm0tdHR5UzAuZ28gICA1NTQuNCAgICAgMC4xICAg MC4wJQovZ251L3N0b3JlL2hwNG1zMzlxNDN6cDdkcWJyazBsYzBxNzJ6OGd3OWs2LXNoZXBoZXJk LXN5c2xvZ2QuZ28gICAgNTM1LjMgICAgIDAuMSAgIDAuMCUKL2dudS9zdG9yZS9ocWFnbTJiamh6 MHIxeHg4Z2J3c3pxZ2gxNW1kYjd5bC1zaGVwaGVyZC1maWxlLXN5c3RlbXMuZ28gICAgIDEuNyAg ICAgMC4xICAgMC4wJQovZ251L3N0b3JlL3FmY2Nkam0xdjJubWg1NTZjMWp5bTg3ZGloN2thamRk LXNoZXBoZXJkLWhvc3QtbmFtZS5nbyAgICAgMS43ICAgICAwLjEgICAwLjAlCi9nbnUvc3RvcmUv a2N3bWFhMjVwM2JrMDE2MHJmbmR5eGIycmthM3F3ZnMtbGliYWlvLTAuMy4xMTEgICAgICAgICAg IDAuMSAgICAgMC4xICAgMC4wJQovZ251L3N0b3JlL3h2NXlsdjloeHZzMXdyYXczNzViNWc5and5 NTd2czhwLW1vZHVsZS1pbXBvcnQgICAgICAgICAgICAwLjEgICAgIDAuMSAgIDAuMCUKL2dudS9z dG9yZS94N3o0ZjRjYTRrOHo2MWlpazAzdjI3ZGxzMDFyaDFjMy1saWJzaWdzZWd2LTIuMTIgICAg ICAgIDUyNC41ICAgICAwLjEgICAwLjAlCi9nbnUvc3RvcmUvejc4aXBhbHh4bDYwdmQyd3Y2ZHY5 NHpjMGlseWNzYzUtbWluZ2V0dHktMS4wOCAgICAgICAgICA1MzAuNyAgICAgMC4wICAgMC4wJQov Z251L3N0b3JlLzlxMW1sajd3c3c5NmJwYTRzaWJnNWRkMnFwaXh3MGx4LW9wZW5md3dmLWZpcm13 YXJlLTUuMiAgICAgMC4wICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUvNXIzbWQydnZpNWsxOHA4 cmlkOGFqajZxMmh6MHhudnctaW5mby1kaXIgICAgICAgICAgICAgICAgIDAuMCAgICAgMC4wICAg MC4wJQovZ251L3N0b3JlL3oxZG52azBnZGY2eGY4NXcxNnk3em02anA4NzRpeXBhLW1vZHVsZS1p bXBvcnQgICAgICAgICAgICAwLjAgICAgIDAuMCAgIDAuMCUKL2dudS9zdG9yZS9zNWZiOTA3eTFm OWl5NWRmemZtOGR2c21teDR6ZHpsMi1uZXQtYmFzZS01LjMgICAgICAgICAgICAgMC4wICAgICAw LjAgICAwLjAlCi9nbnUvc3RvcmUvczJ4azkydnlqcDA3NWIzMHlsNnlnNG1uNm1jeHBpY24td2ly ZWxlc3MtcmVnZGItMjAxOS4wNi4wMyAgICAgMC4wICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUv amttc3h6aWMybnZueGowZmkwZmRrZ2c5cW1ndzlxazItdWRldi1ydWxlcyAgICAgICAgICAgICA1 NzcuMyAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlL2pndjkwYjZrN2txcHhpMDY3aWcxcjg2YThz bjN5cXpwLXNrZWwgICAgICAgICAgICAgICAgICAgICAwLjAgICAgIDAuMCAgIDAuMCUKL2dudS9z dG9yZS9jZHNjdnZnMHpqemEzc2R5NzdnOXdnMHExdzhrMDY0bi1ldGMgICAgICAgICAgICAgICAg ICAgIDU0NS45ICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUveDlqMHExMWlsM2I0NjdtbWgxNXA1 dnowOWx3c2NhZHItYWN0aXZhdGUtc2VydmljZS5zY20gICA1OTcuNSAgICAgMC4wICAgMC4wJQov Z251L3N0b3JlL3phcG15Mml6Z3dsZHB6ZDFxMzFmcDNqdm5iMXNhNzgxLXNoZXBoZXJkLXVzZXIt aG9tZXMuc2NtICAgNTQ4LjUgICAgIDAuMCAgIDAuMCUKL2dudS9zdG9yZS9oNHhtMjk4enB4cWh6 cnI0dnlmaDN3cjhkbGExZDVpNy1zaGVwaGVyZC5jb25mICAgICAgICAgMTAyMS44ICAgICAwLjAg ICAwLjAlCi9nbnUvc3RvcmUvNHA2aXlkeDZ2OXc2aWdiYTVnOWEzZ2w4MDlxd2czODMtcGFtLmQg ICAgICAgICAgICAgICAgICAgIDAuMCAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlLzlxNnEydzZx anFsNWRkZG54NzRoeXJrOHgwNnJzcnJqLXNoZXBoZXJkLXVkZXYuc2NtICAgICAgNTgwLjkgICAg IDAuMCAgIDAuMCUKL2dudS9zdG9yZS9wM2psZHFxOTN3d2x2bDNtYmFqNmd2ZHYweGxwbXBrZC1w cm9maWxlICAgICAgICAgICAgICAgICAgMC4wICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUvYWs5 MGltMmJyYjAwa2xmd2M4eTI4YmlweXZxbXc2NTAtc2hlcGhlcmQtbnNjZC5zY20gICAgICA0NTcu NiAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlL2N4bjdqZGtmNGJ2a3doOTMzdzBzaGxibG1mMjBt ZnFuLXNoZXBoZXJkLXVyYW5kb20tc2VlZC5zY20gICAgIDEuNiAgICAgMC4wICAgMC4wJQovZ251 L3N0b3JlL2x2MzNuYzQ3bW4zODJ5bmFoNmZhbDFwODVkNXJqZ25hLXNoZXBoZXJkLXVzZXItcHJv Y2Vzc2VzLnNjbSAgICAgMS42ICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUvNGlocXZhbHZseXd4 bGpyOWw3cTFzbnIyZzlqa2thc2ctc2hlcGhlcmQtdGVybS1hdXRvLnNjbSAgIDU1NC4zICAgICAw LjAgICAwLjAlCi9nbnUvc3RvcmUvdjEwMWdiYXBud3c0cjI4bnB2bW5uY2k5MGJjaDd5MWotYm9v dCAgICAgICAgICAgICAgICAgIDEwNjMuNiAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlL2p3NXp6 bXdrYjJxbjA2NXNjenZtenoyNGZsYXozODdyLXNoZXBoZXJkLWxvb3BiYWNrLnNjbSAgICAgMS42 ICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUvYng5bHg1MTE2ZmZhY2xxc3JqYnNocmQxMHhqc3Bt cTQtc3lzdGVtICAgICAgICAgICAgICAgIDE1MDAuOCAgICAgMC4wICAgMC4wJQovZ251L3N0b3Jl L3dyY2Exdm1qZDBwMDFsbWhjM3F4NzdnMnZsbmx2bTV3LWFjdGl2YXRlLnNjbSAgICAgICAgICAg NjU5LjMgICAgIDAuMCAgIDAuMCUKL2dudS9zdG9yZS94M2h3NjU4YzZrYXhseDBsbm05bm5uOTU1 eTI1cDhjay1zaGVwaGVyZC1ndWl4LWRhZW1vbi5zY20gICA5MTAuNSAgICAgMC4wICAgMC4wJQov Z251L3N0b3JlL2N4MTNxbWNrcXg0aHpoeG03cWRyM2RpZnB4bXNkYm0wLXNoZXBoZXJkLWZpbGUt c3lzdGVtLS1nbnUtc3RvcmUuc2NtICAgICAyLjUgICAgIDAuMCAgIDAuMCUKL2dudS9zdG9yZS9y Z2xnZDd6eDhxN3g3a3d6YjdrMm12cjdscm16NTJqeS1zaGVwaGVyZC1maWxlLXN5c3RlbS0tZGV2 LXNobS5zY20gICAgIDIuNSAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlL3A5NG14cnY2eGFubjVn MHlqcGg0NXNuemQyNzF5YW03LXNoZXBoZXJkLWZpbGUtc3lzdGVtLS1kZXYtcHRzLnNjbSAgICAg Mi41ICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUvM3JzemlrZHlpbXEwMWZnaDV5aDF4aTNsbjFp ampyNTktc2hlcGhlcmQtdXNlci1maWxlLXN5c3RlbXMuc2NtICAgICAxLjYgICAgIDAuMCAgIDAu MCUKL2dudS9zdG9yZS80bmg0cnNpNWcxOHp6OGpwZmYyZmlqcHM0MTQzYmIzcS1maXJtd2FyZSAg ICAgICAgICAgICAgICAgMC4yICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUvM21pd2IweHo3eDJs eXFiajkybDZrNW4ybHd2Z2pueW0tc2hlcGhlcmQtY29uc29sZS1mb250LXR0eTUuc2NtICAgNTMy LjMgICAgIDAuMCAgIDAuMCUKL2dudS9zdG9yZS9iYmRpN2hrbTQyNmJjanNrcG56NzZ4aGtmMDRo cjByZC1zaGVwaGVyZC1jb25zb2xlLWZvbnQtdHR5NC5zY20gICA1MzIuMyAgICAgMC4wICAgMC4w JQovZ251L3N0b3JlL2lnM255ODY3cDNtMW43YnlxeDk1bDJodjVrcmhqa3IwLXNoZXBoZXJkLWNv bnNvbGUtZm9udC10dHkyLnNjbSAgIDUzMi4zICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUvbHA1 cjhhaTIzcXF5Nm5qeWxocHYzemo5Y21jc3M0YTgtc2hlcGhlcmQtY29uc29sZS1mb250LXR0eTMu c2NtICAgNTMyLjMgICAgIDAuMCAgIDAuMCUKL2dudS9zdG9yZS9ua2RxczlqemJteXl6NGk5bTF4 dzdwNzBwMm1jNG5hNS1zaGVwaGVyZC1jb25zb2xlLWZvbnQtdHR5Ni5zY20gICA1MzIuMyAgICAg MC4wICAgMC4wJQovZ251L3N0b3JlL3phN3M4ZjlrazUzNmM2bjFicjJzNjI4ajc1a2xuYzJiLXNo ZXBoZXJkLWNvbnNvbGUtZm9udC10dHkxLnNjbSAgIDUzMi4zICAgICAwLjAgICAwLjAlCi9nbnUv c3RvcmUvNnFmNXB2bThya3E3ZnBoM2w2NDFkZngyZHZ3MnFhYTUtc2hlcGhlcmQtcm9vdC1maWxl LXN5c3RlbS5zY20gICAgIDEuNiAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlL2lpenl2czYxc2cw OTNyNjhpdmgyOXo3dmhtMmJ5MWF3LXNoZXBoZXJkLXRlcm0tdHR5UzAuc2NtICAgNTU0LjMgICAg IDAuMCAgIDAuMCUKL2dudS9zdG9yZS85dzE1aHB2amt3ZzFsYTQzcHJtcHJyMjE4d2E1cXYwMC1z aGVwaGVyZC1zeXNsb2dkLnNjbSAgIDUzNS4zICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUvMnky N212MTJ4ZzI1NXkwMTR5anJ4aGJqcDNhaWliNDItc2hlcGhlcmQtdmlydHVhbC10ZXJtaW5hbC5z Y20gICAgIDEuNiAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlLzBtYnA2Z2w5Zzg2cnZmeHFxYmFn NzM4cGZsNnF4eGNjLXNoZXBoZXJkLXRlcm0tdHR5NC5zY20gICA1MzIuNCAgICAgMC4wICAgMC4w JQovZ251L3N0b3JlLzk5bHY5d2NzN2ljMGNzMDVmcnB6NXY2cW5sNGdteTJnLXNoZXBoZXJkLXRl cm0tdHR5NS5zY20gICA1MzIuNCAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlL2M2N215NTY3MGI5 bGp2bmNzdnowaTY2dmxkNHgzYjByLXNoZXBoZXJkLXRlcm0tdHR5MS5zY20gICA1MzIuNCAgICAg MC4wICAgMC4wJQovZ251L3N0b3JlL2R6cWNoYW1heXhyMTFmaHJyc3h3emkzc2pwa3cxOGJ2LXNo ZXBoZXJkLXRlcm0tdHR5Mi5zY20gICA1MzIuNCAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlL3E5 d2N2bmduZHZ3eDMwaDR5ZmR4a3Y0aHNwMmc1cno1LXNoZXBoZXJkLXRlcm0tdHR5My5zY20gICA1 MzIuNCAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlL3c5YmI1NTUyMmt3eWtneWtxbGNxN3ExODIy ejRzaDBpLXNoZXBoZXJkLXRlcm0tdHR5Ni5zY20gICA1MzIuNCAgICAgMC4wICAgMC4wJQovZ251 L3N0b3JlLzZmendxZmZzeHJteGM3MHNpYmFjcjl2dnppZnlnam04LXNoZXBoZXJkLWZpbGUtc3lz dGVtcy5zY20gICAgIDEuNiAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlL2pqaGEzZG1saGt3NDhk azN2bTZmMXBkbndzMDdqaTNzLXNoZXBoZXJkLWhvc3QtbmFtZS5zY20gICAgIDEuNiAgICAgMC4w ICAgMC4wJQovZ251L3N0b3JlL3pkbXMwMndqeHdqN2hwbGRxN3AwN245aTB2d2F3MXdkLWFjdGl2 YXRlLXNlcnZpY2Uuc2NtICAgNTc3LjkgICAgIDAuMCAgIDAuMCUKL2dudS9zdG9yZS9rMTJ4bWJo eTI1MHJ4YW54bGlmdmQ0ZmRqZzdmbXM4aC1hY3RpdmF0ZS1zZXJ2aWNlLnNjbSAgIDYyOC42ICAg ICAwLjAgICAwLjAlCi9nbnUvc3RvcmUveDA4NjBrcDdwanBqeWY1MWxwcDA1cjhrYTkwZ2R2MHot cGtnLWNvbmZpZy1hYXJjaDY0LWxpbnV4LWdudS0wLjI5LjIgICAgNzIuMyAgICAgMC4wICAgMC4w JQovZ251L3N0b3JlL3k1bnJmYmo1MnZsbmo3N2l5a2k5aGJqaThxandrODZkLXN5c2xvZy5jb25m ICAgICAgICAgICAgICAwLjAgICAgIDAuMCAgIDAuMCUKL2dudS9zdG9yZS8xcTBjeGt4bDBkd3g1 YXppeDVsY2xkMzM4eGtrbmtxNy05MC1rdm0ucnVsZXMgICAgICAgICAgICAgMC4wICAgICAwLjAg ICAwLjAlCi9nbnUvc3RvcmUvdmxjemR4YnlnbTJuZDM4OW0xbms0enZuZjBncTB2MzgtZXh0bGlu dXguY29uZiAgICAgICAgIDE1MDAuOCAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlL2doM3hod2do OTI3bWQ1aWZ6ZG1nMGNncHFjMGFzMXNoLW5zY2QuY29uZiAgICAgICAgICAgICAgICAwLjAgICAg IDAuMCAgIDAuMCUKL2dudS9zdG9yZS93YWp5dzkxaDF5MjEwMm0yeTZpeTYzYzAxMnZhZjl6aS1w YXJhbWV0ZXJzICAgICAgICAgICAgIDI3Mi45ICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUvOXhs MGxicHJra240azNiOHY1YmN6NnNxMTI1ZGx3YjUtYmFzaHJjICAgICAgICAgICAgICAgICAgIDAu MCAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlL3Frem5oNTU4YW5xc2FraWloZHl3cnNkcW1zeDFt ZDdjLWVudmlyb25tZW50ICAgICAgICAgICAgICAyLjAgICAgIDAuMCAgIDAuMCUKL2dudS9zdG9y ZS9pZDByN3c3eDd5ZmprZ21pa3c0aTh3amZnM3ZteGh2eC1hY3RpdmF0ZS1zZXJ2aWNlLnNjbSAg IDU3Ny43ICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUvNXhoZnF6amZsNWlrYWx5dnYzZnJ5Y3Fm cXl3cTBwNjctbW9kcHJvYmUgICAgICAgICAgICAgICA1NzcuNyAgICAgMC4wICAgMC4wJQovZ251 L3N0b3JlL3E2cXJqeWE1czRjOXFycWJrMGs2YjZiY3I5NDNkOG5jLWFjdGl2YXRlLXNlcnZpY2Uu c2NtICAgNjA4LjAgICAgIDAuMCAgIDAuMCUKL2dudS9zdG9yZS83YXJ5YWlhanJ6NWY0eWtqaW0w bG0yOGRyaGZ3dmd3Ni1sb2dpbiAgICAgICAgICAgICAgICAgICAgMC4wICAgICAwLjAgICAwLjAl Ci9nbnUvc3RvcmUvcmhycnJtamtoM3FuczdoZGt5cmJwN2ZoaWpuMnl4M3gtbG9naW4uZGVmcyAg ICAgICAgICAgICAgIDAuMCAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlLzJhaHIxMGlsaWY4Z3J5 NzRzd3hxdmNrcjh3eDMxZDRiLWFjdGl2YXRlLXNlcnZpY2Uuc2NtICAgNTc3LjggICAgIDAuMCAg IDAuMCUKL2dudS9zdG9yZS9rdzVxYXE1NjVnd3FqNXJpdzJ6Y3JrYzI5dmNxdzF6bi1hY3RpdmF0 ZS1zZXJ2aWNlLnNjbSAgIDU3Ny43ICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUvcDZ2MDJubGds bGtzMGF5bG41NjZhamM5bTZyaGw4MjUtc2hlbGxzICAgICAgICAgICAgICAgICA1NDMuOSAgICAg MC4wICAgMC4wJQovZ251L3N0b3JlL3E3cThxempnMTYzeGQyY2tiaGQ2bXJiMGw5eTJ6cmszLXN1 ICAgICAgICAgICAgICAgICAgICAgICAwLjAgICAgIDAuMCAgIDAuMCUKL2dudS9zdG9yZS9ycTNh MGZnOHZoZnY1c2wxMDYyN2txOGF2OGQyc3c4OS1hY3RpdmF0ZS1zZXJ2aWNlLnNjbSAgIDU5OS4x ICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUvdmQwbHFmeTdqMHlmano2c20zdnMwcXhtamlycGw2 c3ctYWNsICAgICAgICAgICAgICAgICAgICAgIDAuMCAgICAgMC4wICAgMC4wJQovZ251L3N0b3Jl L3E3Ynh3NHFwaGJmZHprZ2hzOGZuOWQwYjZtNjI0NzFkLWZzdGFiICAgICAgICAgICAgICAgICAg ICAwLjAgICAgIDAuMCAgIDAuMCUKL2dudS9zdG9yZS8wNG1ubGJkcWRqenBrajVhdmE1dzBnY202 bWdpcGc5aC1wYXNzd2QgICAgICAgICAgICAgICAgICAgMC4wICAgICAwLjAgICAwLjAlCi9nbnUv c3RvcmUveDQ3enJxeGJubng3eXNpbmFpbXE5cnlqbWk0aG45d3otc3VkbyAgICAgICAgICAgICAg ICAgICAgIDAuMCAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlLzYyNm0yajJjZzAzZ2xjejNnYndj and5YXpqcDd6enl2LWdyb3VwbW9kICAgICAgICAgICAgICAgICAwLjAgICAgIDAuMCAgIDAuMCUK L2dudS9zdG9yZS9ic2htaXNrODZqM2FicnBrbGNhejNsNXJnOWxpdnIwYi11c2VyYWRkICAgICAg ICAgICAgICAgICAgMC4wICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUvaDBxMDN3MXNobDUzenk2 bnY5cTgzcTQ3bmJtMTd3MnctZ3JvdXBhZGQgICAgICAgICAgICAgICAgIDAuMCAgICAgMC4wICAg MC4wJQovZ251L3N0b3JlL25sNXg2MTgzd3ExcjB6OGE1dnZ4NDRpcHpkNGY4bTJxLWdyb3VwZGVs ICAgICAgICAgICAgICAgICAwLjAgICAgIDAuMCAgIDAuMCUKL2dudS9zdG9yZS95ZmJnNGg3YXNn czBxcnFsNXBzNGdxcDltOHNkcjBqMi11c2VybW9kICAgICAgICAgICAgICAgICAgMC4wICAgICAw LjAgICAwLjAlCi9nbnUvc3RvcmUveXg3ajNieHNrMzFnamIxemRrNDVzZ3BjcHJiZ2M0MTQtdXNl cmRlbCAgICAgICAgICAgICAgICAgIDAuMCAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlLzZnNHk1 aG5yMzZydjY2a3Z5azRhazByMnFiY2x2N256LW90aGVyICAgICAgICAgICAgICAgICAgICAwLjAg ICAgIDAuMCAgIDAuMCUKL2dudS9zdG9yZS9rNHM4YTI3OThsMjZwMTR4M2pxenlsc2QzMGRnajlj Ni1uc3N3aXRjaC5jb25mICAgICAgICAgICAgMC4wICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUv bDV2cjR3aDE1ZDdpOG1wcTRpaGtuOXh5ZDJsNGRzZmQtdWRldi5jb25mICAgICAgICAgICAgICA1 NzcuMyAgICAgMC4wICAgMC4wJQovZ251L3N0b3JlL3NtNnpyYWd4Yml6cXJmdmcweWtjbjNnMmc3 Y21oem5yLWhvc3RzICAgICAgICAgICAgICAgICAgICAwLjAgICAgIDAuMCAgIDAuMCUKL2dudS9z dG9yZS9tcmswa202Z3F3NHpuMjBhejJicWlkdmFqcHM3eXk5My1tb3RkICAgICAgICAgICAgICAg ICAgICAgMC4wICAgICAwLjAgICAwLjAlCi9nbnUvc3RvcmUvZDdjNGtkYzRxa3drZzlqNmp3Znhq cWkzcHhmem5hcWEtaXNzdWUgICAgICAgICAgICAgICAgICAgIDAuMCAgICAgMC4wICAgMC4wJQov Z251L3N0b3JlL214bmg3cHk3Z2w1bGZtMjgyNWhpamdxamg3cnZiMGdtLXN1ZG9lcnMgICAgICAg ICAgICAgICAgICAwLjAgICAgIDAuMCAgIDAuMCUKL2dudS9zdG9yZS82YzlmeTJ2MXprZzdnZzBh aGZndnZobm44ZHA1ZjRzbi10aW1lem9uZSAgICAgICAgICAgICAgICAgMC4wICAgICAwLjAgICAw LjAlCi9nbnUvc3RvcmUvcHo2Nmg4dmozd2E4NHloMGxqNXNmY3h2Y204M2xnY2ctaG9zdG5hbWUg ICAgICAgICAgICAgICAgIDAuMCAgICAgMC4wICAgMC4wJQo= --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Wed Mar 11 10:25:41 2020 Received: (at 39941) by debbugs.gnu.org; 11 Mar 2020 14:25:41 +0000 Received: from localhost ([127.0.0.1]:55294 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jC2In-0008Ob-KJ for submit@debbugs.gnu.org; Wed, 11 Mar 2020 10:25:41 -0400 Received: from eggs.gnu.org ([209.51.188.92]:57725) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jC2Im-0008OM-2i for 39941@debbugs.gnu.org; Wed, 11 Mar 2020 10:25:40 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:32776) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1jC2Ig-0003jp-V8; Wed, 11 Mar 2020 10:25:35 -0400 Received: from [2a01:e0a:1d:7270:af76:b9b:ca24:c465] (port=38168 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1jC2Ig-0006bu-C8; Wed, 11 Mar 2020 10:25:34 -0400 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Mathieu Othacehe Subject: Re: bug#39941: Disk-image size increase on core-updates. References: <87sgimdjcj.fsf@gmail.com> <87eeu0h8d6.fsf@gmail.com> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 22 =?utf-8?Q?Vent=C3=B4se?= an 228 de la =?utf-8?Q?R?= =?utf-8?Q?=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Wed, 11 Mar 2020 15:25:32 +0100 In-Reply-To: <87eeu0h8d6.fsf@gmail.com> (Mathieu Othacehe's message of "Tue, 10 Mar 2020 10:22:45 +0100") Message-ID: <87a74nhstf.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 39941 Cc: 39941@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Hi, Mathieu Othacehe skribis: > The "guix size" report is attached. Several issues appear: > > * Inclusion of gcc-cross-sans-libc-aarch64-linux-gnu-7.5.0 and > gcc-cross-aarch64-linux-gnu-7.5.0. Could you find out (perhaps by looking at =E2=80=98guix graph -t references= =E2=80=99) what is referencing these two cross-compilers? Thanks, Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Wed Mar 11 10:45:35 2020 Received: (at 39941) by debbugs.gnu.org; 11 Mar 2020 14:45:35 +0000 Received: from localhost ([127.0.0.1]:55330 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jC2c3-0000Sy-5L for submit@debbugs.gnu.org; Wed, 11 Mar 2020 10:45:35 -0400 Received: from mail-wr1-f51.google.com ([209.85.221.51]:34091) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jC2c0-0000Sk-SZ for 39941@debbugs.gnu.org; Wed, 11 Mar 2020 10:45:33 -0400 Received: by mail-wr1-f51.google.com with SMTP id z15so2995625wrl.1 for <39941@debbugs.gnu.org>; Wed, 11 Mar 2020 07:45:32 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=references:user-agent:from:to:cc:subject:in-reply-to:date :message-id:mime-version:content-transfer-encoding; bh=DaJtzF7MNvZgU9g0MOAy6e9vBYVyt9aKrbSirAJtVQY=; b=OZyxm7qQmxwAqhpWIMb3ynxU1Iu6KveFcMurLfFjBzi6Sxno7lceZK+UzXNxURVAo0 U8qoBErvkPyYsHdem31n9VVds4g1xVpc/t/tBfLTNX4ppVnqZ8cGMBgz9UbtTSnDU0K8 /EFuWwBCr9+3aUefsgFwBvs5YdYm0ikiL2gFQPGRAYzbNMPHmOYNWrsISu3NXl/Hibu9 MDAHCdjyl8/krQV1yjCrGRiKH2WD11XW6xVcFr1dOh+55KuVb1VW027j6Pl3AwzsqV63 kldw/N4SFMgck6aBc5eVScPSnjVO+bhEumkbjU2egkpD2TMv9skcrT+Hxiqpv+BxdF9t 0lkA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:references:user-agent:from:to:cc:subject :in-reply-to:date:message-id:mime-version:content-transfer-encoding; bh=DaJtzF7MNvZgU9g0MOAy6e9vBYVyt9aKrbSirAJtVQY=; b=AIUzIGJ8TKjWS3Di/cJ3r47YqRAXG15OFcqLSKJmSOzIgsRFJfcASv8Rr9TMFn2+qG xC9otsB+fBtrmD+DpxZzpfTo0YDbSXVzzkyowf5uMbF+lxqOn25dLuUEH8l0wutwOXaI sNMhtIiEjZI9mwdjPZqkRIKaeVutStJhkSAah50qf5Uiu8vymRPizKWZmXowjPJHlm7i PI425zsPxi8K5O1gFRprSGvTnK7K/TNSyOXMFOXWuyEDN+17BHOkyzNgdsRQyii5aZW0 dxFFvedbPSWcaPtIeaFEvzPnxpnAJA0jAKHupa9WbMUZdJOYBcKazFaoJqDzo+7bIGJN eqIQ== X-Gm-Message-State: ANhLgQ3qpZqKf4w3OX9PtYM7Um8v7ebuXKO8se3IwF5F3DzuIQqTdwMd VhLvphdrRtsOX69Z9e4QjRnvJXzS X-Google-Smtp-Source: ADFU+vtsPC57qVZpnp3O7SdCtwXAlqrMVUeDkUel5rkIlKt0ZXRVUWh1vGvevw1VLQWlgpCV9H81ww== X-Received: by 2002:adf:fc81:: with SMTP id g1mr5070715wrr.410.1583937926628; Wed, 11 Mar 2020 07:45:26 -0700 (PDT) Received: from meru (lfbn-ann-1-269-240.w86-200.abo.wanadoo.fr. [86.200.224.240]) by smtp.gmail.com with ESMTPSA id z11sm8416015wmd.47.2020.03.11.07.45.25 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Wed, 11 Mar 2020 07:45:25 -0700 (PDT) References: <87sgimdjcj.fsf@gmail.com> <87eeu0h8d6.fsf@gmail.com> <87a74nhstf.fsf@gnu.org> User-agent: mu4e 1.2.0; emacs 26.3 From: Mathieu Othacehe To: Ludovic =?utf-8?Q?Court=C3=A8s?= Subject: Re: bug#39941: Disk-image size increase on core-updates. In-reply-to: <87a74nhstf.fsf@gnu.org> Date: Wed, 11 Mar 2020 15:45:24 +0100 Message-ID: <87zhcnympn.fsf@gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 39941 Cc: 39941@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hey, > Could you find out (perhaps by looking at =E2=80=98guix graph -t referenc= es=E2=80=99) > what is referencing these two cross-compilers? Turns out on master, --8<---------------cut here---------------start------------->8--- guix size `guix build guile|grep -v debug` --8<---------------cut here---------------end--------------->8--- returns ~124 MiB, while, --8<---------------cut here---------------start------------->8--- guix size `guix build --target=3Daarch64-linux-gnu guile|grep -v debug` --8<---------------cut here---------------end--------------->8--- returns ~523 MiB. When building the native guile, only the "lib" output of gcc is kept. When cross-compiling, the whole cross-compiler is dragged down (as there's only "out" defined for cross-gcc). That does not explain the sudden increase, but this is still quite unfortunate :p Thanks, Mathieu From debbugs-submit-bounces@debbugs.gnu.org Wed Mar 11 16:33:42 2020 Received: (at 39941) by debbugs.gnu.org; 11 Mar 2020 20:33:43 +0000 Received: from localhost ([127.0.0.1]:55622 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jC82v-00038H-T7 for submit@debbugs.gnu.org; Wed, 11 Mar 2020 16:33:42 -0400 Received: from eggs.gnu.org ([209.51.188.92]:56151) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jC82t-000384-SE for 39941@debbugs.gnu.org; Wed, 11 Mar 2020 16:33:40 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:40422) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1jC82o-0001i5-LN; Wed, 11 Mar 2020 16:33:34 -0400 Received: from [2a01:e0a:1d:7270:af76:b9b:ca24:c465] (port=39216 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1jC82n-0000M1-OL; Wed, 11 Mar 2020 16:33:34 -0400 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Mathieu Othacehe Subject: Re: bug#39941: Disk-image size increase on core-updates. References: <87sgimdjcj.fsf@gmail.com> <87eeu0h8d6.fsf@gmail.com> <87a74nhstf.fsf@gnu.org> <87zhcnympn.fsf@gmail.com> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 22 =?utf-8?Q?Vent=C3=B4se?= an 228 de la =?utf-8?Q?R?= =?utf-8?Q?=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Wed, 11 Mar 2020 21:33:31 +0100 In-Reply-To: <87zhcnympn.fsf@gmail.com> (Mathieu Othacehe's message of "Wed, 11 Mar 2020 15:45:24 +0100") Message-ID: <87r1xyfx7o.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 39941 Cc: 39941@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Hi! Mathieu Othacehe skribis: > Turns out on master, > > guix size `guix build guile|grep -v debug` > > > returns ~124 MiB, while, > > guix size `guix build --target=3Daarch64-linux-gnu guile|grep -v debug` > > returns ~523 MiB. > > When building the native guile, only the "lib" output of gcc is > kept. When cross-compiling, the whole cross-compiler is dragged down (as > there's only "out" defined for cross-gcc). Ah yes, we should try to introduce a =E2=80=9Clib=E2=80=9D output there as = well. I vaguely remember this was tricky but I=E2=80=99m not sure why; worth a try! > That does not explain the sudden increase, but this is still quite > unfortunate :p Yep, would also be nice to track down. Speaking of which, the Data Service has things like: http://data.guix.gnu.org/gnu/store/p8in2npgl5yhliy25ikz7shjbq0gii95-guile= -next-3.0.0 We could eventually use it to track the evolution of the size of individual packages, or that of their closure (even for cross-compiled packages). I remember a discussion with Chris Baines on this but I=E2=80= =99m not sure what the outcome was. Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Thu Mar 12 04:06:39 2020 Received: (at 39941) by debbugs.gnu.org; 12 Mar 2020 08:06:40 +0000 Received: from localhost ([127.0.0.1]:55870 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jCIrX-0005vd-Mp for submit@debbugs.gnu.org; Thu, 12 Mar 2020 04:06:39 -0400 Received: from mail-wm1-f47.google.com ([209.85.128.47]:50457) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jCIrW-0005vM-89 for 39941@debbugs.gnu.org; Thu, 12 Mar 2020 04:06:38 -0400 Received: by mail-wm1-f47.google.com with SMTP id a5so5005952wmb.0 for <39941@debbugs.gnu.org>; Thu, 12 Mar 2020 01:06:38 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=references:user-agent:from:to:cc:subject:in-reply-to:date :message-id:mime-version:content-transfer-encoding; bh=7UVUQ4WVFVVh4R2kWB9a2pB4y1aJAoPT3J1e7Fj7KPA=; b=a9XHlvWSw1vcXnsBtYTczgSngv07+LaST8UC73fVnqoKQoSWjV6I1XSFBXb46PRgE6 KTLnXdLoxFioHghEPX28ziqPXj7qxPeD5CyyogiK5u+KPNmVYXz2Mp/xJKYH/OmC/bSm 8Ky/4cPCuCoUuknxLqfj5ijuheeQgL65kaH0eRmhnL3gpq2sbjaqvYWE8i1jrLwDCACP +sDdUPBt69NFiESg32BWknqTiM08r/tsBWv89/frgspQGKiPWsg4Vor2LuOuhCNAR5EQ zlwCbcBPGuXKlwSzNNAKt61x4DANr3v/TS2UIhexXcmWIWOXc3x1n1wa5110eZoUmRQ5 q7RQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:references:user-agent:from:to:cc:subject :in-reply-to:date:message-id:mime-version:content-transfer-encoding; bh=7UVUQ4WVFVVh4R2kWB9a2pB4y1aJAoPT3J1e7Fj7KPA=; b=ZTZi7woB1ZSpQM46u8LOPYb1Alw7j23b4SiVstdirSe6qM/w3y7/ipp2kDghOQyvr5 NqZI2PuIEIos2MfS4I/tuZtjiM166eKUpZPTOYkxUluWXF3fk1RmLnIRrJqbohdv7Rn8 EC+ZLNCsHIvlQ2rCqsxhF5AE9pytwrmZc0HlXipBTd+1lHxdMuSb5rQY2RfKTVpHGZWU asxi5M7ilOt0J5gPgRouF+n09/LqYq+tdlBSyNQsH41zB+X//UQSgcNWaA2RxWz/x4rp AMFpDZHj/1T9UpboKfUAPJIrfvIO+DGXQ5PvEVqhtHLLPPr0qYd/LlHnq6hVnOdcqi9y xc8A== X-Gm-Message-State: ANhLgQ3/S6ovDEecNDfwBzLWVI7/fUDYsbIOJz6CDom+VTA553gtS56K qVOEpuHEov/nrCQ+NcZDko8= X-Google-Smtp-Source: ADFU+vsmPxcF2tKOUa3upDf6jWcB8BdDtpI0Z30IT5rA+5FvuQiIIMEywusFLfHM9EqVfj/g/QHLrw== X-Received: by 2002:a05:600c:22d9:: with SMTP id 25mr3564698wmg.41.1584000392156; Thu, 12 Mar 2020 01:06:32 -0700 (PDT) Received: from meru (lfbn-ann-1-269-240.w86-200.abo.wanadoo.fr. [86.200.224.240]) by smtp.gmail.com with ESMTPSA id c5sm10098152wma.3.2020.03.12.01.06.30 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Thu, 12 Mar 2020 01:06:31 -0700 (PDT) References: <87sgimdjcj.fsf@gmail.com> <87eeu0h8d6.fsf@gmail.com> <87a74nhstf.fsf@gnu.org> <87zhcnympn.fsf@gmail.com> <87r1xyfx7o.fsf@gnu.org> User-agent: mu4e 1.2.0; emacs 26.3 From: Mathieu Othacehe To: Ludovic =?utf-8?Q?Court=C3=A8s?= Subject: Re: bug#39941: Disk-image size increase on core-updates. In-reply-to: <87r1xyfx7o.fsf@gnu.org> Date: Thu, 12 Mar 2020 09:06:29 +0100 Message-ID: <87wo7qyp2y.fsf@gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 39941 Cc: 39941@debbugs.gnu.org, Christopher Baines X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hi, > Ah yes, we should try to introduce a =E2=80=9Clib=E2=80=9D output there a= s well. I > vaguely remember this was tricky but I=E2=80=99m not sure why; worth a tr= y! Ok then, I'll give it a try. > Speaking of which, the Data Service has things like: > > http://data.guix.gnu.org/gnu/store/p8in2npgl5yhliy25ikz7shjbq0gii95-gui= le-next-3.0.0 > > We could eventually use it to track the evolution of the size of > individual packages, or that of their closure (even for cross-compiled > packages). I remember a discussion with Chris Baines on this but I=E2=80= =99m > not sure what the outcome was. Yep, it would be very helpful to track package closure size and cross-compilation status using the CI. When sending a patch to Linux, you get emails that inform you that you may have broken the build for a specific architecture, in a specific configuration. We would really need this kind of feedback for cross-compilation as very few people actually use it, and it is really easy to break it. That's something I'd like to discuss with Chris soon. Thanks, Mathieu From debbugs-submit-bounces@debbugs.gnu.org Sat Mar 14 06:54:55 2020 Received: (at 39941) by debbugs.gnu.org; 14 Mar 2020 10:54:55 +0000 Received: from localhost ([127.0.0.1]:60651 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jD4RT-0005Ee-0m for submit@debbugs.gnu.org; Sat, 14 Mar 2020 06:54:55 -0400 Received: from mail-wr1-f54.google.com ([209.85.221.54]:40573) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jD4RQ-0005ER-Cz for 39941@debbugs.gnu.org; Sat, 14 Mar 2020 06:54:53 -0400 Received: by mail-wr1-f54.google.com with SMTP id f3so8282038wrw.7 for <39941@debbugs.gnu.org>; Sat, 14 Mar 2020 03:54:52 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=references:user-agent:from:to:cc:subject:in-reply-to:date :message-id:mime-version; bh=1fUyZJ+Wr6viJ+7At4ioktBXVJuUO6hrDF6LRYkuB9E=; b=W3Z/qJShihC+6B6+R4TpKnwjPlCUZANo5fINfBaV03zXdPvNB1sFTric+OdqfmhZZx i+r2MHb8WcxpYfIWKmaxgzCQcn32I/RVuzXTVISqSlvIE1O+oFk194Ztxh+eqmgova7P cUl49gYg2j+xH6Gt4KV5mciemgfghbKiTC26rRduSKsXiyUweFJLP3KCmPh2ReQkF7g4 m/j4J/+lYEWuUocRs3UCk2TRs6VdYjLvDchoTRGE3pjtSUHpswdMflTy4VlbBLJgu/XA QYB8+ajLlvykByj09+S1IiHRu9zhwwpnt4zd+cR3m9Ywt7iaVE0l5zeEadchfGhk3FqL WruA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:references:user-agent:from:to:cc:subject :in-reply-to:date:message-id:mime-version; bh=1fUyZJ+Wr6viJ+7At4ioktBXVJuUO6hrDF6LRYkuB9E=; b=NAUc8aWZcobKOaLME1zmpaeTpP/BTac+pjZQqHarNoP14V5jBlhsq+1hQhg5MtTNMK QKYvwN202IyN0FdPneDyZzEwTHwssl5xQbrCId7grBFJKcFsDjLgeO5uVl4YVQvnX1XF UXVfYHY6VUTtAjQJkngWnzZFpFaOM2K/gt4UMki8Aj25PtP7HwmkIEHhXksGgwUDhTJH CH3nDQ6scb0wwbAjLB88UR8P2/AwqVjVCPRDvhhqfovbp3pIIgylT5otnjH6pr2NuwxC yh/i5g/ZaxjQXAIKQX7pioD2snv9Zkvy1Nb9SZos76mPYSJw5IAxG6qQiGqHsKwciIBG H3xA== X-Gm-Message-State: ANhLgQ0+4LaCk6hiP5xo2F0PFNQ5xN0oD9W/N7fsGeyw5DYzwjuSuDs5 DeBBnCo+IZE03dTOQBEDBaGjrGlT X-Google-Smtp-Source: ADFU+vsRF934WwBVqVkjbNMqkQpF72/6dphgFZWW9p18a7b8meb72OezybM/2jd6lqQIrlFeF9iLPg== X-Received: by 2002:a5d:4683:: with SMTP id u3mr24792005wrq.251.1584183285990; Sat, 14 Mar 2020 03:54:45 -0700 (PDT) Received: from cervin ([2a01:e0a:fa:a50:709f:c263:3a05:fdf9]) by smtp.gmail.com with ESMTPSA id v2sm16706415wme.2.2020.03.14.03.54.41 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sat, 14 Mar 2020 03:54:43 -0700 (PDT) References: <87sgimdjcj.fsf@gmail.com> <87eeu0h8d6.fsf@gmail.com> <87a74nhstf.fsf@gnu.org> <87zhcnympn.fsf@gmail.com> <87r1xyfx7o.fsf@gnu.org> User-agent: mu4e 1.2.0; emacs 26.3 From: Mathieu Othacehe To: Ludovic =?utf-8?Q?Court=C3=A8s?= Subject: Re: bug#39941: Disk-image size increase on core-updates. In-reply-to: <87r1xyfx7o.fsf@gnu.org> Date: Sat, 14 Mar 2020 11:54:40 +0100 Message-ID: <87a74jnr4f.fsf@gmail.com> MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="=-=-=" X-Debbugs-Envelope-To: 39941 Cc: 39941@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" --=-=-= Content-Type: text/plain Hello, Here's a patch that adds a "lib" output to cross-gcc. This was indeed quite tricky! Anyway, with this patch the closure of "hello" for aarch64-linux-gnu is reduced from 469 MiB to 187 MiB. I think we can go further. --8<---------------cut here---------------start------------->8--- mathieu@elbruz ~/guix [env]$ guix size /gnu/store/14ygibryjr7mcly0q9mb8306hlg16nhq-hello-2.10 store item total self /gnu/store/vm2gaw5jk1zr1x9qzj4z52qjxvrh0nk9-glibc-cross-aarch64-linux-gnu-2.31 158.9 71.4 38.2% /gnu/store/w00jb174abikqpznadwzvvgwl3r7qfzd-glibc-2.31 38.4 36.7 19.6% /gnu/store/08vqg0s77dnff7rz90b0h87n2rfyaszg-gcc-7.5.0-lib 71.0 32.6 17.5% /gnu/store/vqsixs9ks4chpjynhizkpdd1gdshv87h-gcc-cross-aarch64-linux-gnu-7.5.0-lib 186.8 27.9 14.9% /gnu/store/fgrpk8r46k34pyqv6xkbi8gbv997dbpx-gcc-cross-sans-libc-aarch64-linux-gnu-7.5.0-lib 80.8 9.8 5.2% /gnu/store/zf5603c5l6ilgyg35gqfkn82v3k9hbri-linux-libre-headers-cross-aarch64-linux-gnu-5.4.20 5.1 5.1 2.7% /gnu/store/6hhsxa3vvbh8gvcfjw4k5sfk1qrhkcrf-bash-static-5.0.16 1.6 1.6 0.9% /gnu/store/nvc3r588745kkj159lm1pa4xz5g99rqd-bash-static-5.0.16 1.6 1.6 0.9% /gnu/store/14ygibryjr7mcly0q9mb8306hlg16nhq-hello-2.10 187.0 0.2 0.1% total: 187.0 MiB --8<---------------cut here---------------end--------------->8--- There are still references to native glibc/gcc and two different bash, that may be removed? WDYT? Thanks, Mathieu --=-=-= Content-Type: text/x-diff; charset=utf-8 Content-Disposition: inline; filename=0001-gnu-cross-gcc-Add-a-lib-output.patch Content-Transfer-Encoding: quoted-printable >From 7df06872de701e1c9237cb7fa36089b1f9e37dd9 Mon Sep 17 00:00:00 2001 From: Mathieu Othacehe Date: Sat, 14 Mar 2020 11:39:52 +0100 Subject: [PATCH] gnu: cross-gcc: Add a "lib" output. Add a "lib" output to cross-gcc. This requires an upstream GCC patch adding support for --with-toolexeclibdir configure option. This option allows to install cross-built GCC libraries in a specific location. This also fixes the computation of TOOLDIR_BASE_PREFIX, that fails when /gnu/store/... directories are involved. * gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch: New file. * gnu/local.mk (dist_patch_DATA): Add it. * gnu/packages/cross-base.scm (cross-gcc)[source]: Apply it, [outputs]: add a "lib" output, (cross-gcc-snippet): fix TOOLDIR_BASE_PREFIX. --- gnu/local.mk | 3 +- gnu/packages/cross-base.scm | 41 +- .../patches/gcc-7-cross-toolexeclibdir.patch | 36585 ++++++++++++++++ 3 files changed, 36615 insertions(+), 14 deletions(-) create mode 100644 gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch diff --git a/gnu/local.mk b/gnu/local.mk index f2e323c345..4080ac78cc 100644 --- a/gnu/local.mk +++ b/gnu/local.mk @@ -14,7 +14,7 @@ # Copyright =C2=A9 2016, 2017, 2018, 2019 Jan (janneke) Nieuwenhuizen # Copyright =C2=A9 2017, 2018, 2019, 2020 Tobias Geerinckx-Rice # Copyright =C2=A9 2017, 2018 Cl=C3=A9ment Lassieur -# Copyright =C2=A9 2017 Mathieu Othacehe +# Copyright =C2=A9 2017, 2020 Mathieu Othacehe # Copyright =C2=A9 2017, 2018, 2019 G=C3=A1bor Boskovits # Copyright =C2=A9 2018 Amirouche Boubekki # Copyright =C2=A9 2018, 2019, 2020 Oleg Pykhalov @@ -909,6 +909,7 @@ dist_patch_DATA =3D \ %D%/packages/patches/gcc-6-source-date-epoch-2.patch \ %D%/packages/patches/gcc-7-cross-mingw.patch \ %D%/packages/patches/gcc-7-cross-environment-variables.patch \ + %D%/packages/patches/gcc-7-cross-toolexeclibdir.patch \ %D%/packages/patches/gcc-8-cross-environment-variables.patch \ %D%/packages/patches/gcc-8-strmov-store-file-names.patch \ %D%/packages/patches/gcc-9-asan-fix-limits-include.patch \ diff --git a/gnu/packages/cross-base.scm b/gnu/packages/cross-base.scm index 667d1f786a..d373e522d5 100644 --- a/gnu/packages/cross-base.scm +++ b/gnu/packages/cross-base.scm @@ -6,6 +6,7 @@ ;;; Copyright =C2=A9 2018 Tobias Geerinckx-Rice ;;; Copyright =C2=A9 2019, 2020 Marius Bakke ;;; Copyright =C2=A9 2019 Carl Dong +;;; Copyright =C2=A9 2020 Mathieu Othacehe ;;; ;;; This file is part of GNU Guix. ;;; @@ -162,6 +163,13 @@ base compiler and using LIBC (which may be either a li= bc package or #f.)" "--disable-libsanitizer" )) =20 + ;; Install cross-built libraries such as libgcc_s.s= o in + ;; the "lib" output. + ,@(if libc + `((string-append "--with-toolexeclibdir=3D" + (assoc-ref %outputs "lib") + "/" ,target "/lib")) + '()) ;; For a newlib (non-glibc) target ,@(if (cross-newlib? target) '("--with-newlib") @@ -196,12 +204,18 @@ base compiler and using LIBC (which may be either a l= ibc package or #f.)" =20 (define (cross-gcc-snippet target) "Return GCC snippet needed for TARGET." - (cond ((target-mingw? target) - '(begin - (copy-recursively "libstdc++-v3/config/os/mingw32-w64" - "libstdc++-v3/config/os/newlib") - #t)) - (else #f))) + `(begin + ,@(if (target-mingw? target) + '((copy-recursively "libstdc++-v3/config/os/mingw32-w64" + "libstdc++-v3/config/os/newlib")) + '()) + ;; TOOLDIR_BASE_PREFIX is erroneous when using a separate "lib" + ;; output. Specify it correctly, otherwise GCC won't find its shared + ;; libraries installed in the "lib" output. + (substitute* "gcc/Makefile.in" + (("-DTOOLDIR_BASE_PREFIX=3D[^ ]*") + "-DTOOLDIR_BASE_PREFIX=3D\\\"../../../../\\\"")) + #t)) =20 (define* (cross-gcc target #:key @@ -220,18 +234,19 @@ target that libc." (patches (append (origin-patches (package-source xgcc)) - (cons (cond - ((version>=3D? (package-version xgcc) "8.0") (searc= h-patch "gcc-8-cross-environment-variables.patch")) - ((version>=3D? (package-version xgcc) "6.0") (searc= h-patch "gcc-6-cross-environment-variables.patch")) - (else (search-patch "gcc-cross-environment-variabl= es.patch"))) + (append (cond + ((version>=3D? (package-version xgcc) "8.0") + (search-patches "gcc-8-cross-environment-variables= .patch")) + ((version>=3D? (package-version xgcc) "6.0") + (search-patches "gcc-7-cross-toolexeclibdir.patch" + "gcc-6-cross-environment-variables= .patch")) + (else (search-patches "gcc-cross-environment-varia= bles.patch"))) (cross-gcc-patches xgcc target)))) (modules '((guix build utils))) (snippet (cross-gcc-snippet target)))) =20 - ;; For simplicity, use a single output. Otherwise libgcc_s & co. are = not - ;; found by default, etc. - (outputs '("out")) + (outputs '("out" "lib")) =20 (arguments `(#:implicit-inputs? #f diff --git a/gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch b/gnu/pa= ckages/patches/gcc-7-cross-toolexeclibdir.patch new file mode 100644 index 0000000000..2686ca83fb --- /dev/null +++ b/gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch @@ -0,0 +1,36585 @@ +This patch taken from GCC upstream adds support for overriding cross-compi= led +shared libraries installation path. This is needed to have a separate "li= b" +output containing those shared libraries. + +From fe6b5640a52a6e75dddea834e357974c205c737c Mon Sep 17 00:00:00 2001 +From: "Maciej W. Rozycki" +Date: Fri, 24 Jan 2020 11:24:25 +0000 +Subject: [PATCH] Add `--with-toolexeclibdir=3D' configuration option + +Provide means, in the form of a `--with-toolexeclibdir=3D' configuration +option, to override the default installation directory for target +libraries, otherwise known as $toolexeclibdir. This is so that it is +possible to get newly-built libraries, particularly the shared ones, +installed in a common place, so that they can be readily used by the +target system as their host libraries, possibly over NFS, without a need +to manually copy them over from the currently hardcoded location they +would otherwise be installed in. + +In the presence of the `--enable-version-specific-runtime-libs' option +and for configurations building native GCC the option is ignored. + + config/ + * toolexeclibdir.m4: New file. + + gcc/ + * doc/install.texi (Cross-Compiler-Specific Options): Document + `--with-toolexeclibdir' option. + + libada/ + * Makefile.in (configure_deps): Add `toolexeclibdir.m4'. + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * configure: Regenerate. + + libatomic/ + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * Makefile.in: Regenerate. + * aclocal.m4: Regenerate. + * configure: Regenerate. + * testsuite/Makefile.in: Regenerate. + + libffi/ + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * Makefile.in: Regenerate. + * aclocal.m4: Regenerate. + * configure: Regenerate. + * include/Makefile.in: Regenerate. + * man/Makefile.in: Regenerate. + * testsuite/Makefile.in: Regenerate. + + libgcc/ + * Makefile.in (configure_deps): Add `toolexeclibdir.m4'. + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * configure: Regenerate. + + libgfortran/ + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * Makefile.in: Regenerate. + * aclocal.m4: Regenerate. + * configure: Regenerate. + + libgomp/ + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * Makefile.in: Regenerate. + * aclocal.m4: Regenerate. + * configure: Regenerate. + * testsuite/Makefile.in: Regenerate. + + libhsail-rt/ + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * Makefile.in: Regenerate. + * aclocal.m4: Regenerate. + * configure: Regenerate. + + libitm/ + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * Makefile.in: Regenerate. + * aclocal.m4: Regenerate. + * configure: Regenerate. + * testsuite/Makefile.in: Regenerate. + + libobjc/ + * Makefile.in (aclocal_deps): Add `toolexeclibdir.m4'. + * aclocal.m4: Include `toolexeclibdir.m4'. + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * configure: Regenerate. + + liboffloadmic/ + * plugin/configure.ac: Handle `--with-toolexeclibdir=3D'. + * plugin/Makefile.in: Regenerate. + * plugin/aclocal.m4: Regenerate. + * plugin/configure: Regenerate. + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * Makefile.in: Regenerate. + * aclocal.m4: Regenerate. + * configure: Regenerate. + + libphobos/ + * m4/druntime.m4: Handle `--with-toolexeclibdir=3D'. + * m4/Makefile.in: Regenerate. + * libdruntime/Makefile.in: Regenerate. + * src/Makefile.in: Regenerate. + * testsuite/Makefile.in: Regenerate. + * Makefile.in: Regenerate. + * aclocal.m4: Regenerate. + * configure: Regenerate. + + libquadmath/ + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * Makefile.in: Regenerate. + * aclocal.m4: Regenerate. + * configure: Regenerate. + + libsanitizer/ + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * Makefile.in: Regenerate. + * aclocal.m4: Regenerate. + * configure: Regenerate. + * asan/Makefile.in: Regenerate. + * interception/Makefile.in: Regenerate. + * libbacktrace/Makefile.in: Regenerate. + * lsan/Makefile.in: Regenerate. + * sanitizer_common/Makefile.in: Regenerate. + * tsan/Makefile.in: Regenerate. + * ubsan/Makefile.in: Regenerate. + + libssp/ + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * Makefile.in: Regenerate. + * aclocal.m4: Regenerate. + * configure: Regenerate. + + libstdc++-v3/ + * acinclude.m4: Handle `--with-toolexeclibdir=3D'. + * Makefile.in: Regenerate. + * aclocal.m4: Regenerate. + * configure: Regenerate. + * doc/Makefile.in: Regenerate. + * include/Makefile.in: Regenerate. + * libsupc++/Makefile.in: Regenerate. + * po/Makefile.in: Regenerate. + * python/Makefile.in: Regenerate. + * src/Makefile.in: Regenerate. + * src/c++11/Makefile.in: Regenerate. + * src/c++17/Makefile.in: Regenerate. + * src/c++98/Makefile.in: Regenerate. + * src/filesystem/Makefile.in: Regenerate. + * testsuite/Makefile.in: Regenerate. + + libvtv/ + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * Makefile.in: Regenerate. + * aclocal.m4: Regenerate. + * configure: Regenerate. + * testsuite/Makefile.in: Regenerate. + + zlib/ + * configure.ac: Handle `--with-toolexeclibdir=3D'. + * Makefile.in: Regenerate. + * aclocal.m4: Regenerate. + * configure: Regenerate. +--- + config/ChangeLog | 148 +- + config/toolexeclibdir.m4 | 31 + + gcc/ChangeLog | 18710 +++----------------- + gcc/doc/install.texi | 4 + + libada/ChangeLog | 68 +- + libada/Makefile.in | 1 + + libada/configure | 29 +- + libada/configure.ac | 12 +- + libatomic/ChangeLog | 162 +- + libatomic/Makefile.in | 1 + + libatomic/aclocal.m4 | 1 + + libatomic/configure | 33 +- + libatomic/configure.ac | 11 +- + libatomic/testsuite/Makefile.in | 1 + + libffi/ChangeLog | 93 +- + libffi/Makefile.in | 1 + + libffi/aclocal.m4 | 1 + + libffi/configure | 33 +- + libffi/configure.ac | 11 +- + libffi/include/Makefile.in | 1 + + libffi/man/Makefile.in | 1 + + libffi/testsuite/Makefile.in | 1 + + libgcc/ChangeLog | 2051 ++- + libgcc/Makefile.in | 1 + + libgcc/configure | 38 +- + libgcc/configure.ac | 25 +- + libgfortran/ChangeLog | 725 +- + libgfortran/Makefile.in | 1 + + libgfortran/aclocal.m4 | 1 + + libgfortran/configure | 33 +- + libgfortran/configure.ac | 11 +- + libgomp/ChangeLog | 4463 ++++- + libgomp/Makefile.in | 1 + + libgomp/aclocal.m4 | 1 + + libgomp/configure | 33 +- + libgomp/configure.ac | 11 +- + libgomp/testsuite/Makefile.in | 1 + + libhsail-rt/ChangeLog | 64 +- + libhsail-rt/Makefile.in | 1 + + libhsail-rt/aclocal.m4 | 1 + + libhsail-rt/configure | 33 +- + libhsail-rt/configure.ac | 11 +- + libitm/ChangeLog | 178 +- + libitm/Makefile.in | 1 + + libitm/aclocal.m4 | 1 + + libitm/configure | 33 +- + libitm/configure.ac | 11 +- + libitm/testsuite/Makefile.in | 1 + + libobjc/ChangeLog | 300 +- + libobjc/Makefile.in | 1 + + libobjc/aclocal.m4 | 1 + + libobjc/configure | 33 +- + libobjc/configure.ac | 11 +- + liboffloadmic/ChangeLog | 65 +- + liboffloadmic/Makefile.in | 1 + + liboffloadmic/aclocal.m4 | 1 + + liboffloadmic/configure | 33 +- + liboffloadmic/configure.ac | 11 +- + liboffloadmic/plugin/Makefile.in | 1 + + liboffloadmic/plugin/aclocal.m4 | 1 + + liboffloadmic/plugin/configure | 33 +- + liboffloadmic/plugin/configure.ac | 11 +- + libquadmath/ChangeLog | 222 +- + libquadmath/Makefile.in | 1 + + libquadmath/aclocal.m4 | 1 + + libquadmath/configure | 33 +- + libquadmath/configure.ac | 11 +- + libsanitizer/ChangeLog | 624 +- + libsanitizer/Makefile.in | 1 + + libsanitizer/aclocal.m4 | 1 + + libsanitizer/asan/Makefile.in | 1 + + libsanitizer/configure | 33 +- + libsanitizer/configure.ac | 11 +- + libsanitizer/interception/Makefile.in | 1 + + libsanitizer/libbacktrace/Makefile.in | 1 + + libsanitizer/lsan/Makefile.in | 1 + + libsanitizer/sanitizer_common/Makefile.in | 1 + + libsanitizer/tsan/Makefile.in | 1 + + libsanitizer/ubsan/Makefile.in | 1 + + libssp/ChangeLog | 59 +- + libssp/Makefile.in | 1 + + libssp/aclocal.m4 | 1 + + libssp/configure | 33 +- + libssp/configure.ac | 11 +- + libstdc++-v3/ChangeLog | 3997 +---- + libstdc++-v3/Makefile.in | 1 + + libstdc++-v3/acinclude.m4 | 11 +- + libstdc++-v3/aclocal.m4 | 1 + + libstdc++-v3/configure | 44 +- + libstdc++-v3/doc/Makefile.in | 1 + + libstdc++-v3/include/Makefile.in | 1 + + libstdc++-v3/libsupc++/Makefile.in | 1 + + libstdc++-v3/po/Makefile.in | 1 + + libstdc++-v3/python/Makefile.in | 1 + + libstdc++-v3/src/Makefile.in | 1 + + libstdc++-v3/src/c++11/Makefile.in | 1 + + libstdc++-v3/src/c++17/Makefile.in | 1 + + libstdc++-v3/src/c++98/Makefile.in | 1 + + libstdc++-v3/src/filesystem/Makefile.in | 1 + + libstdc++-v3/testsuite/Makefile.in | 1 + + libvtv/ChangeLog | 75 +- + libvtv/Makefile.in | 1 + + libvtv/aclocal.m4 | 1 + + libvtv/configure | 33 +- + libvtv/configure.ac | 11 +- + libvtv/testsuite/Makefile.in | 1 + + zlib/ChangeLog.gcj | 33 + + zlib/Makefile.in | 1 + + zlib/aclocal.m4 | 1 + + zlib/configure | 33 +- + zlib/configure.ac | 11 +- + 111 files changed, 11540 insertions(+), 21364 deletions(-) + create mode 100644 config/toolexeclibdir.m4 + +diff --git a/config/ChangeLog b/config/ChangeLog +index 0a71e399754..9c8e40af124 100644 +--- a/config/ChangeLog ++++ b/config/ChangeLog +@@ -1,30 +1,150 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. ++ * toolexeclibdir.m4: New file. +=20 +-2018-12-06 Release Manager ++2019-09-10 Christophe Lyon +=20 +- * GCC 7.4.0 released. ++ * futex.m4: Handle *-uclinux*. ++ * tls.m4 (GCC_CHECK_TLS): Likewise. +=20 +-2018-06-22 Jakub Jelinek ++2019-09-06 Florian Weimer +=20 +- Backported from mainline +- 2018-04-18 David Malcolm ++ * futex.m4 (GCC_LINUX_FUTEX): Include for the syscall ++ function. ++ ++2019-07-08 Richard Sandiford ++ ++ * bootstrap-Og.mk: New file. ++ ++2019-06-25 Kwok Cheung Yeung ++ Andrew Stubbs ++ ++ * gthr.m4 (GCC_AC_THREAD_HEADER): Add case for gcn. ++ ++2019-05-30 Rainer Orth ++ ++ * ax_count_cpus.m4: New file. ++ ++2019-05-02 Richard Biener ++ ++ PR bootstrap/85574 ++ * bootstrap-lto.mk (extra-compare): Set to gcc/lto1$(exeext). ++ ++2019-04-16 Martin Liska ++ ++ * bootstrap-lto-lean.mk: Filter out -flto in STAGEtrain_CFLAGS. ++ ++2019-04-09 Martin Liska ++ ++ * bootstrap-lto-lean.mk: New file. ++ ++2019-03-02 Johannes Pfau ++ ++ * mh-mingw: Also set __USE_MINGW_ACCESS flag for C++ code. ++ ++2018-10-31 Joseph Myers ++ ++ PR bootstrap/82856 ++ * math.m4, tls.m4: Use AC_LANG_SOURCE. ++ ++ Merge from binutils-gdb: ++ 2018-06-19 Simon Marchi ++ ++ * override.m4 (_GCC_AUTOCONF_VERSION): Bump from 2.64 to 2.69. ++ ++2018-10-28 Iain Buclaw ++ ++ * multi.m4: Set GDC. ++ ++2018-07-05 James Clarke ++ ++ * dfp.m4 (enable_decimal_float): Enable for x86_64*-*-gnu* to ++ catch x86_64 kFreeBSD and Hurd. ++ ++2018-06-08 Martin Liska ++ ++ * bootstrap-mpx.mk: Remove. ++ ++2018-05-10 Martin Liska ++ ++ PR bootstrap/64914 ++ * bootstrap-ubsan.mk: Define UBSAN_BOOTSTRAP. ++ ++2018-05-09 Joshua Watt ++ ++ * ax_pthread.m4: Add file. ++ ++2018-05-08 Richard Biener ++ ++ PR bootstrap/85571 ++ * bootstrap-lto-noplugin.mk: Disable compare. ++ * bootstrap-lto.mk: Supply contrib/compare-lto for do-compare. ++ ++2018-04-24 H.J. Lu ++ ++ PR bootstrap/85490 ++ * bootstrap-cet.mk (STAGE4_CFLAGS): New. ++ ++2018-04-24 H.J. Lu ++ ++ PR target/85485 ++ * bootstrap-cet.mk (STAGE2_CFLAGS): Remove -mcet. ++ (STAGE3_CFLAGS): Likewise. ++ ++2018-04-24 H.J. Lu ++ ++ PR target/85485 ++ * cet.m4 (GCC_CET_FLAGS): Replace -mcet with -mshstk. ++ ++2018-04-19 Jakub Jelinek ++ ++ * cet.m4 (GCC_CET_FLAGS): Default to --disable-cet, replace ++ --enable-cet=3Ddefault with --enable-cet=3Dauto. ++ ++2018-04-18 David Malcolm +=20 + PR jit/85384 + * acx.m4 (GCC_BASE_VER): Remove \$\$ from sed expression. +=20 +-2018-01-25 Release Manager ++2018-04-05 H.J. Lu ++ ++ PR gas/22318 ++ * plugins.m4 (AC_PLUGINS): Use dlsym to check if libdl is needed. ++ ++2018-02-14 Igor Tsimbalist ++ ++ PR target/84148 ++ * cet.m4: Check if target support multi-byte NOPS (SSE). ++ ++2018-02-06 Eric Botcazou ++ ++ * gcc-plugin.m4 (GCC_ENABLE_PLUGINS): Remove -q option passed to grep. ++ ++2017-11-14 Boris Kolpackov ++ ++ * gcc-plugin.m4: Add support for MinGW. ++ ++2017-11-17 Igor Tsimbalist ++ ++ * cet.m4: New file. ++ ++2017-11-15 Alexandre Oliva ++ ++ * bootstrap-debug-lean.mk (do-compare): Use the ++ contrib/compare-debug script. ++ ++2017-10-24 H.J. Lu +=20 +- * GCC 7.3.0 released. ++ * bootstrap-cet.mk: New file. +=20 +-2017-08-14 Release Manager ++2017-06-19 Martin Liska +=20 +- * GCC 7.2.0 released. ++ * bootstrap-lto-noplugin.mk: Enable -flto in all PGO stages. ++ * bootstrap-lto.mk: Likewise. +=20 +-2017-05-02 Release Manager ++2017-06-03 Eric Botcazou +=20 +- * GCC 7.1.0 released. ++ * mt-android: New file. +=20 + 2017-02-13 Richard Biener +=20 +@@ -389,7 +509,7 @@ +=20 + * config/mh-interix: Remove as unneeded. + * config/picflag.m4 (i[[34567]]86-*-interix3*): +- Change triplet to i[[34567]]86-*-interix[[3-9]]*. ++ Change triplet to i[[34567]]86-*-interix[[3-9]]*. +=20 + 2012-01-04 Andreas Krebbel +=20 +diff --git a/config/toolexeclibdir.m4 b/config/toolexeclibdir.m4 +new file mode 100644 +index 00000000000..5dd89786219 +--- /dev/null ++++ b/config/toolexeclibdir.m4 +@@ -0,0 +1,31 @@ ++dnl toolexeclibdir override support. ++dnl Copyright (C) 2020 Free Software Foundation, Inc. ++dnl ++dnl This program is free software; you can redistribute it and/or modify ++dnl it under the terms of the GNU General Public License as published by ++dnl the Free Software Foundation; either version 3, or (at your option) ++dnl any later version. ++dnl ++dnl This program is distributed in the hope that it will be useful, ++dnl but WITHOUT ANY WARRANTY; without even the implied warranty of ++dnl MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ++dnl GNU General Public License for more details. ++dnl ++dnl You should have received a copy of the GNU General Public License ++dnl along with this program; see the file COPYING3. If not see ++dnl . ++ ++AC_DEFUN([GCC_WITH_TOOLEXECLIBDIR], ++[AC_ARG_WITH(toolexeclibdir, ++ [AS_HELP_STRING([--with-toolexeclibdir=3DDIR], ++ [install libraries built with a cross compiler within DIR])], ++ [dnl ++case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac], ++ [with_toolexeclibdir=3Dno]) ++]) +diff --git a/gcc/ChangeLog b/gcc/ChangeLog +index 51fed5508dc..f15f03a4a6d 100644 +--- a/gcc/ChangeLog ++++ b/gcc/ChangeLog +@@ -1,16523 +1,2517 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. ++ * doc/install.texi (Cross-Compiler-Specific Options): Document ++ `--with-toolexeclibdir' option. +=20 +-2019-11-01 Iain Sandoe ++2020-01-24 Hans-Peter Nilsson +=20 +- Backport from mainline +- 2019-10-13 Iain Sandoe +- +- * config/darwin.c (machopic_indirection_name): Rework the +- function to emit linker-visible symbols only for indirections +- in the data section. Clean up the code and update comments. +- +-2019-11-01 Iain Sandoe +- +- Backport from mainline +- 2019-10-09 Iain Sandoe +- +- * config/darwin.c (darwin_override_options): Make the check for +- Objective-C ABI version more specific for 64bit code. +- +- Backport from mainline +- 2019-10-06 Iain Sandoe +- +- * config/darwin.c (darwin_override_options): Adjust objective-c +- ABI version error messages to avoid punctuation and contracted +- negations. +- +-2019-11-01 Iain Sandoe +- +- Backport from mainline +- 2019-07-03 Iain Sandoe +- +- * config/darwin.h (REAL_LIBGCC_SPEC): Adjust for earlier Darwin. +- (STARTFILE_SPEC): Split crt3 into a separate spec. +- (DARWIN_EXTRA_SPECS): Add crt2 and crt3 spec. +- (DARWIN_CRT2_SPEC): New. +- (DARWIN_CRT3_SPEC): New. +- (MIN_LD64_OMIT_STUBS): Revise to 62.1. +- * config/rs6000/darwin.h (DARWIN_CRT2_SPEC): Revise conditions. +- (DARWIN_CRT3_SPEC): New. +- +-2019-11-01 Iain Sandoe +- +- Backport from mainline +- 2019-06-27 Iain Sandoe +- +- * config/rs6000/darwin.h (ENDFILE_SPEC): Correct whitespace in the +- spec. +- +- Backport from mainline +- 2019-06-25 Iain Sandoe +- +- * config/rs6000/darwin.h (ENDFILE_SPEC): New. +- +-2019-11-01 Iain Sandoe +- +- Backport from mainline +- 2019-06-18 Iain Sandoe +- +- * config/darwin.c (darwin_emit_unwind_label): New default to false. +- (darwin_override_options): Set darwin_emit_unwind_label as needed. +- +-2019-11-01 Iain Sandoe +- +- Backport from mainline +- 2019-08-13 Iain Sandoe +- +- * config/darwin.c (machopic_indirect_call_target): Rename symbol stub +- flag. +- (darwin_override_options): Likewise. +- * config/darwin.h: Likewise. +- * config/darwin.opt: Likewise. +- * config/i386/i386.c (output_pic_addr_const): Likewise. +- * config/rs6000/darwin.h: Likewise. +- * config/rs6000/rs6000.c (rs6000_call_darwin_1): Likewise. +- * config/i386/darwin.h (TARGET_MACHO_PICSYM_STUBS): Rename to ... +- ... this TARGET_MACHO_SYMBOL_STUBS. +- (FUNCTION_PROFILER):Likewise. +- * config/i386/i386.h: Likewise. +- +- Backport from mainline +- 2019-06-16 Iain Sandoe +- +- * config/darwin.c (machopic_indirect_call_target): Use renamed +- darwin_picsymbol_stubs to decide on output. +- (darwin_override_options): Handle darwin_picsymbol_stubs. +- * config/darwin.h (MIN_LD64_OMIT_STUBS): New. +- (LD64_VERSION): Revise default. +- * config/darwin.opt: (mpic-symbol-stubs): New option. +- (darwin_picsymbol_stubs): New variable. +- * config/i386/darwin.h (TARGET_MACHO_BRANCH_ISLANDS): +- rename to TARGET_MACHO_PICSYM_STUBS. +- * config/i386/i386.c (output_pic_addr_const): Likewise. +- * config/i386/i386.h Likewise. +- * config/rs6000/darwin.h: Likewise. +- * config/rs6000/rs6000.c (rs6000_call_darwin_1): Use renamed +- darwin_picsymbol_stubs. +- +-2019-11-01 Iain Sandoe +- +- Backport from mainline +- 2019-06-28 Iain Sandoe +- +- * config.gcc (powerpc-*-darwin*, powerpc64-*-darwin*): Remove +- override on extra_headers. +- +-2019-11-01 Iain Sandoe +- +- Backport from mainline +- 2019-06-27 Iain Sandoe +- +- * config/rs6000/rs6000.c (darwin_rs6000_override_options): Honour +- user-specified float mode choice for kernel mode code. +- +-2019-11-01 Iain Sandoe +- +- Backport from mainline +- 2019-06-23 Iain Sandoe +- +- * config/rs6000/darwin.h: Handle GCC target pragma. +- +-2019-10-29 Iain Sandoe +- +- Backport from mainline +- 2019-10-17 Iain Sandoe +- +- PR target/65342 +- * config/rs6000/darwin.md (movdi_low, movsi_low_st): Delete. +- (movdi_low_st): Delete. +- * config/rs6000/rs6000.c +- (darwin_rs6000_legitimate_lo_sum_const_p): New. +- (mem_operand_gpr): Validate Mach-O LO_SUM cases separately. +- * config/rs6000/rs6000.md (movsi_low): Delete. +- +-2019-10-29 Iain Sandoe +- +- Backport from mainline +- 2019-10-12 Iain Sandoe +- +- PR target/67183 +- * config/darwin.c (machopic_indirection): New field to flag +- non-lazy-symbol-pointers in the data section. +- (machopic_indirection_name): Compute if an indirection should +- appear in the data section. +- (machopic_output_data_section_indirection): New callback split +- from machopic_output_indirection. +- (machopic_output_stub_indirection): Likewise. +- (machopic_output_indirection): Retain the code for non-lazy +- symbol pointers in their regular section. +- (machopic_finish): Use the new callbacks to order the indirection +- output. +- +-2019-10-29 Iain Sandoe +- +- Backport from mainline +- 2019-10-12 Iain Sandoe +- +- * config/darwin-protos.h (machopic_finish): Delete. +- * config/darwin.c (machopic_finish): Make static. +- +- Backport from mainline +- 2019-10-09 Iain Sandoe +- +- * config/darwin.c (machopic_indirect_data_reference): Set flag to +- indicate that the new symbol is an indirection. +- (machopic_indirect_call_target): Likewise. +- * config/darwin.h (MACHO_SYMBOL_FLAG_INDIRECTION): New. +- (MACHO_SYMBOL_INDIRECTION_P): New. +- (MACHO_SYMBOL_FLAG_STATIC): Adjust bit number. +- +- Backport from mainline +- 2019-10-08 Iain Sandoe +- +- * config/darwin.c (machopic_indirect_data_reference): Check for +- required indirections before making direct access to defined +- values. +- (machopic_output_indirection): Place the indirected pointes for +- required indirections into the non-lazy symbol pointers section. +- (darwin_encode_section_info): +- * config/darwin.h (MACHO_SYMBOL_FLAG_MUST_INDIRECT): New. +- (MACHO_SYMBOL_MUST_INDIRECT_P): New. +- +- Backport from mainline +- 2019-10-07 Iain Sandoe +- +- * config/darwin.c (machopic_output_indirection): Don't put +- hidden symbol indirections into the .data section, use the +- non-lazy symbol pointers section as normal. +- (darwin_encode_section_info): Record if a symbol is hidden. +- * config/darwin.h (MACHO_SYMBOL_FLAG_HIDDEN_VIS): New. +- (MACHO_SYMBOL_HIDDEN_VIS_P): New. +- +- Backport from mainline +- 2019-10-07 Iain Sandoe +- +- * config/darwin.c (machopic_symbol_defined_p): Use symbol flag +- predicates instead of accessing bits directly. +- (machopic_indirect_call_target): Likewise. +- (machopic_output_indirection): Likewise. +- (darwin_encode_section_info): Improve description. Use renamed +- symbol flags. Use predicate macros for variables and functions. +- * config/darwin.h: +- Rename MACHO_SYMBOL_VARIABLE to MACHO_SYMBOL_FLAG_VARIABLE. +- Rename MACHO_SYMBOL_DEFINED to MACHO_SYMBOL_FLAG_DEFINED. +- Rename MACHO_SYMBOL_STATIC to MACHO_SYMBOL_FLAG_STATIC. +- (MACHO_SYMBOL_VARIABLE_P): New. +- (MACHO_SYMBOL_DEFINED_P):New. +- (MACHO_SYMBOL_STATIC_P): New. +- * config/i386/darwin.h (MACHO_SYMBOL_FLAG_VARIABLE): Delete. +- (SYMBOL_FLAG_SUBT_DEP): New. +- * config/rs6000/darwin.h (SYMBOL_FLAG_SUBT_DEP): New. +- +-2019-10-29 Iain Sandoe +- +- Backport from mainline +- 2019-10-05 Iain Sandoe +- +- PR target/59888 +- * config/darwin.c (darwin_rodata_section): Add relocation flag, +- choose const_data section for constants with relocations. +- (machopic_select_section): Pass relocation flag to +- darwin_rodata_section (). +- +-2019-10-29 Iain Sandoe +- +- Backport from mainline +- 2019-09-21 Iain Sandoe +- +- * config/darwin.c (machopic_legitimize_pic_address): Check +- for lra, rather than reload. +- +-2019-10-29 Iain Sandoe +- +- Backport from mainline +- 2019-10-03 Iain Sandoe +- +- PR target/87243 +- * config/darwin-driver.c (maybe_get_sysroot_from_sdkroot): New. +- (darwin_driver_init): Use the sysroot provided by SDKROOT when that +- is available and the user has not set one on the command line. +- +-2019-10-29 Iain Sandoe +- +- Backport from mainline +- 2019-07-03 Iain Sandoe +- +- * config/darwin.h (DRIVER_SELF_SPECS): Remove the linker cases. +- (RDYNAMIC): Rename to, DARWIN_RDYNAMIC. +- (DARWIN_PIE_SPEC, DARWIN_NOPIE_SPEC): Adjust to remove the Xlinker +- clauses. +- (LINK_COMMAND_SPEC_A): Add DARWIN_RDYNAMIC, DARWIN_PIE_SPEC and +- DARWIN_NOPIE_SPEC. +- +- Backport from mainline +- 2019-06-19 Iain Sandoe +- +- * config/darwin.h (DRIVER_SELF_SPECS): Add RDYNAMIC, DARWIN_PIE_SPEC +- and DARWIN_NOPIE_SPEC. +- (RDYNAMIC): New, modified from DARWIN_EXPORT_DYNAMIC. +- (DARWIN_PIE_SPEC): Collate from darwin.h and darwin9.h. +- (DARWIN_NOPIE_SPEC): Collate from darwin10.h. +- (DARWIN_NOCOMPACT_UNWIND): New from darwin10.h +- (DARWIN_EXPORT_DYNAMIC): Delete. +- * config/darwin10.h (LINK_GCC_C_SEQUENCE_SPEC): Move no_compact_unwind +- and pie options processing to darwin.h. +- * config/darwin9.h (DARWIN_PIE_SPEC): Move pie processing to darwin.h +- +-2019-10-25 Richard Earnshaw +- +- Backport from mainline +- 2019-05-08 Mihail Ionescu +- Richard Earnshaw +- PR target/88167 +- * config/arm/arm.c (thumb1_prologue_unused_call_clobbered_lo_regs): New +- function. +- (thumb1_epilogue_unused_call_clobbered_lo_regs): New function. +- (thumb1_compute_save_core_reg_mask): Don't force a spare work +- register if both the epilogue and prologue can use call-clobbered +- regs. +- (thumb1_unexpanded_epilogue): Use +- thumb1_epilogue_unused_call_clobbered_lo_regs. Reverse the logic for +- picking temporaries for restoring high regs to match that of the +- prologue where possible. +- (thumb1_expand_prologue): Add any usable call-clobbered low registers to +- the list of work registers. Detect if the return address is still live +- at the end of the prologue and avoid using it for a work register if so. +- If the return address is not live, add LR to the list of pushable regs +- after the first pass. +- +-2019-10-24 Richard Biener +- +- Backport from mainline +- 2019-10-17 Richard Biener +- +- PR debug/91887 +- * dwarf2out.c (gen_formal_parameter_die): Also try to match +- context_die against a DW_TAG_GNU_formal_parameter_pack parent. +- +- 2019-09-19 Richard Biener +- +- PR tree-optimization/91812 +- * tree-ssa-phiprop.c (propagate_with_phi): Do not replace +- volatile loads. +- +-2019-10-23 Eric Botcazou +- +- PR tree-optimization/92131 +- * tree-vrp.c (extract_range_from_plus_minus_expr): If the resulting +- range would be symbolic, drop to varying for any explicit overflow +- in the constant part or if neither range is a singleton. +- +-2019-10-18 Georg-Johann Lay +- +- Backport from trunk +- 2019-10-18 Georg-Johann Lay +- +- PR target/86040 +- * config/avr/avr.c (avr_out_lpm): Do not shortcut-return. +- +-2019-10-17 Segher Boessenkool +- +- Backport from trunk +- 2019-03-15 Segher Boessenkool +- +- PR rtl-optimization/89721 +- * lra-constraints (invariant_p): Return false if side_effects_p holds. +- +-2019-10-17 Richard Earnshaw +- +- Backport from mainline +- 2019-05-03 Richard Earnshaw +- +- PR target/89400 +- * config/arm/arm.md (unaligned_loadsi): Add variant for thumb1. +- Restrict 'all' variant to 32-bit configurations. +- (unaligned_loadhiu): Likewise. +- (unaligned_storehi): Likewise. +- (unaligned_storesi): Likewise. +- (unaligned_loadhis): Disable when compiling for thumb1. +- +-2019-10-16 Peter Bergner +- +- Backport from mainline +- 2019-10-08 Tulio Magno Quites Machado Filho +- +- * config.gcc: Move -L usage from LINK_OS_EXTRA_SPEC32 and +- LINK_OS_EXTRA_SPEC64 to MD_STARTFILE_PREFIX and +- MD_STARTFILE_PREFIX_1 when using --with-advance-toolchain. +- +-2019-10-11 Oleg Endo +- +- Backport from mainline +- 2019-10-10 Oleg Endo +- +- PR target/88630 +- * config/sh/sh.h (TARGET_FPU_SH4_300): New macro. +- * config/sh/sh.c (sh_option_override): Enable fsca and fsrra insns +- also for TARGET_FPU_SH4_300. +- (sh_emit_mode_set): Check for TARGET_FPU_SH4_300 instead of +- TARGET_SH4_300. +- * config/sh/sh.md (toggle_pr): Add TARGET_FPU_SH4_300 condition. +- (negsf2): Expand to either negsf2_fpscr or negsf2_no_fpscr. +- (*negsf2_i): Split into ... +- (negsf2_fpscr, negsf2_no_fpscr): ... these new patterns. +- (abssf2): Expand to either abssf2_fpsc or abssf2_no_fpsc. +- (**abssf2_i): Split into ... +- (abssf2_fpscr, abssf2_no_fpscr): ... these new patterns. +- (negdf2): Expand to either negdf2_fpscr or negdf2_no_fpscr. +- (*negdf2_i): Split into ... +- (negdf2_fpscr, negdf2_no_fpscr): ... these new patterns. +- (absdf2): Expand to either absdf2_fpscr or absdf2_no_fpsc. +- (**abssf2_i): Split into ... +- (absdf2_fpscr, absdf2_no_fpscr): ... these new patterns. +- +-2019-10-07 Bill Schmidt +- +- Backport from mainline +- 2019-10-01 Bill Schmidt +- +- PR target/91275 +- * config/rs6000/rs6000.c (rtx_is_swappable_p): Don't swap +- vpmsumd. +- +-2019-10-01 Oleg Endo +- +- Backport from mainline +- +- 2019-10-01 Oleg Endo +- +- PR target/88562 +- * config/sh/sh.c (sh_extending_set_of_reg::use_as_extended_reg): Use +- sh_check_add_incdec_notes to preserve REG_INC notes when replacing +- a memory access insn. +- +-2019-09-28 Iain Sandoe +- +- Backport from mainline. +- 2019-05-12 Iain Sandoe +- +- PR target/82920 +- * config/i386/darwin.h (CC1_SPEC): Report -mx32 as an error for +- Darwin. +- +-2019-09-28 Iain Sandoe +- +- Backport from mainline. +- 2019-05-12 Iain Sandoe +- +- PR target/82920 +- * config/i386/i386.c (ix86_output_jmp_thunk_or_indirect): New. +- (ix86_output_indirect_branch_via_reg): Use output mechanism +- accounting for __USER_LABEL_PREFIX__. +- (ix86_output_indirect_branch_via_push): Likewise. +- (ix86_output_function_return): Likewise. +- (ix86_output_indirect_function_return): Likewise. +- +-2019-09-28 Oleg Endo +- +- Backport from mainline +- 2019-09-28 Oleg Endo +- +- PR target/80672 +- * config/sh/sh.c (parse_validate_atomic_model_option): Use +- std::string::compare instead of std::string::find. +- +-2019-09-28 Oleg Endo +- +- Backport from mainline +- 2018-07-15 Jeff Law +- +- PR target/85993 +- * config/sh/sh.c (output_mi_thunk): Remove dead conditional +- block. +- +-2019-09-27 Iain Sandoe +- +- Backport from mainline +- 2019-06-16 Iain Sandoe +- +- * config/darwin.opt (prebind, noprebind, seglinkedit, +- noseglinkedit): Add RejectNegative. +- +- Backport from mainline +- 2019-06-14 Iain Sandoe +- +- * config/darwin.opt: Add RejectNegative where needed, reorder +- and add minimal functional descriptions. +- +-2019-09-23 Max Filippov +- +- Backport from mainline +- 2019-06-18 Max Filippov +- +- * config/xtensa/xtensa.c (xtensa_expand_prologue): Add stack +- pointer adjustment for the case of no callee-saved registers and +- stack frame bigger than 128 bytes. +- +-2019-09-20 John David Anglin +- +- * config/pa/pa.c (pa_trampoline_init): Remove spurious extended +- characters. +- +-2019-09-20 Andreas Krebbel +- +- Backport from mainline +- 2019-06-06 Andreas Krebbel +- +- PR rtl-optimization/88751 +- * ira.c (ira): Use the number of the actually referenced registers +- when calculating the threshold. +- +-2019-09-11 Eric Botcazou +- +- PR rtl-optimization/89795 +- * rtlanal.c (nonzero_bits1) : Do not propagate results from +- inner REGs to paradoxical SUBREGs if WORD_REGISTER_OPERATIONS is set. +- +-2019-09-09 Jakub Jelinek +- +- PR target/87853 +- * config/i386/emmintrin.h (_mm_cmpeq_epi8): Use casts to __v16qi +- instead of __v16qs. +- +- PR target/91704 +- * config/i386/avxintrin.h (__v32qs): New typedef. +- * config/i386/avx2intrin.h (_mm256_cmpgt_epi8): Use casts to __v32qs +- instead of __v32qi. +- +-2019-09-08 Iain Sandoe +- +- Backport from mainline +- 2018-12-23 Iain Sandoe +- +- * config/i386/darwin.h (TARGET_ASM_OUTPUT_IDENT): New. +- +-2019-08-22 Iain Sandoe +- +- Backport from mainline +- 2019-05-31 Iain Sandoe +- +- * config/i386/darwin.h (ASM_OUTPUT_MAX_SKIP_ALIGN): New. +- +-2019-09-05 Iain Sandoe +- +- Backport from mainline +- 2019-08-18 Iain Sandoe +- +- * config/rs6000/darwin.h (TARGET_OS_CPP_BUILTINS): Add asserts +- for cpu and machine. Factor 64/32b builtins. +- +- Backport from mainline +- 2019-06-23 Iain Sandoe +- +- * config/rs6000/darwin.h: (__PPC__, __PPC64__): New. +- +-2019-09-05 Iain Sandoe +- +- Backport from mainline +- 2019-08-23 Iain Sandoe +- +- PR pch/61250 +- * ggc-page.c (ggc_pch_read): Read the ggc_pch_ondisk structure +- and issue any diagnostics needed before collecting the pre-PCH +- state. +- +-2019-09-05 Iain Sandoe +- +- Backport from mainline +- 2019-07-24 Iain Sandoe +- +- PR bootstrap/87030 +- * config/i386/darwin.h (REAL_LIBGCC_SPEC): Revert change from r273749. +- +- PR bootstrap/87030 +- * config/i386/darwin.h (REAL_LIBGCC_SPEC): Move from here... +- * config/i386/darwin32-biarch.h .. to here. +- * config/i386/darwin64-biarch.h: Adjust comments. +- * config/rs6000/darwin32-biarch.h: Likewise. +- * config/rs6000/darwin64-biarch.h: Likewise. +- * config.gcc: Missed commit from r273746 +- (*-*-darwin*): Don't include CPU t-darwin here. +- (i[34567]86-*-darwin*): Adjust to use biarch files. Produce +- an error message if i686-darwin configuration is attempted for +- Darwin >=3D 18. +- +- Backport from mainline +- 2019-07-23 Iain Sandoe +- +- PR bootstrap/87030 +- * config.gcc (*-*-darwin*): Don't include CPU t-darwin here. +- (i[34567]86-*-darwin*): Adjust to use biarch files. Produce +- an error message if i686-darwin configuration is attempted for +- Darwin >=3D 18. +- (x86_64-*-darwin*): Switch to single multilib for Darwin >=3D 18. +- (powerpc-*-darwin*): Use biarch files where needed. +- (powerpc64-*-darwin*): Likewise. +- * config/i386/darwin.h (REAL_LIBGCC_SPEC): Move to new biarch file. +- (DARWIN_ARCH_SPEC, DARWIN_SUBARCH_SPEC): Revise for default single +- arch case. +- * config/i386/darwin32-biarch.h: New. +- * config/i386/darwin64.h: Rename. +- * gcc/config/i386/darwin64-biarch.h: To this. +- * config/i386/t-darwin: Rename. +- * gcc/config/i386/t-darwin32-biarch: To this. +- * config/i386/t-darwin64: Rename. +- * gcc/config/i386/t-darwin64-biarch: To this. +- * config/rs6000/darwin32-biarch.h: New. +- * config/rs6000/darwin64.h: Rename. +- * config/rs6000/darwin64-biarch.h: To this. +- (DARWIN_ARCH_SPEC, DARWIN_SUBARCH_SPEC): Revise for default single +- arch case. +- * config/rs6000/t-darwin8: Rename. +- * config/rs6000/t-darwin32-biarch: To this. +- * config/rs6000/t-darwin64 Rename. +- * config/rs6000/t-darwin64-biarch: To this. +- +-2019-09-05 Richard Biener +- +- * lto-streamer.h (LTO_minor_version): Bump. +- +- Backport from mainline +- 2019-05-06 Richard Biener +- +- PR tree-optimization/90328 +- * tree-data-ref.h (dr_may_alias_p): Pass in the actual loop nest. +- * tree-data-ref.c (dr_may_alias_p): Check whether the clique +- is valid in the loop nest before using it. +- (initialize_data_dependence_relation): Adjust. +- * graphite-scop-detection.c (build_alias_set): Pass the SCOP enclosing +- loop as loop-nest to dr_may_alias_p. +- +- 2019-03-08 Richard Biener +- +- PR middle-end/89578 +- * cfgloop.h (struct loop): Add owned_clique field. +- * cfgloopmanip.c (copy_loop_info): Copy it. +- * tree-cfg.c (gimple_duplicate_bb): Do not remap owned_clique +- cliques. +- * tree-inline.c (copy_loops): Remap owned_clique. +- * lto-streamer-in.c (input_cfg): Stream owned_clique. +- * lto-streamer-out.c (output_cfg): Likewise. +- +- 2019-02-22 Richard Biener +- +- PR tree-optimization/87609 +- * tree-cfg.c (gimple_duplicate_bb): Only remap inlined cliques. +- +- 2019-02-22 Richard Biener +- +- PR middle-end/87609 +- * cfghooks.h (dependence_hash): New typedef. +- (struct copy_bb_data): New type. +- (cfg_hooks::duplicate_block): Adjust to take a copy_bb_data argument. +- (duplicate_block): Likewise. +- * cfghooks.c (duplicate_block): Pass down copy_bb_data. +- (copy_bbs): Create and pass down copy_bb_data. +- * cfgrtl.c (cfg_layout_duplicate_bb): Adjust. +- (rtl_duplicate_bb): Likewise. +- * tree-cfg.c (gimple_duplicate_bb): If the copy_bb_data arg is not NULL +- remap dependence info. +- +- 2019-02-22 Richard Biener +- +- PR tree-optimization/87609 +- * tree-core.h (tree_base): Document special clique values. +- * tree-inline.c (remap_dependence_clique): Do not use the +- special clique value of one. +- (maybe_set_dependence_info): Use clique one. +- (clear_dependence_clique): New callback. +- (compute_dependence_clique): Clear clique one from all refs +- before assigning it (again). +- +-2019-08-27 Iain Sandoe +- +- Backport from mainline +- 2019-07-07 Iain Sandoe +- +- * config/darwin.c (darwin_override_options): Make a final check on PIC +- options. +- +-2019-09-04 Iain Sandoe +- +- Backport from mainline +- 2019-07-07 Iain Sandoe +- * config/darwin.c (darwin_override_options): Don't jam symbol stubs +- on for kernel code. +- +-2019-09-04 Iain Sandoe +- +- Backport from mainline +- 2019-06-27 Iain Sandoe +- +- * config/rs6000/rs6000.c (darwin_rs6000_override_options): Do not +- use longcall for 64b code. +- +-2019-09-04 Iain Sandoe +- +- Backport from mainline +- 2019-06-19 Iain Sandoe +- +- * config/darwin-driver.c (darwin_driver_init): Fix off-by-one errors +- in computing the number of options to be moved. +- +- Backport from mainline +- 2019-06-13 Iain Sandoe +- +- * config/darwin-driver.c (validate_macosx_version_min): New. +- (darwin_default_min_version): Cleanup and validate supplied version. +- (darwin_driver_init): Likewise and push cleaned version into opts. +- +-2019-09-04 Richard Biener +- +- Backport from mainline +- 2019-03-26 Bin Cheng +- +- PR tree-optimization/81740 +- * tree-vect-data-refs.c (vect_analyze_data_ref_dependence): +- In case of outer loop vectorization, check for backward dependence +- at the inner loop if outer loop dependence is reversed. +- +-2019-09-04 Richard Biener +- +- Backport from mainline +- 2018-11-23 Richard Biener +- +- PR tree-optimization/88149 +- * tree-vect-slp.c (vect_slp_analyze_node_operations): Detect +- the case where there are two different def types for the +- same operand at different operand position in the same stmt. +- +-2019-09-04 Richard Biener +- +- Backport from mainline +- 2019-04-09 Richard Sandiford +- +- * tree-vect-data-refs.c (vect_get_smallest_scalar_type): Always +- use gimple_expr_type for load and store calls. Skip over the +- condition argument in a conditional internal function. +- Protect use of TREE_INT_CST_LOW. +- +- 2019-04-08 Richard Biener +- +- PR tree-optimization/90006 +- * tree-vect-data-refs.c (vect_get_smallest_scalar_type): Handle +- calls like lrint. +- +- 2019-03-14 Richard Biener +- +- PR middle-end/89698 +- * fold-const.c (operand_equal_p): For INDIRECT_REF check +- that the access types are similar. +- +- 2019-01-18 Richard Biener +- +- PR tree-optimization/88903 +- * tree-vect-stmts.c (vectorizable_shift): Verify we see all +- scalar stmts a SLP shift amount is composed of when detecting +- shifts by scalars. +- +- 2018-12-11 Richard Biener +- +- PR middle-end/88448 +- PR middle-end/88415 +- * tree-complex.c (update_complex_assignment): Properly transfer +- or clean EH info around gimple_assign_set_rhs_with_ops. +- +- 2018-11-15 Richard Biener +- +- PR tree-optimization/88030 +- * tree-complex.c (need_eh_cleanup): New global. +- (update_complex_assignment): Mark blocks that need EH update. +- (expand_complex_comparison): Likewise. +- (tree_lower_complex): Allocate and deallocate need_eh_cleanup, +- perform EH cleanup and schedule CFG cleanup if that did anything. +- +- 2018-11-08 Richard Biener +- +- PR tree-optimization/87929 +- * tree-complex.c (expand_complex_comparison): Clean EH. +- +- 2017-07-25 Eric Botcazou +- +- * gimple.c (gimple_assign_set_rhs_with_ops): Do not ask gsi_replace +- to update EH info here. +- +-2019-09-03 Iain Sandoe +- +- Backport from mainline +- 2019-05-18 Iain Sandoe +- +- * config/darwin-c.c (darwin_register_objc_includes): Do not +- prepend the sysroot when building gnu-runtime header search +- paths. +- +-2019-09-03 Iain Sandoe +- +- Backport from mainline +- 2019-05-18 Iain Sandoe +- +- * config/darwin.c (darwin_file_end): Use switch_to_section () +- instead of direct output of the asm. +- +-2019-09-03 Iain Sandoe +- +- Backport from mainline +- 2018-08-22 Iain Sandoe +- +- * config/darwin.h (LINK_COMMAND_SPEC_A): Update lto options +- to match gcc/gcc.c. +- +-2019-09-02 Richard Biener +- +- Backport from mainline +- 2019-03-14 Richard Biener +- +- PR tree-optimization/89710 +- * tree-ssa-loop-ch.c (should_duplicate_loop_header_p): Use +- safe_dyn_cast. +- +- 2019-03-14 Richard Biener +- +- PR middle-end/89572 +- * tree-scalar-evolution.c (get_loop_exit_condition): Use +- safe_dyn_cast. +- * tree-ssa-loop-ivcanon.c (canonicalize_loop_induction_variables): +- Use gimple_location_safe. +- +- 2019-02-18 Richard Biener +- +- PR tree-optimization/89296 +- * tree-ssa-loop-ch.c (ch_base::copy_headers): Restrict setting +- of no-warning flag to cases that might emit the bogus warning. +- +- 2019-01-31 Richard Biener +- +- PR tree-optimization/89135 +- * tree-ssa-phiprop.c (pass_phiprop::execute): Skip blocks +- with abnormal preds. +- +-2019-09-02 Richard Biener +- +- Backport from mainline +- 2019-07-19 Richard Biener +- +- PR tree-optimization/91200 +- * tree-ssa-phiopt.c (cond_store_replacement): Check we have +- no PHI nodes in middle-bb. +- +- 2019-07-15 Richard Biener +- +- PR middle-end/91162 +- * tree-cfg.c (move_block_to_fn): When releasing a virtual PHI +- node make sure to replace all uses with something valid. +- +- 2019-07-11 Richard Biener +- +- PR middle-end/91131 +- * gimplify.c (gimplify_compound_literal_expr): Force a temporary +- when the object is volatile and we have not cleared it even though +- there are no nonzero elements. +- +- 2019-07-10 Richard Biener +- +- PR tree-optimization/91126 +- * tree-ssa-sccvn.c (n_walk_cb_data::push_partial_def): Adjust +- native encoding offset for BYTES_BIG_ENDIAN. +- (vn_reference_lookup_3): Likewise. +- +- 2019-07-10 Richard Biener +- +- PR tree-optimization/91126 +- * tree-ssa-sccvn.c (vn_reference_lookup_3): Adjust +- native encoding offset for BYTES_BIG_ENDIAN. +- +- 2019-04-29 Richard Biener +- +- PR tree-optimization/90278 +- * tree-ssa-forwprop.c (pass_forwprop::execute): Transfer/clean +- EH on comparison simplification. +- +- 2019-04-11 Richard Biener +- +- PR tree-optimization/90020 +- * tree-ssa-sccvn.c (vn_reference_may_trap): New function. +- * tree-ssa-sccvn.h (vn_reference_may_trap): Declare. +- * tree-ssa-pre.c (compute_avail): Use it to not put +- possibly trapping references after a call that might not +- return into EXP_GEN. +- * gcse.c (compute_hash_table_work): Do not elide +- marking a block containing a call if the call might not +- return. +- +-2019-09-02 Bin Cheng +- +- Backport from mainline +- 2019-07-18 Bin Cheng +- +- PR tree-optimization/91137 +- * tree-ssa-loop-ivopts.c (struct ivopts_data): New field. +- (tree_ssa_iv_optimize_init, alloc_iv, tree_ssa_iv_optimize_finalize): +- Init, use and fini the above new field. +- (determine_base_object_1): New function. +- (determine_base_object): Reimplement using walk_tree. +- +-2019-08-30 Richard Biener +- +- Backport from mainline +- 2019-05-27 Richard Biener +- +- PR tree-optimization/90637 +- * tree-ssa-sink.c (statement_sink_location): Honor the +- computed sink location for single-uses. +- +- * gcc.dg/gomp/pr90637.c: New testcase. +- +- 2019-06-21 Richard Biener +- +- PR tree-optimization/90930 +- * tree-ssa-reassoc.c (rewrite_expr_tree_parallel): Set visited +- flag on new stmts to avoid re-processing them. +- +- 2019-04-25 Richard Biener +- +- PR middle-end/90194 +- * match.pd: Add pattern to simplify view-conversion of an +- empty constructor. +- +- 2019-04-24 Richard Biener +- +- PR middle-end/90213 +- * gimple-fold.c (fold_const_aggregate_ref_1): Do multiplication +- by size and BITS_PER_UNIT on poly-wide-ints. +- +- 2019-04-15 Richard Biener +- +- PR tree-optimization/90071 +- * tree-ssa-reassoc.c (init_range_entry): Do not pick up +- abnormal operands from def stmts. +- +- 2019-03-13 Richard Biener +- +- PR middle-end/89677 +- * tree-scalar-evolution.c (simplify_peeled_chrec): Do not +- throw FP expressions at tree-affine. +- +-2019-08-30 Segher Boessenkool +- +- Backport from trunk +- 2019-08-22 Segher Boessenkool +- +- PR target/91481 +- * config/rs6000/rs6000.md (unspec): Delete UNSPEC_DARN, UNSPEC_DARN_32, +- and UNSPEC_DARN_RAW. +- (unspecv): New enumerator values UNSPECV_DARN, UNSPECV_DARN_32, and +- UNSPECV_DARN_RAW. +- (darn_32): Use an unspec_volatile, and UNSPECV_DARN_32. +- (darn_raw): Use an unspec_volatile, and UNSPECV_DARN_RAW. +- (darn): Use an unspec_volatile, and UNSPECV_DARN. +- +-2019-08-30 Segher Boessenkool +- +- Backport from trunk +- 2019-08-22 Segher Boessenkool +- +- * config/rs6000/altivec.md (unspec): Delete UNSPEC_DARN, UNSPEC_DARN_32, +- UNSPEC_DARN_RAW, UNSPEC_CMPRB, UNSPEC_CMPRB2, UNSPEC_CMPEQB; move to... +- * config/rs6000/rs6000.md (unspec): ... here. +- * config/rs6000/altivec.md (darn_32, darn_raw, darn, cmprb, +- *cmprb_internal, setb_signed, setb_unsigned, cmprb2, *cmprb2_internal, +- cmpeqb, *cmpeqb_internal): Delete, move to... +- * config/rs6000/rs6000.md (darn_32, darn_raw, darn, cmprb, +- *cmprb_internal, setb_signed, setb_unsigned, cmprb2, *cmprb2_internal, +- cmpeqb, *cmpeqb_internal): ... here. +- +-2019-08-30 Jakub Jelinek +- +- Backported from mainline +- 2019-07-30 Jakub Jelinek +- +- PR target/91150 +- * config/i386/i386.c (expand_vec_perm_blend): Change mask type +- from unsigned to unsigned HOST_WIDE_INT. For E_V64QImode cast +- comparison to unsigned HOST_WIDE_INT before shifting it left. +- +- 2019-07-04 Jakub Jelinek +- +- PR middle-end/78884 +- * gimplify.c (struct gimplify_omp_ctx): Add add_safelen1 member. +- (gimplify_bind_expr): If seeing TREE_ADDRESSABLE VLA inside of simd +- loop body, set ctx->add_safelen1 instead of making it GOVD_PRIVATE. +- (gimplify_adjust_omp_clauses): Add safelen (1) clause if +- ctx->add_safelen1 is set. +- +- PR rtl-optimization/90756 +- * explow.c (promote_ssa_mode): Always use TYPE_MODE, don't bypass it +- for VECTOR_TYPE_P. +- +- 2019-06-12 Jakub Jelinek +- +- PR c/90760 +- * symtab.c (symtab_node::set_section): Allow being called on aliases +- as long as they aren't analyzed yet. +- +- 2019-04-19 Jakub Jelinek +- +- PR middle-end/90139 +- * tree-outof-ssa.c (get_temp_reg): If reg_mode is BLKmode, return +- assign_temp instead of gen_reg_rtx. +- +- 2019-06-11 Jakub Jelinek +- +- PR target/90811 +- * config/nvptx/nvptx.c (nvptx_output_softstack_switch): Use and.b%d +- instead of and.u%d. +- +- 2019-05-29 Jakub Jelinek +- +- PR fortran/90329 +- * lto-streamer.h (LTO_minor_version): Bump to 1. +- +- 2019-05-16 Jakub Jelinek +- +- PR fortran/90329 +- * tree-core.h (struct tree_decl_common): Document +- decl_nonshareable_flag for PARM_DECLs. +- * tree.h (DECL_HIDDEN_STRING_LENGTH): Define. +- * calls.c (expand_call): Don't try tail call if caller +- has any DECL_HIDDEN_STRING_LENGTH PARM_DECLs that are or might be +- passed on the stack and callee needs to pass any arguments on the +- stack. +- * tree-streamer-in.c (unpack_ts_decl_common_value_fields): Use +- else if instead of series of mutually exclusive ifs. Handle +- DECL_HIDDEN_STRING_LENGTH for PARM_DECLs. +- * tree-streamer-out.c (pack_ts_decl_common_value_fields): Likewise. +- +- 2019-04-24 Jakub Jelinek +- +- PR target/90187 +- * config/i386/i386.c (ix86_expand_sse_fp_minmax): Force if_true into +- a register if both if_true and if_false are MEMs. +- +- PR tree-optimization/90208 +- * tree-cfg.c (remove_bb): Move forced labels from removed bbs +- after labels of new_bb, not before them. +- +- 2019-04-16 Jakub Jelinek +- +- PR rtl-optimization/90082 +- * dce.c (can_delete_call): New function. +- (deletable_insn_p, mark_insn): Use it. +- +- PR tree-optimization/90090 +- * tree-ssa-math-opts.c (is_division_by): Ignore divisions that can +- throw internally. +- +- 2019-04-09 Jakub Jelinek +- +- PR tree-optimization/89998 +- * gimple-ssa-sprintf.c (try_substitute_return_value): Use lhs type +- instead of integer_type_node if possible, don't add ranges if return +- type is not compatible with int. +- * gimple-fold.c (gimple_fold_builtin_sprintf, +- gimple_fold_builtin_snprintf): Use lhs type instead of hardcoded +- integer_type_node. +- +- 2019-03-29 Jakub Jelinek +- +- PR c/89872 +- * gimplify.c (gimplify_compound_literal_expr): Don't optimize a +- non-addressable complit into its initializer if it is volatile. +- +- 2019-03-28 Jakub Jelinek +- +- PR middle-end/89621 +- * tree-inline.h (struct copy_body_data): Add +- dont_remap_vla_if_no_change flag. +- * tree-inline.c (remap_type_3, remap_type_2): New functions. +- (remap_type): Don't remap vla types if id->dont_remap_vla_if_no_change +- and remap_type_2 returns false. +- * omp-low.c (new_omp_context): Set ctx->cb.dont_remap_vla_if_no_change. +- +- 2019-03-20 Jakub Jelinek +- +- PR target/89752 +- * lra-constraints.c (process_alt_operands) : For BLKmode, don't +- update this_alternative nor this_alternative_set. +- +- 2019-03-19 Jakub Jelinek +- +- PR rtl-optimization/89768 +- * loop-unroll.c (unroll_loop_constant_iterations): Use gen_int_mode +- instead of GEN_INT. +- (unroll_loop_runtime_iterations): Likewise. +- +- PR target/89752 +- * gimplify.c (gimplify_asm_expr): For output argument with +- TREE_ADDRESSABLE type, clear allows_reg if it allows memory, otherwise +- diagnose error. +- +- PR target/89726 +- * config/i386/i386.c (ix86_expand_floorceildf_32): In ceil +- compensation use x2 +=3D 1 instead of x2 -=3D -1 and when honoring +- signed zeros, do another copysign after the compensation. +- +- 2019-03-15 Jakub Jelinek +- +- PR debug/89704 +- * dwarf2out.c (add_const_value_attribute): Return false for MINUS, +- SIGN_EXTEND and ZERO_EXTEND. +- +- 2019-03-14 Jakub Jelinek +- +- PR rtl-optimization/89679 +- * expmed.c (expand_mult_const): Don't add a REG_EQUAL note if it +- would contain a paradoxical SUBREG. +- +- PR tree-optimization/89703 +- * tree-ssa-strlen.c (valid_builtin_call): Punt if stmt call types +- aren't compatible also with builtin_decl_explicit. Check pure +- or non-pure status of BUILT_IN_STR{{,N}CMP,N{LEN,{CAT,CPY}{,_CHK}}} +- and BUILT_IN_STPNCPY{,_CHK}. +- +- 2019-03-13 Jakub Jelinek +- +- PR middle-end/88588 +- * omp-simd-clone.c (ipa_simd_modify_stmt_ops): Handle PHI args. +- (ipa_simd_modify_function_body): Handle PHIs. +- +- 2019-03-12 Jakub Jelinek +- +- PR middle-end/89663 +- * builtins.c (expand_builtin_int_roundingfn, +- expand_builtin_int_roundingfn_2): Return NULL_RTX instead of +- gcc_unreachable if validate_arglist fails. +- +- 2019-03-09 Jakub Jelinek +- +- PR c/88568 +- * tree.c (handle_dll_attribute): Don't clear TREE_STATIC for +- dllimport on VAR_DECLs with RECORD_TYPE or UNION_TYPE DECL_CONTEXT. +- +- 2019-03-05 Jakub Jelinek +- +- PR target/89587 +- * config/rs6000/t-linux (MULTIARCH_DIRNAME): Set to non-empty only +- if_multiarch. +- +- PR middle-end/89590 +- * builtins.c (maybe_emit_free_warning): Punt if free doesn't have +- exactly one argument. +- +- 2019-02-28 Jakub Jelinek +- +- PR c/89520 +- * convert.c (convert_to_real_1, convert_to_integer_1): Punt for +- builtins if they don't have a single scalar floating point argument. +- Formatting fixes. +- +- 2019-02-20 Jakub Jelinek +- +- PR middle-end/89412 +- * expr.c (expand_assignment): If result is a MEM, use change_address +- instead of simplify_gen_subreg. +- +- 2019-02-20 Jakub Jelinek +- David Malcolm +- +- PR middle-end/89091 +- * fold-const.c (decode_field_reference): Return NULL_TREE if +- lang_hooks.types.type_for_size returns NULL. Check it before +- overwriting *exp_. Use return NULL_TREE instead of return 0. +- +- 2019-02-20 Jakub Jelinek +- +- PR middle-end/88074 +- PR middle-end/89415 +- * toplev.c (do_compile): Double the emin/emax exponents to workaround +- buggy mpc_norm. +- +- 2019-02-19 Richard Biener +- +- PR middle-end/88074 +- * toplev.c (do_compile): Initialize mpfr's exponent range +- based on available float modes. +- +- 2019-02-18 Jakub Jelinek +-=20 +- PR target/89361 +- * config/s390/s390.c (s390_indirect_branch_attrvalue, +- s390_indirect_branch_settings): Define unconditionally. +- (s390_set_current_function): Likewise, but guard the whole body except +- the s390_indirect_branch_settings call with +- #if S390_USE_TARGET_ATTRIBUTE. +- (TARGET_SET_CURRENT_FUNCTION): Redefine unconditionally. +- +- 2019-02-15 Richard Biener +- Jakub Jelinek +- +- PR tree-optimization/89278 +- * tree-loop-distribution.c: Include tree-eh.h. +- (generate_memset_builtin, generate_memcpy_builtin): Call +- rewrite_to_non_trapping_overflow on builtin->size before passing it +- to force_gimple_operand_gsi. +- +- 2019-02-15 Jakub Jelinek +- +- PR other/89342 +- * optc-save-gen.awk: Handle optimize_fast like optimize_size or +- optimize_debug. +- * opth-gen.awk: Likewise. +- +- 2019-02-14 Jakub Jelinek +- +- PR rtl-optimization/89354 +- * combine.c (make_extraction): Punt if extraction_mode is narrower +- than len bits. +- +- PR tree-optimization/89314 +- * fold-const.c (fold_binary_loc): Cast strlen argument to +- const char * before dereferencing it. Formatting fixes. +- +- 2019-02-13 Jakub Jelinek +- +- PR middle-end/89303 +- * tree-ssa-structalias.c (set_uids_in_ptset): Or in vi->is_heap_var +- into pt->vars_contains_escaped_heap instead of setting +- pt->vars_contains_escaped_heap to it. +- +- PR middle-end/89281 +- * optabs.c (prepare_cmp_insn): Use UINTVAL (size) instead of +- INTVAL (size), compare it to GET_MODE_MASK instead of +- 1 << GET_MODE_BITSIZE. +- +- 2019-02-09 Jakub Jelinek +- +- PR middle-end/89246 +- * config/i386/i386.c (ix86_simd_clone_compute_vecsize_and_simdlen): +- If !node->definition and TYPE_ARG_TYPES is non-NULL, use +- TYPE_ARG_TYPES instead of DECL_ARGUMENTS. +- +- 2019-01-16 David Malcolm +- +- PR target/88861 +- * combine.c (delete_noop_moves): Convert to "bool" return, +- returning true if any edges are eliminated. +- (combine_instructions): Also return true if delete_noop_moves +- returns true. +- +- 2019-02-08 Jakub Jelinek +- +- PR rtl-optimization/89234 +- * except.c (copy_reg_eh_region_note_forward): Return if note_or_insn +- is a NOTE, CODE_LABEL etc. - rtx_insn * other than INSN_P. +- (copy_reg_eh_region_note_backward): Likewise. +- +- 2019-02-05 Jakub Jelinek +- +- PR target/89188 +- * dce.c (delete_unmarked_insns): Don't remove no-op moves if they +- can throw, non-call exceptions are enabled and we can't delete +- dead exceptions or alter cfg. Set must_clean if +- delete_insn_and_edges returns true, don't set it blindly for calls. +- +- PR rtl-optimization/89195 +- * combine.c (make_extraction): For MEMs, don't extract bytes outside +- of the original MEM. +- +- PR target/89186 +- * optabs.c (prepare_cmp_insn): Pass x and y to +- emit_block_comp_via_libcall rather than XEXP (x, 0) and XEXP (y, 0). +- +- 2019-02-02 Jakub Jelinek +- +- PR middle-end/87887 +- * config/i386/i386.c (ix86_simd_clone_compute_vecsize_and_simdlen): +- Punt with warning on aggregate return or argument types. Ignore +- type/mode checking for uniform arguments. +- +- 2019-02-01 Jakub Jelinek +- +- PR tree-optimization/88107 +- * tree-cfg.c (find_outermost_region_in_block): Add ALL argument, +- instead of assertion that eh_region_outermost is non-NULL, if it +- is NULL, set *ALL to true and return NULL. +- (move_sese_region_to_fn): Adjust caller, if all is set, call +- duplicate_eh_regions with NULL region. +- +- 2019-01-29 Jakub Jelinek +- +- PR c++/66676 +- PR ipa/89104 +- * omp-simd-clone.c (simd_clone_clauses_extract) +- : Ignore clauses with NULL +- OMP_CLAUSE_ALIGNED_ALIGNMENT. +- +- 2019-01-28 Jakub Jelinek +- +- PR middle-end/89002 +- * gimplify.c (gimplify_omp_for): When adding OMP_CLAUSE_*_GIMPLE_SEQ +- for lastprivate/linear IV, push gimplify context around gimplify_assign +- and, if it needed any temporaries, pop it into a gimple bind around the +- sequence. +- +- 2019-01-27 Jakub Jelinek +- +- PR target/87214 +- * config/i386/sse.md +- (avx512dq_shuf_64x2_1, +- avx512f_shuf_64x2_1): Ensure the +- first constants in pairs are multiples of 2. Formatting fixes. +- (avx512vl_shuf_32x4_1, +- avx512vl_shuf_32x4_1): Ensure the +- first constants in each quadruple are multiples of 4. Formatting fixes. +- +- 2019-01-22 Jakub Jelinek +- +- PR rtl-optimization/49429 +- PR target/49454 +- PR rtl-optimization/86334 +- PR target/88906 +- * expr.c (emit_block_move_hints): Move marking of MEM_EXPRs +- addressable from here... +- (emit_block_op_via_libcall): ... to here. +- +- 2019-01-17 Jakub Jelinek +- +- PR rtl-optimization/88870 +- * dce.c (deletable_insn_p): Never delete const/pure calls that can +- throw if we can't alter the cfg or delete dead exceptions. +- (mark_insn): Don't call find_call_stack_args for such calls. +- +- 2019-01-10 Jakub Jelinek +- +- PR c/88568 +- * tree.c (handle_dll_attribute): Clear TREE_STATIC after setting +- DECL_EXTERNAL. +- +- 2019-01-05 Jakub Jelinek +- +- PR middle-end/82564 +- PR target/88620 +- * expr.c (expand_assignment): For calls returning VLA structures +- if to_rtx is not a MEM, force it into a stack temporary. +- +- 2019-01-04 Jakub Jelinek +- +- PR target/88594 +- * config/i386/i386.c (ix86_expand_divmod_libfunc): Use mode instead +- of GET_MODE (opN) as modes of the libcall arguments. +- +- 2019-01-03 Jakub Jelinek +- +- PR debug/88644 +- * dwarf2out.c (modified_type_die): If type is equal to sizetype, +- change it to qualified_type. +- +- 2018-12-21 Jakub Jelinek +- +- PR middle-end/85594 +- PR middle-end/88553 +- * omp-expand.c (extract_omp_for_update_vars): Regimplify the condition +- if needed. +- (expand_omp_for_generic): Don't clobber t temporary for ordered loops. +- +- PR rtl-optimization/88563 +- * expr.c (expand_expr_real_2) : Swap innermode +- and mode arguments to convert_modes. Likewise swap mode and word_mode +- arguments. Handle both arguments with VOIDmode before convert_modes +- of one of them. Formatting fixes. +- +- 2018-12-13 Jakub Jelinek +- +- PR rtl-optimization/88470 +- * cfgcleanup.c (outgoing_edges_match): If the function is +- shrink-wrapped and bb1 ends with a JUMP_INSN with a single fake +- edge to EXIT, return false. +- +- PR rtl-optimization/88416 +- * valtrack.c (cleanup_auto_inc_dec): Handle pre/post-inc/dec/modify +- even if !AUTO_INC_DEC. +- +- 2018-12-07 Jakub Jelinek +- +- PR target/85593 +- * final.c (rest_of_handle_final): Don't call collect_fn_hard_reg_usage +- for functions with naked attribute. +- +- 2018-11-20 Jakub Jelinek +- +- PR tree-optimization/87895 +- * omp-simd-clone.c (ipa_simd_modify_function_body): When removing +- or replacing GIMPLE_RETURN, set EDGE_FALLTHRU on the edge to EXIT. +- (simd_clone_adjust): Don't set EDGE_FALLTHRU here. In a loop that +- redirects edges to EXIT to edges to incr_bb, iterate while EXIT +- has any preds and always use EDGE_PRED (, 0). +- +- 2018-10-20 Jakub Jelinek +- +- PR middle-end/87647 +- * varasm.c (decode_addr_const): Handle COMPOUND_LITERAL_EXPR. +- +- 2018-10-19 Jakub Jelinek +- +- PR middle-end/85488 +- PR middle-end/87649 +- * omp-low.c (check_omp_nesting_restrictions): Diagnose ordered without +- depend closely nested inside of loop with ordered clause with +- a parameter. +- +-2019-08-25 Uro=C5=A1 Bizjak +- +- PR target/91533 +- Backport from mainline +- 2019-06-30 Uro=C5=A1 Bizjak +- +- * config/i386/sse.md (ssse3_abs2): Rename from abs2. +- * config/i386/i386-builtin.def (__builtin_ia32_pabsb): +- Use CODE_FOR_ssse3_absv8qi2. +- (__builtin_ia32_pabsw): Use CODE_FOR_ssse3_absv4hi2. +- (__builtin_ia32_pabsd): Use CODE_FOR_ssse3_absv2si2. +- +-2019-08-21 Richard Biener +- +- PR tree-optimization/91510 +- Backport from mainline +- 2017-09-26 Martin Jambor +- +- * tree-sra.c (compare_access_positions): Put integral types first, +- stabilize sorting of integral types, remove conditions putting +- non-full-precision integers last. +- (sort_and_splice_var_accesses): Disable scalarization if a +- non-integert would be represented by a non-full-precision integer. +- +-2019-08-20 Eric Botcazou +- +- PR rtl-optimization/91347 +- * dse.c (scan_insn): Call add_wild_read for non-const/memset tail calls +- before reload if HARD_FRAME_POINTER_IS_ARG_POINTER. +- +-2019-07-22 Martin Liska +- +- Backport from mainline +- 2019-07-22 Martin Liska +- +- PR driver/91172 +- * opts-common.c (decode_cmdline_option): Decode +- argument of -Werror and check it for a wrong language. +- * opts-global.c (complain_wrong_lang): Remove such case. +- +-2019-07-16 Wilco Dijkstra +- +- Backport from mainline +- 2019-03-05 Wilco Dijkstra +- +- PR target/89222 +- * config/arm/arm.md (movsi): Use targetm.cannot_force_const_mem +- to decide when to split off a non-zero offset from a symbol. +- * config/arm/arm.c (arm_cannot_force_const_mem): Disallow offsets +- in function symbols. +- +-2019-07-15 Andreas Krebbel +- +- Backport from mainline +- 2019-07-01 Andreas Krebbel +- +- * config/s390/vector.md: Fix shift count operand printing. +- +-2019-07-12 Eric Botcazou +- +- PR rtl-optimization/91136 +- * df-core.c (ACCESSING REFS): Fix typos in comment. +- * resource.c (mark_target_live_reg): Add artificial defs that occur at +- the beginning of the block to the initial set of live registers. +- +-2019-06-28 Jeff Law +- +- Backport from mainline +- 2019-06-21 Jeff Law +- +- PR tree-optimization/90949 +- * tree-ssa-copy.c (fini_copy_prop): Use reset_flow_sensitive_info. +- * tree-ssanames.c (reset_flow_sensitive_info): Reset non-null state. +- +-2019-06-27 Martin Jambor +- +- Backport from mainline +- 2019-06-25 Martin Jambor +- +- PR ipa/90939 +- * ipa-cp.c (ipcp_bits_lattice::meet_with): Remove assert. +- +-2019-06-16 John David Anglin +- +- PR middle-end/64242 +- * config/pa/pa.md (nonlocal_goto): Restore frame pointer last. Add +- frame clobbers and schedule block. +- (builtin_longjmp): Likewise. +- +-2019-05-24 John David Anglin +- +- PR target/90530 +- * config/pa/pa.c (pa_cannot_change_mode_class): Accept mode changes +- from DImode to SImode in floating-point registers on 64-bit target. +- * config/pa/pa.md (umulsidi3): Change nonimmediate_operand to +- register_operand in xmpyu patterns. +- +-2019-05-23 Uro=C5=A1 Bizjak +- +- Backported from mainline +- 2019-05-21 Uro=C5=A1 Bizjak +- +- * config/i386/cpuid.h (__cpuid): For 32bit targets, zero +- %ebx and %ecx bafore calling cpuid with leaf 1 or +- non-constant leaf argument. +- +- 2019-05-21 Uro=C5=A1 Bizjak +- +- PR target/90547 +- * config/i386/i386.md (anddi_1 to andsi_1_zext splitter): +- Avoid calling gen_lowpart with CONST operand. +- +-2019-05-20 Kelvin Nilsen +- +- Backport from mainline. +- 2019-05-07 Kelvin Nilsen +- +- PR target/89765 +- * config/rs6000/rs6000-c.c (altivec_resolve_overloaded_builtin): +- In handling of ALTIVEC_BUILTIN_VEC_INSERT, use modular arithmetic +- to compute vector element selector for both constant and variable +- operands. +- +-2019-01-03 Iain Sandoe +- +- PR target/86215 +- Backport from mainline +- 2017-09-25 Iain Sandoe +- +- PR target/80556 +- * config/i386/darwin.h (REAL_LIB_SPEC): New; put libSystem ahead +- of libgcc_eh for m64. +- * config/i386/darwin64.h: Likewise. +- +-2019-05-15 David Edelsohn +- +- Backport from mainline +- 2019-04-11 David Edelsohn +- * xcoffout.h (xcoff_private_rodata_section_name): Declare. +- * xcoffout.c (xcoff_private_rodata_section_name): Define. +- * config/rs6000/rs6000.c (rs6000_xcoff_asm_init_sections): Create +- read_only_private_data_section using coff_private_rodata_section_name. +- (rs6000_xcoff_file_start): Generate coff_private_rodata_section_name. +- +- 2018-12-04 David Edelsohn +- 2018-12-13 David Edelsohn +- PR target/61976 +- * config/rs6000/rs6000.c (rs6000_function_arg): Don't pass aggregates +- in FPRs on AIX. Ensure type is non-NULL. +- (rs6000_arg_partial_bytes): Same. +- +-2019-05-15 Sebastian Huber +- +- * config/arm/t-rtems: Replace -march=3Darmv7-m multilibs with +- -mcpu=3Dcortex-m3 and -mcpu=3Dcortex-m4 multilibs. +- +-2019-05-13 Kelvin Nilsen +- +- Backport from mainline. +- 2019-05-06 Kelvin Nilsen +- +- PR target/89424 +- * config/rs6000/rs6000.c (rs6000_expand_vector_extract): Add +- handling of V1TImode. +- +-2019-05-07 Richard Sandiford +- +- Backport from mainline: +- 2019-01-25 Richard Sandiford +- +- PR middle-end/89037 +- * varasm.c (output_constructor_bitfield): Use wi::extract_uhwi +- instead of accessing TREE_INT_CST_ELT directly. +- +-2019-05-01 Ramana Radhakrishnan +- +- Backport from mainline. +- 2019-04-30 Ramana Radhakrishnan +- PR target/86538 +- * config/aarch64/aarch64-c.c (aarch64_update_cpp_builtins): +- Define __ARM_FEATURE_ATOMICS +- +-2019-04-30 Srinath Parvathaneni +- +- PR target/90075 +- * config/aarch64/iterators.md (V_INT_EQUIV): Add mode for +- integer equivalent of floating point values. +- +- Backport from mainline +- 2018-12-11 Richard Earnshaw +- PR target/37369 +- * config/aarch64/iterators.md (sizem1): Add sizes for +- SFmode and DFmode. +- (Vbtype): Add SFmode mapping. +- * config/aarch64/aarch64.md (copysigndf3, copysignsf3): Delete. +- (copysign3): New expand pattern. +- (copysign3_insn): New insn pattern. +- +-2019-04-22 Kelvin Nilsen +- +- Backport from mainline +- 2019-03-15 Kelvin Nilsen +- +- PR target/87532 +- * config/rs6000/rs6000-c.c (altivec_resolve_overloaded_builtin): +- When handling vec_extract, use modular arithmetic to allow +- constant selectors greater than vector length. +- * config/rs6000/rs6000.c (rs6000_expand_vector_extract): Allow +- V1TImode vectors to have constant selector values greater than 0. +- Use modular arithmetic to compute vector index. +- (rs6000_split_vec_extract_var): Use modular arithmetic to compute +- index for in-memory vectors. Correct code generation for +- in-register vectors. Use inner mode of vector rather than mode of +- destination for move instruction. +- (altivec_expand_vec_ext_builtin): Use modular arithmetic to +- compute index. +- +- 2019-04-12 Kelvin Nilsen +- +- PR target/87532 +- * config/rs6000/vsx.md (*vsx_extract__mode_var): +- Use QI inner mode with V16QI vector mode. +- +-2019-04-19 Xiong Hu Luo +- +- Backport from trunk +- 2018-05-23 Segher Boessenkool +- +- * doc/sourcebuild.texi (Endianness): New subsubsection. +- +-2019-04-11 Martin Liska +- +- Backport from mainline +- 2019-03-08 Martin Liska +- +- PR target/86952 +- * config/i386/i386.c (ix86_option_override_internal): Disable +- jump tables when retpolines are used. +- +-2019-04-10 Matthew Malcomson +- +- PR target/90024 +- * config/arm/arm.c (neon_valid_immediate): Disallow VOIDmode parameter. +- * config/arm/constraints.md (Dm, DN, Dn): Split previous Dn constraint +- into three. +- * config/arm/neon.md (*neon_mov): Account for TImode and DImode +- differences directly. +- (*smax3_neon, vashl3, vashr3_imm): Use Dm constraint. +- +-2019-04-07 Uro=C5=A1 Bizjak +- +- PR target/89945 +- * config/i386/i386.md (anddi_1 to andsi_1_zext splitter): +- Avoid calling gen_lowpart with SYMBOL_REF and LABEL_REF operand. +- +-2019-04-06 Eric Botcazou +- +- Backport from mainline +- 2019-02-19 Eric Botcazou +- +- * rtlanal.c (get_initial_register_offset): Fall back to the estimate +- as long as the epilogue isn't completed. +- +-2019-04-03 Richard Biener +- +- PR lto/89896 +- * lto-wrapper.c (run_gcc): Avoid implicit rules making +- the all target phony. +- +-2019-04-02 Xiong Hu Luo +- +- Backport from trunk r250477. +- +- 2017-07-24 Carl Love +- +- * config/rs6000/rs6000-c.c: Add support for built-in functions +- vector float vec_extract_fp32_from_shorth (vector unsigned short); +- vector float vec_extract_fp32_from_shortl (vector unsigned short); +- * config/rs6000/altivec.h (vec_extract_fp_from_shorth, +- vec_extract_fp_from_shortl): Add defines for the two builtins. +- * config/rs6000/rs6000-builtin.def (VEXTRACT_FP_FROM_SHORTH, +- VEXTRACT_FP_FROM_SHORTL): Add BU_P9V_OVERLOAD_1 and BU_P9V_VSX_1 +- new builtins. +- * config/rs6000/vsx.md vsx_xvcvhpsp): Add define_insn. +- (vextract_fp_from_shorth, vextract_fp_from_shortl): Add define_expands. +- * doc/extend.texi: Update the built-in documentation file for the +- new built-in function. +- +- Backport from trunk r255555. +- +- 2017-12-11 Carl Love +- +- * config/rs6000/altivec.h (vec_extract_fp32_from_shorth, +- vec_extract_fp32_from_shortl]): Add #defines. +- * config/rs6000/rs6000-builtin.def (VSLDOI_2DI): Add macro expansion. +- * config/rs6000/rs6000-c.c (ALTIVEC_BUILTIN_VEC_UNPACKH, +- ALTIVEC_BUILTIN_VEC_UNPACKL, ALTIVEC_BUILTIN_VEC_AND, +- ALTIVEC_BUILTIN_VEC_SLD, ALTIVEC_BUILTIN_VEC_SRL, +- ALTIVEC_BUILTIN_VEC_SRO, ALTIVEC_BUILTIN_VEC_SLD, +- ALTIVEC_BUILTIN_VEC_SLL): Add expansions. +- * doc/extend.texi: Add documentation for the added builtins. +- +-2019-03-28 Martin Liska +- +- Backport from mainline +- 2018-11-05 Martin Liska +- +- PR web/87829 +- * doc/invoke.texi: Remove options that are +- not disabled with -Os. +- +-2019-02-26 Richard Biener +- +- Backport from mainline +- 2019-02-12 Richard Biener +- +- PR tree-optimization/89253 +- * tree-ssa-loop-split.c (tree_ssa_split_loops): Check we can +- duplicate the loop. +- +- 2019-02-08 Richard Biener +- +- PR middle-end/89223 +- * tree-data-ref.c (initialize_matrix_A): Fail if constant +- doesn't fit in HWI. +- (analyze_subscript_affine_affine): Handle failure from +- initialize_matrix_A. +- +- 2019-01-28 Richard Biener +- +- PR tree-optimization/88739 +- * tree-ssa-sccvn.c (vn_reference_lookup_3): Avoid generating +- BIT_FIELD_REFs of non-mode-precision integral operands. +- +-2019-03-26 Richard Biener +- +- Backport from mainline +- 2019-01-08 Richard Biener +- +- PR tree-optimization/86554 +- * tree-ssa-sccvn.c (visit_nary_op): When value-numbering to +- expressions with different overflow behavior make sure there's an +- available expression on the path. +- +- 2018-11-20 Richard Biener +-=20 +- PR tree-optimization/88105 +- * tree-ssa-dom.c (pass_dominator::execute): Do not walk +- backedges. +- +- 2018-03-08 Richard Biener +- +- PR middle-end/84552 +- * tree-scalar-evolution.c: Include tree-into-ssa.h. +- (follow_copies_to_constant): Do not follow SSA names registered +- for update. +- +-2019-03-21 Bill Schmidt +- +- * config/rs6000/rs6000.c (rs6000_analyze_swaps): Rebuild +- ud- and du-chains between phases. +- +-2019-03-21 Matthias Klose +- +- Backport from mainline +- 2019-02-26 Richard Biener +- +- PR tree-optimization/89505 +- * tree-ssa-structalias.c (compute_dependence_clique): Make sure +- to handle restrict pointed-to vars with multiple subvars +- correctly. +- +-2019-03-17 H.J. Lu +- +- Backport from mainline +- 2019-03-14 H.J. Lu +- +- PR target/89523 +- * config/i386/i386.c (ix86_print_operand): Handle 'M' to add +- addr32 prefix to VSIB address for X32. +- * config/i386/sse.md (*avx512pf_gatherpfsf_mask): Prepend +- "%M2" to opcode. +- (*avx512pf_gatherpfdf_mask): Likewise. +- (*avx512pf_scatterpfsf_mask): Likewise. +- (*avx512pf_scatterpfdf_mask): Likewise. +- (*avx2_gathersi): Prepend "%M3" to opcode. +- (*avx2_gathersi_2): Prepend "%M2" to opcode. +- (*avx2_gatherdi): Prepend "%M3" to opcode. +- (*avx2_gatherdi_2): Prepend "%M2" to opcode. +- (*avx2_gatherdi_3): Prepend "%M3" to opcode. +- (*avx2_gatherdi_4): Prepend "%M2" to opcode.` +- (*avx512f_gathersi): Prepend "%M4" to opcode. +- (*avx512f_gathersi_2): Prepend "%M3" to opcode. +- (*avx512f_gatherdi): Prepend "%M4" to opcode. +- (*avx512f_gatherdi_2): Prepend "%M3" to opcode. +- (*avx512f_scattersi): Prepend "%M0" to opcode. +- (*avx512f_scatterdi): Likewise. +- +-2019-03-14 Martin Jambor +- +- Backport from mainline +- 2019-03-07 Martin Jambor +- +- PR lto/87525 +- * ipa-cp.c (perform_estimation_of_a_value): Account zero time benefit +- for extern inline functions. +- +-2019-03-14 Richard Biener +- +- Backport from mainline +- 2018-02-16 Jakub Jelinek +-=20 +- PR target/84272 +- * config/aarch64/cortex-a57-fma-steering.c (fma_forest::merge_forest): +- Use ++iter rather than iter++ for std::list iterators. +- (func_fma_steering::dfs): Likewise. Don't delete nodes right away, +- defer deleting them until all nodes in the forest are processed. Do +- free even leaf nodes. Change to_process into auto_vec. +- +-2019-03-13 Andre Vieira +- +- Backport from mainline +- 2019-03-08 Andre Vieira +- +- * config/arm/arm.h (TARGET_FP16_TO_DOUBLE): Add TARGET_VFP_DOUBLE +- requirement. +- +-2019-03-11 Martin Liska +- +- Backport from mainline +- 2019-02-11 David Malcolm +- +- PR lto/88147 +- * input.c (selftest::test_line_offset_overflow): New selftest. +- (selftest::input_c_tests): Call it. +- +-2019-03-07 Xiong Hu Luo +- +- Backport of r268834 from mainline to gcc-7-branch. +- 2019-02-13 Xiong Hu Luo +- +- * config/rs6000/altivec.h (vec_sbox_be, vec_cipher_be, +- vec_cipherlast_be, vec_ncipher_be, vec_ncipherlast_be): New #defines. +- * config/rs6000/crypto.md (CR_vqdi): New define_mode_iterator. +- (crypto_vsbox_, crypto__): New define_insns. +- * config/rs6000/rs6000-builtin.def (VSBOX_BE): New BU_CRYPTO_1. +- (VCIPHER_BE, VCIPHERLAST_BE, VNCIPHER_BE, VNCIPHERLAST_BE): +- New BU_CRYPTO_2. +- * config/rs6000/rs6000.c (builtin_function_type) +- : New switch options. +- * doc/extend.texi (vec_sbox_be, vec_cipher_be, vec_cipherlast_be, +- vec_ncipher_be, vec_ncipherlast_be): New builtin functions. +- +-2019-02-27 Uro=C5=A1 Bizjak +- +- PR target/89397 +- * config/i386/i386.c (ix86_atomic_assign_expand_fenv): Check +- TARGET_SSE in addition to TARGET_SSE_MATH. +- +- (ix86_excess_precision): Ditto. +- (ix86_float_exceptions_rounding_supported_p): Ditto. +- (use_rsqrt_p): Ditto. +- * config/i386/sse.md (rsqrt2): Ditto. +- +-2019-02-15 Martin Liska +- +- Backport from mainline +- 2019-02-14 Martin Liska +- +- PR rtl-optimization/89242 +- * dce.c (delete_unmarked_insns): Call free_dominance_info we +- process a transformation. +- +-2019-02-15 Martin Liska +- +- Backport from mainline +- 2019-02-11 Martin Liska +- +- PR ipa/89009 +- * ipa-cp.c (build_toporder_info): Remove usage of a param. +- * ipa-inline.c (inline_small_functions): Likewise. +- * ipa-pure-const.c (propagate_pure_const): Likewise. +- (propagate_nothrow): Likewise. +- * ipa-reference.c (propagate): Likewise. +- * ipa-utils.c (struct searchc_env): Remove unused field. +- (searchc): Always search across AVAIL_INTERPOSABLE. +- (ipa_reduced_postorder): Always allow AVAIL_INTERPOSABLE as +- the only called IPA pure const can properly not propagate +- across interposable boundary. +- * ipa-utils.h (ipa_reduced_postorder): Remove param. +- +-2019-02-11 Stefan Agner +- +- Backport from mainline. +- 2019-01-10 Stefan Agner +- +- PR target/88648 +- * config/arm/arm.c (arm_option_override_internal): Force +- opts->x_inline_asm_unified to true only if TARGET_THUMB2_P. +- +-2019-02-09 Alan Modra +- +- PR target/88343 +- * config/rs6000/rs6000.c (rs6000_reg_live_or_pic_offset_p): Match +- logic in rs6000_emit_prologue emitting pic_offset_table setup. +- +-2019-02-08 Eric Botcazou +- +- Backport from mainline +- 2018-06-11 Segher Boessenkool +- +- PR target/85755 +- * config/rs6000/rs6000.md (*movdi_internal32): Put constraint modifiers +- on the correct operand. +- (*movdi_internal64): Ditto. +- +-2019-02-06 Kelvin Nilsen +- +- Backport from mainline. +- 2019-01-30 Kelvin Nilsen +- * config/rs6000/rs6000-c.c (altivec-resolve_overloaded_builtin): +- Change handling of ALTIVEC_BUILTIN_VEC_EXTRACT. Coerce result to +- type of vector element when vec_extract is implemented by direct +- move. +- +-2019-02-06 Eric Botcazou +- +- * config/i386/i386.c (ix86_expand_prologue): Emit a memory blockage +- after restoring registers saved to allocate the frame on Windows. +- +-2019-02-05 Andreas Krebbel +- +- Backport from mainline +- 2019-02-05 Andreas Krebbel +- +- PR target/88856 +- * config/s390/s390.md: Remove load and test FP splitter. +- +-2019-02-04 Bill Schmidt +- +- PR target/87064 +- Backport from mainline +- +- 2019-01-30 Bill Schmidt +- +- PR target/87064 +- * config/rs6000/vsx.md (*vsx_reduc__v4sf_scalar): +- Disable for little-endian. +- +- 2019-01-22 Jakub Jelinek +- +- PR target/87064 +- * config/rs6000/vsx.md (*vsx_reduc__v2df_scalar): +- Disable for little endian. +- +-2018-01-31 Bill Schmidt +- +- Backport from mainline +- 2018-01-31 Bill Schmidt +- +- PR tree-optimization/89008 +- * gimple-ssa-strength-reduction.c (slsr_process_mul): Don't +- process anything of the form X * 0. +- +-2019-01-31 Richard Biener +- +- Backport from mainline +- 2019-01-31 Richard Biener +- +- PR rtl-optimization/89115 +- * lra.c (lra_rtx_hash): Properly hash CONST_INT values. +- +- 2019-01-30 Richard Biener +- +- PR rtl-optimization/89115 +- * opts.c (default_options_optimization): Reduce +- PARAM_MAX_DSE_ACTIVE_LOCAL_STORES by a factor of 10 at -O1. +- Make PARAM_LOOP_INVARIANT_MAX_BBS_IN_LOOP reduction relative +- to the default. +- +-2019-01-30 Kewen Lin +- +- Backport from mainline. +- 2019-01-17 Kewen Lin +- +- * doc/extend.texi: Add four new prototypes for vec_ld and seven new +- prototypes for vec_st. +- * config/rs6000/rs6000-c.c (altivec_overloaded_builtins): Add entries +- for scalar address type variants of altivec_vec_ld/altivec_vec_st, +- mainly on signed/unsigned long long and double. +- +-2019-01-27 Uro=C5=A1 Bizjak +- +- PR target/88948 +- * rtl.h (prepare_copy_insn): New prototype. +- * gcse.c (prepare_copy_insn): New function, split out from +- process_insert_insn. +- (process_insert_insn): Use prepare_copy_insn. +- * store-motion.c (replace_store_insn): Use prepare_copy_insn +- instead of gen_move_insn. +- +-2019-01-24 Uro=C5=A1 Bizjak +- +- PR target/88998 +- * config/i386/sse.md (sse2_cvtpi2pd): Add SSE alternatives. +- Disparage MMX alternative. +- (sse2_cvtpd2pi): Ditto. +- (sse2_cvttpd2pi): Ditto. +- +-2019-01-24 Richard Biener +- +- Backport from mainline +- 2019-01-23 Richard Biener +- +- PR tree-optimization/89008 +- * tree-ssa-reassoc.c (eliminate_using_constants): For * 0 do +- not leave another stray operand. +- +-2019-01-22 Uro=C5=A1 Bizjak +- +- PR target/88938 +- * config/i386/i386.c (ix86_expand_builtin) [case IX86_BUILTIN_BEXTRI32, +- case IX86_BUILTIN_BEXTRI64]: Sanitize operands. +- +-2019-01-18 Uro=C5=A1 Bizjak +- +- * config/alpha/alpha.c (alpha_gimplify_va_arg): +- Handle split indirect COMPLEX_TYPE arguments. +- +-2019-01-16 Martin Jambor +- +- Backported from mainline +- 2018-12-10 Martin Jambor +- +- PR ipa/88214 +- * ipa-prop.c (determine_locally_known_aggregate_parts): Make sure +- we check pointers against pointers. +- +-2019-01-09 Eric Botcazou +- James Clarke +- +- PR target/84010 +- * config/sparc/sparc.c (sparc_legitimize_tls_address): Only use Pmode +- consistently in TLS address generation and adjust code to the renaming +- of patterns. Mark calls to __tls_get_addr as const. +- * config/sparc/sparc.md (tgd_hi22): Turn into... +- (tgd_hi22): ...this and use Pmode throughout. +- (tgd_lo10): Turn into... +- (tgd_lo10): ...this and use Pmode throughout. +- (tgd_add32): Merge into... +- (tgd_add64): Likewise. +- (tgd_add): ...this and use Pmode throughout. +- (tldm_hi22): Turn into... +- (tldm_hi22): ...this and use Pmode throughout. +- (tldm_lo10): Turn into... +- (tldm_lo10): ...this and use Pmode throughout. +- (tldm_add32): Merge into... +- (tldm_add64): Likewise. +- (tldm_add): ...this and use Pmode throughout. +- (tldm_call32): Merge into... +- (tldm_call64): Likewise. +- (tldm_call): ...this and use Pmode throughout. +- (tldo_hix22): Turn into... +- (tldo_hix22): ...this and use Pmode throughout. +- (tldo_lox10): Turn into... +- (tldo_lox10): ...this and use Pmode throughout. +- (tldo_add32): Merge into... +- (tldo_add64): Likewise. +- (tldo_add): ...this and use Pmode throughout. +- (tie_hi22): Turn into... +- (tie_hi22): ...this and use Pmode throughout. +- (tie_lo10): Turn into... +- (tie_lo10): ...this and use Pmode throughout. +- (tie_ld64): Use DImode throughout. +- (tie_add32): Merge into... +- (tie_add64): Likewise. +- (tie_add): ...this and use Pmode throughout. +- (tle_hix22_sp32): Merge into... +- (tle_hix22_sp64): Likewise. +- (tle_hix22): ...this and use Pmode throughout. +- (tle_lox22_sp32): Merge into... +- (tle_lox22_sp64): Likewise. +- (tle_lox22): ...this and use Pmode throughout. +- (*tldo_ldub_sp32): Merge into... +- (*tldo_ldub_sp64): Likewise. +- (*tldo_ldub): ...this and use Pmode throughout. +- (*tldo_ldub1_sp32): Merge into... +- (*tldo_ldub1_sp64): Likewise. +- (*tldo_ldub1): ...this and use Pmode throughout. +- (*tldo_ldub2_sp32): Merge into... +- (*tldo_ldub2_sp64): Likewise. +- (*tldo_ldub2): ...this and use Pmode throughout. +- (*tldo_ldsb1_sp32): Merge into... +- (*tldo_ldsb1_sp64): Likewise. +- (*tldo_ldsb1): ...this and use Pmode throughout. +- (*tldo_ldsb2_sp32): Merge into... +- (*tldo_ldsb2_sp64): Likewise. +- (*tldo_ldsb2): ...this and use Pmode throughout. +- (*tldo_ldub3_sp64): Use DImode throughout. +- (*tldo_ldsb3_sp64): Likewise. +- (*tldo_lduh_sp32): Merge into... +- (*tldo_lduh_sp64): Likewise. +- (*tldo_lduh): ...this and use Pmode throughout. +- (*tldo_lduh1_sp32): Merge into... +- (*tldo_lduh1_sp64): Likewise. +- (*tldo_lduh1): ...this and use Pmode throughout. +- (*tldo_ldsh1_sp32): Merge into... +- (*tldo_ldsh1_sp64): Likewise. +- (*tldo_ldsh1): ...this and use Pmode throughout. +- (*tldo_lduh2_sp64): Use DImode throughout. +- (*tldo_ldsh2_sp64): Likewise. +- (*tldo_lduw_sp32): Merge into... +- (*tldo_lduw_sp64): Likewise. +- (*tldo_lduw): ...this and use Pmode throughout. +- (*tldo_lduw1_sp64): Use DImode throughout. +- (*tldo_ldsw1_sp64): Likewise. +- (*tldo_ldx_sp64): Likewise. +- (*tldo_stb_sp32): Merge into... +- (*tldo_stb_sp64): Likewise. +- (*tldo_stb): ...this and use Pmode throughout. +- (*tldo_sth_sp32): Merge into... +- (*tldo_sth_sp64): Likewise. +- (*tldo_sth): ...this and use Pmode throughout. +- (*tldo_stw_sp32): Merge into... +- (*tldo_stw_sp64): Likewise. +- (*tldo_stw): ...this and use Pmode throughout. +- (*tldo_stx_sp64): Use DImode throughout. +- +-2019-01-09 Eric Botcazou +- +- * doc/invoke.texi (-Os): Add reference to -finline-functions. +- (-finline-small-functions): Add references to -O3 and -Os. +- (-findirect-inlining): Likewise. +- (-finline-functions): Add references to -Os, -fprofile-use and +- -fauto-profile. +- +-2019-01-03 Iain Sandoe +- +- revert: +- 2018-12-30 Iain Sandoe +- +- backport from mainline. +- 2018-12-12 Segher Boessenkool +- Iain Sandoe +- +- PR target/88343 +- * config/rs6000/rs6000.c (save_reg_p): Do not save the picbase reg +- unless it has been used. +- (first_reg_to_save): Remove dead code. +- +-2019-01-02 Segher Boessenkool +- +- Backport from trunk +- 2018-12-06 Segher Boessenkool +- +- PR inline-asm/55681 +- * doc/extend.texi (Basic Asm): Update grammar. +- (Extended Asm): Update grammar. +- +- Backport from trunk +- 2018-12-06 Segher Boessenkool +- +- * doc/extend.texi (Using Assembly Language with C): Document asm inline. +- (Size of an asm): Fix typo. Document asm inline. +- * gimple-pretty-print.c (dump_gimple_asm): Handle asm inline. +- * gimple.h (enum gf_mask): Add GF_ASM_INLINE. +- (gimple_asm_set_volatile): Fix typo. +- (gimple_asm_inline_p): New. +- (gimple_asm_set_inline): New. +- * gimplify.c (gimplify_asm_expr): Propagate the asm inline flag from +- tree to gimple. +- * ipa-icf-gimple.c (func_checker::compare_gimple_asm): Compare the +- gimple_asm_inline_p flag, too. +- * tree-core.h (tree_base): Document that protected_flag is ASM_INLINE_P +- in an ASM_EXPR. +- * tree-inline.c (estimate_num_insns): If gimple_asm_inline_p return +- a minimum size for an asm. +- * tree.h (ASM_INLINE_P): New. +- +-2018-12-30 Iain Sandoe +- +- backport from mainline. +- 2018-12-12 Segher Boessenkool +- Iain Sandoe +- +- PR target/88343 +- * config/rs6000/rs6000.c (save_reg_p): Do not save the picbase reg +- unless it has been used. +- (first_reg_to_save): Remove dead code. +- +-2018-12-24 Iain Sandoe +- +- Backport from mainline +- 2018-12-06 Iain Sandoe +- +- PR c++/87380 +- * config/darwin.h (TARGET_WEAK_NOT_IN_ARCHIVE_TOC) Remove, use the +- default. +- * config/rs6000/darwin7.h (TARGET_WEAK_NOT_IN_ARCHIVE_TOC): New. +- +-2018-12-24 Iain Sandoe +- +- Backport from mainline +- 2018-12-06 Iain Sandoe +- +- PR target/78444 +- * config/i386/darwin.h (STACK_BOUNDARY): Remove macro. +- * config/i386/i386.c (ix86_compute_frame_layout): Ensure at least 128b +- stack alignment in non-leaf functions. +- +-2018-12-24 Iain Sandoe +- +- Backport from mainline +- 2018-08-15 Iain Sandoe +- +- PR target/81685 +- * config/darwin.h: (DEBUG_STR_OFFSETS_SECTION, DEBUG_LOCLISTS_SECTION, +- DEBUG_RNGLISTS_SECTION) new macros. (DEBUG_PUBNAMES_SECTION, +- DEBUG_PUBTYPES_SECTION) update to include GNU variant. +- +-2018-12-21 Uros Bizjak +- +- Backport from mainline +- 2018-12-10 Uros Bizjak +- +- PR target/88418 +- * config/i386/i386.c (ix86_expand_sse_cmp): For vector modes, +- check operand 1 with vector_operand predicate. +- (ix86_expand_sse_movcc): For vector modes, check op_true with +- vector_operand, not nonimmediate_operand. +- +-2018-12-19 Bill Schmidt +- +- Backport from mainline +- 2018-12-18 Bill Schmidt +- +- * doc/extend.texi (PowerPC Altivec/VSX Built-in Functions): +- Describe when a typedef name can be used as the type specifier for +- a vector type, and when it cannot. +- +-2018-12-19 Segher Boessenkool +- +- Backport from trunk +- 2018-12-19 Segher Boessenkool +- +- PR target/88213 +- * config/rs6000/vsx.md (*vsx_extract___load): +- Require TARGET_POWERPC64. +- +-2018-12-17 Senthil Kumar Selvaraj +- +- Backport from trunk +- 2018-12-17 Senthil Kumar Selvaraj +- +- PR rtl-optimization/88253 +- * combine.c (combine_simplify_rtx): Test for side-effects before +- substituting by zero. +- +-2018-12-15 Segher Boessenkool +- +- Backport from trunk +- 2018-12-14 Segher Boessenkool +- +- PR rtl-optimization/88001 +- * function.c (match_asm_constraints_1): Don't invalidly share RTL. +- +-2018-12-13 Andreas Krebbel +- +- Backport from mainline +- 2018-12-13 Andreas Krebbel +- +- * config/s390/s390-builtins.def (s390_vec_double_s64): Map to +- s390_vec_double_s64 instead of s390_vcdgb. +- (s390_vec_double_u64): Map to s390_vec_double_u64 instead of +- s390_vcdlgb. +- +-2018-12-13 Andreas Krebbel +- +- Backport from mainline +- 2018-12-13 Andreas Krebbel +- +- * config/s390/vx-builtins.md ("vec_ctd_s64", "vec_ctd_u64") +- ("vec_ctsl", "vec_ctul"): Replace 0 with VEC_NOINEXACT. +- ("vec_double_s64", "vec_double_u64"): Replace 4 with VEC_INEXACT. +- +-2018-12-12 Peter Bergner +- +- Backport from mainline +- 2018-12-07 Peter Bergner +- +- PR target/87496 +- * config/rs6000/rs6000.c (rs6000_option_override_internal): Disallow +- -mabi=3Dieeelongdouble and -mabi=3Dibmlongdouble without -mlong-double-1= 28. +- Do not error for -mabi=3Dibmlongdouble and no ISA 2.06 support. +- * doc/invoke.texi: Document -mabi=3Dibmlongdouble and -mabi=3Dieeelongdo= uble +- require -mlong-double-128. +- +-2018-12-06 Richard Biener +- +- * BASE-VER: Increment to 7.4.1. +- +-2018-12-06 Release Manager +- +- * GCC 7.4.0 released. +- +-2018-11-28 Richard Biener +- +- PR tree-optimization/79351 +- * tree-ssa-sccvn.c (vn_reference_lookup_3): For assignments from +- empty CONSTRUCTORs ensure the store is at a constant position. +- +-2018-11-26 Iain Sandoe +- +- Backport from mainline +- 2018-08-22 Iain Sandoe +- +- PR bootstrap/81033 +- PR target/81733 +- PR target/52795 +- * gcc/dwarf2out.c (FUNC_SECOND_SECT_LABEL): New. +- (dwarf2out_switch_text_section): Generate a local label for the second +- function sub-section and apply it as the second FDE start label. +- * gcc/final.c (final_scan_insn_1): Emit second FDE label after the +- second sub-section start. +- +-2018-11-26 Iain Sandoe +- +- 2018-08-15 Iain Sandoe +- +- * config/darwin.c +- (darwin_function_switched_text_sections): Delete. +- * gcc/config/darwin.h +- (TARGET_ASM_FUNCTION_SWITCHED_TEXT_SECTIONS): Likewise. +- +-2018-11-26 Andreas Krebbel +- +- Backport from mainline +- 2018-11-20 Andreas Krebbel +- +- * config/s390/s390.md ("clztidi2"): Swap the RTX's written to the +- DImode parts of the target operand. +- +-2018-11-26 Andreas Krebbel +- +- Backport from mainline +- 2018-11-26 Andreas Krebbel +- +- * doc/invoke.texi: Document z14/arch12 -march option. +- +-2018-10-19 Richard Biener +- +- PR middle-end/87645 +- Backport from mainline +- 2018-07-12 Richard Biener +- +- * gimple-match-head.c (gimple_resimplify1): Apply recursion +- limit. +- (gimple_resimplify2): Likewise. +- (gimple_resimplify3): Likewise. +- (gimple_resimplify4): Likewise. +- +-2018-11-26 Richard Biener +- +- Backport from mainline +- 2018-10-15 Richard Biener +- +- PR middle-end/87610 +- * tree-ssa-structalias.c (struct vls_data): Add escaped_p member. +- (visit_loadstore): When a used restrict tag escaped verify that +- the points-to solution of "other" pointers do not include +- escaped. +- (compute_dependence_clique): If a used restrict tag escaped +- communicated that down to visit_loadstore. +- +- 2018-10-25 Richard Biener +- +- PR tree-optimization/87665 +- PR tree-optimization/87745 +- * tree-vectorizer.h (get_earlier_stmt): Remove. +- (get_later_stmt): Pick up UID from the original non-pattern stmt. +- +- 2018-10-24 Richard Biener +- +- PR tree-optimization/87665 +- * tree-vect-data-refs.c (vect_preserves_scalar_order_p): Adjust +- to reflect reality. +- +-2018-11-26 Richard Biener +- +- Backport from mainline +- 2018-06-14 Richard Biener +- +- PR middle-end/86139 +- * tree-vect-generic.c (build_word_mode_vector_type): Remove +- duplicate and harmful type_hash_canon. +- +- 2018-06-15 Richard Biener +- +- PR middle-end/86076 +- * tree-cfg.c (move_stmt_op): unshare invariant addresses +- before adjusting their block. +- +-2018-11-22 Uros Bizjak +- +- Backport from mainline +- 2018-11-16 Uros Bizjak +- +- PR target/88051 +- * config/i386/sse.md (UNSPEC_MOVDI_TO_SSE): New UNSPEC. +- (movdi_to_sse): Rewrite using UNSPEC_MOVDI_TO_SSE unspec. +- +-2018-11-22 Tom de Vries +- +- backport from trunk: +- 2017-11-19 Tom de Vries +- +- PR target/82961 +- * vmsdbgout.c (vmsdbgout_early_finish): New function. +- (vmsdbg_debug_hooks): Set early_finish field to vmsdbgout_early_finish. +- +-2018-11-21 Mihail Ionescu +- +- PR target/87867 +- Backport from mainiline +- 2018-09-26 Eric Botcazou +- +- * config/arm/arm.c (arm_reorg): Skip Thumb reorg pass for thunks. +- (arm32_output_mi_thunk): Deal with long calls. +- +-2018-11-20 Richard Biener +- +- Backport from mainline +- 2018-03-12 Richard Biener +- +- PR tree-optimization/84777 +- * tree-ssa-loop-ch.c (should_duplicate_loop_header_p): For +- force-vectorize loops ignore whether we are optimizing for size. +- +- 2018-01-26 Richard Biener +- +- PR rtl-optimization/84003 +- * dse.c (record_store): Only record redundant stores when +- the earlier store aliases at least all accesses the later one does. +- +-2018-11-20 Xuepeng Guo +- +- Backport from mainline +- 2018-11-05 Xuepeng Guo +- +- PR target/87853 +- * config/i386/emmintrin.h (__v16qs): New to cope with option +- -funsigned-char. +- (_mm_cmpeq_epi8): Replace __v16qi with __v16qs. +- (_mm_cmplt_epi8): Likewise. +- (_mm_cmpgt_epi8): Likewise. +- +-2018-11-20 Eric Botcazou +- +- PR rtl-optimization/85925 +- * rtl.h (word_register_operation_p): New predicate. +- * combine.c (record_dead_and_set_regs_1): Only apply specific handling +- for WORD_REGISTER_OPERATIONS targets to word_register_operation_p RTX. +- * rtlanal.c (nonzero_bits1): Likewise. Adjust couple of comments. +- (num_sign_bit_copies1): Likewise. +- +-2018-11-18 Uros Bizjak +- +- Backport from mainline +- 2018-11-11 Uros Bizjak +- +- PR target/87928 +- * config/i386/i386.h (STACK_BOUNDARY): Use TARGET_64BIT_MS_ABI +- instead of (TARGET_64BIT && ix86_abi =3D=3D MS_ABI). +- * config/i386/darwin.h (STACK_BOUNDARY): Ditto. +- * config/i386/cygming.h (STACK_BOUNDARY): Remove. +- +-2018-11-15 Nathan Sidwell +- +- PR debug/88006 +- PR debug/87462 +- * dwarf2out.c (dwarf2out_finish): Apply resolve_addr to comdat +- type list. +- +-2018-11-11 Uros Bizjak +- +- Backport from mainline +- 2018-11-04 Uros Bizjak +- +- PR middle-end/58372 +- * cfgexpand.c (pass_expand::execute): Move the call to +- finish_eh_generation in front of the call to expand_stack_alignment. +- +-2018-11-07 Max Filippov +- +- Backport from mainline +- 2018-11-05 Max Filippov +- +- * config/xtensa/uclinux.h (XTENSA_ALWAYS_PIC): Change to 0. +- +-2018-10-26 Bill Schmidt +- +- Backport from mainline +- 2018-10-19 Bill Schmidt +- +- PR tree-optimization/87473 +- * gimple-ssa-strength-reduction.c (record_phi_increments): For +- phi arguments identical to the base expression of the phi +- candidate, record a phi-adjust increment of zero minus the index +- expression of the hidden basis. +- (phi_incr_cost): For phi arguments identical to the base +- expression of the phi candidate, the difference to compare against +- the increment is zero minus the index expression of the hidden +- basis, and there is no potential savings from replacing the (phi) +- statement. +- (ncd_with_phi): For phi arguments identical to the base expression +- of the phi candidate, the difference to compare against the +- increment is zero minus the index expression of the hidden basis. +- (all_phi_incrs_profitable): For phi arguments identical to the +- base expression of the phi candidate, the increment to be checked +- for profitability is zero minus the index expression of the hidden +- basis. +- +-2018-10-19 Andreas Krebbel +- +- Backport from mainline +- 2018-10-15 Andreas Krebbel +- +- * config/s390/s390.c (s390_expand_vec_init): Force vector element +- into reg if it isn't a general operand. +- +-2018-10-17 Eric Botcazou +- +- PR middle-end/87623 +- * fold-const.c (fold_truth_andor_1): If the right side is not constant, +- bail out if both sides do not have the same storage order. +- +-2018-10-16 Wilco Dijkstra +- +- Backported from mainline +- PR target/87511 +- * config/aarch64/aarch64.c (aarch64_mask_and_shift_for_ubfiz_p): +- Use HOST_WIDE_INT_1U for shift. +- +-2018-10-12 Jakub Jelinek +- +- Backported from mainline +- 2018-10-10 Jakub Jelinek +- +- PR target/87550 +- * config/i386/i386-builtin.def (IX86_BUILTIN_RDPMC): Move from args set +- to special_args set. +- +- 2018-09-12 Jakub Jelinek +- +- PR middle-end/87248 +- * fold-const.c (fold_ternary_loc) : Verify also that +- BIT_AND_EXPR's second operand is a power of two. Formatting fix. +- +- 2018-08-27 Jakub Jelinek +- +- PR rtl-optimization/87065 +- * combine.c (simplify_if_then_else): Formatting fix. +- (if_then_else_cond): Guard MULT optimization with SCALAR_INT_MODE_P +- check. +- (known_cond): Don't return const_true_rtx for vector modes. Use +- CONST0_RTX instead of const0_rtx. Formatting fixes. +- +- 2018-07-24 Jakub Jelinek +- +- PR middle-end/86627 +- * expmed.c (expand_divmod): Punt if d =3D=3D HOST_WIDE_INT_MIN +- and size > HOST_BITS_PER_WIDE_INT. For size > HOST_BITS_PER_WIDE_INT +- and abs_d =3D=3D d, do the power of two handling if profitable. +- +- 2018-07-17 Jakub Jelinek +- +- PR middle-end/86542 +- * omp-low.c (create_task_copyfn): Copy over also fields corresponding +- to _looptemp_ clauses, other than the first two. +- +- PR middle-end/86539 +- * gimplify.c (gimplify_omp_for): Ensure taskloop firstprivatized init +- and cond temporaries don't have reference type if iterator has +- pointer type. For init use &for_pre_body instead of pre_p if +- for_pre_body is non-empty. +- +- 2018-07-26 Jakub Jelinek +- +- PR middle-end/86660 +- * omp-low.c (scan_sharing_clauses): Don't ignore map clauses for +- declare target to variables if they have always,{to,from,tofrom} map +- kinds. +- +-2018-10-12 Richard Biener +- +- Backport from mainline +- 2018-08-23 Richard Biener +- +- PR middle-end/87024 +- * tree-inline.c (copy_bb): Drop unused __builtin_va_arg_pack_len +- calls. +- +- 2018-08-17 Richard Biener +- +- PR middle-end/86505 +- * tree-inline.c (copy_bb): When inlining __builtin_va_arg_pack_len () +- across a va-arg-pack using call adjust its return value accordingly. +- +-2018-10-09 H.J. Lu +- +- Backport from mainline +- 2018-09-29 H.J. Lu +- +- PR target/87370 +- * config/i386/i386.c (construct_container): Use TImode for +- BLKmode values in 2 integer registers. +- +-2018-10-08 H.J. Lu +- +- Backport from mainline +- 2018-10-08 H.J. Lu +- +- PR target/87517 +- * config/i386/avx512fintrin.h (_mm512_mask_fmaddsub_round_pd): +- Defined with __builtin_ia32_vfmaddsubpd512_mask. +- +-2018-10-05 H.J. Lu +- +- Backport from mainline +- 2018-10-05 H.J. Lu +- +- PR target/87522 +- * config/i386/gnu-user.h (ASM_SPEC): Don't pass -msse2avx to +- assembler for -mavx. +- * config/i386/gnu-user64.h (ASM_SPEC): Likewise. +- +-2018-10-03 Uros Bizjak +- +- Backport from mainline +- 2018-09-28 Uros Bizjak +- +- * config/i386/i386.h (SSE_REGNO): Fix check for FIRST_REX_SSE_REG. +- (GET_SSE_REGNO): Rename from SSE_REGNO. Update all uses for rename. +- +-2018-10-03 Jonathan Wakely +- +- PR other/87353 +- * doc/invoke.texi (Link Options): Fix formatting and grammar. +- +-2018-10-01 Kyrylo Tkachov +- +- Backport from mainline +- 2018-06-29 Kyrylo Tkachov +- +- * config/arm/arm.c (output_move_double): Don't allow STRD instructions +- if starting source register is not even. +- +-2018-09-29 Jakub Jelinek +- +- PR target/87467 +- * config/i386/avx512fintrin.h (_mm512_abs_pd, _mm512_mask_abs_pd): Use +- __m512d type for __A argument rather than __m512. +- +-2018-09-27 Michael Meissner +- +- Backport from mainline +- 2018-08-20 Michael Meissner +- +- PR target/87033 +- * config/rs6000/rs6000.md (extendsi2): Change constraints +- from 'Y' to 'YZ' to enable the LWAX instruction to be generated +- for indexed loads. +- +-2018-09-21 Eric Botcazou +- +- * config/rs6000/rs6000.c (rs6000_function_ok_for_sibcall): Return false +- if the call takes a static chain. +- +-2018-09-19 John David Anglin +- +- * config/pa/pa.md (atomic_storeqi): Restore deleted expander. +- (atomic_storehi): Likewise. +- (atomic_storesi): Likewise. +- (atomic_loaddi): Restore compare and swap exchange loop code. +- +-2018-09-12 Segher Boessenkool +- +- Backport from trunk +- 2018-08-24 Segher Boessenkool +- +- PR target/86989 +- * config/rs6000/rs6000.c (toc_relative_expr_p): Check that the base is +- the TOC register. +- +-2018-09-12 Andreas Krebbel +- +- Backport from mainline +- 2018-09-12 Andreas Krebbel +- +- * config/s390/s390.md (PFPO_RND_MODE_DFP, PFPO_RND_MODE_BFP): New +- constants. +- ("trunc2") +- ("trunc2") +- ("extend2") +- ("extend2"): Set proper rounding mode +- according to the target operand type. +- +-2018-09-04 Max Filippov +- +- Backport from mainline +- 2018-09-04 Max Filippov +- +- * config/xtensa/xtensa.c (xtensa_expand_atomic): Reorder AND and +- XOR operations in NAND case. +- +-2018-09-04 Jonathan Wakely +- +- * doc/invoke.texi (Option Summary): Add -Waligned-new. +- +-2018-09-03 Tom de Vries +- +- backport from trunk: +- 2018-06-21 Tom de Vries +- +- PR tree-optimization/85859 +- * tree-ssa-tail-merge.c (stmt_local_def): Copy gimple_is_call +- test with comment from bb_no_side_effects_p. +- +-2018-08-25 Jozef Lawrynowicz +- +- Backport from mainline +- PR target/86662 +- * gcc/tree.c (build_common_tree_nodes): Initialize integer_types array +- with all enabled __intN types. +- +- * gcc/testsuite/gcc.target/msp430/pr86662.c: New test. +- +-2018-08-21 H.J. Lu +- +- Backport from mainline +- 2018-08-20 H.J. Lu +- +- PR target/87014 +- * config/i386/i386.md (eh_return): Always update EH return +- address in word_mode. +- +-2018-08-17 John David Anglin +- +- Backport from mainline +- 2018-08-11 John David Anglin +- +- * config/pa/pa.md (UNSPEC_MEMORY_BARRIER): New unspec enum. +- Update comment for atomic instructions. +- (atomic_storeqi, atomic_storehi, atomic_storesi, atomic_storesf, +- atomic_loaddf, atomic_loaddf_1, atomic_storedf, atomic_storedf_1): +- Remove. +- (atomic_loaddi): Revise fence expansion to only emit fence prior to +- load for __ATOMIC_SEQ_CST model. +- (atomic_loaddi_1): Remove float register target. +- (atomic_storedi): Handle CONST_INT values. +- (atomic_storedi_1): Remove float register source. Add special case +- for zero value. +- (memory_barrier): New expander and insn. +- +-2018-08-13 Segher Boessenkool +- +- Backport from mainline +- 2018-05-09 Segher Boessenkool +- +- PR rtl-optimization/85645 +- * regrename.c (build_def_use): Also kill the chains that include the +- destination of a REG_CFA_REGISTER note. +- +- PR rtl-optimization/85645 +- * regcprop.c (copyprop_hardreg_forward_1): Don't propagate into an +- insn that has a REG_CFA_REGISTER note. +- +-2018-08-10 Segher Boessenkool +- +- Backport from mainline +- 2018-06-19 Segher Boessenkool +- +- PR target/86197 +- * config/rs6000/rs6000.md (rs6000_discover_homogeneous_aggregate): An +- ieee128 argument takes up only one (vector) register, not two (floating +- point) registers. +- +-2018-08-02 Jozef Lawrynowicz +- +- Backport from mainline +- 2018-07-31 Jozef Lawrynowicz +- +- PR middle-end/86705 +- * gcc/cfgexpand.c (set_parm_rtl): Use the alignment of Pmode when +- MAX_SUPPORTED_STACK_ALIGNMENT would otherwise be exceeded by the +- requested variable alignment. +- (expand_one_ssa_partition): Likewise. +- (expand_one_var): Likewise. +- +-2018-08-01 Richard Biener +- +- PR bootstrap/86724 +- * graphite.h: Include isl/id.h and isl/space.h to allow build +- with ISL 0.20. +- +-2018-07-29 John David Anglin +- +- * config/pa/pa.c (pa_output_addr_vec): Align address table. +- * config/pa/pa.h (JUMP_TABLES_IN_TEXT_SECTION): Revise comment. +- * config/pa/pa32-linux.h (JUMP_TABLES_IN_TEXT_SECTION): Define. +- +-2018-07-17 Kyrylo Tkachov +- +- Backport from mainline +- PR target/84168 +- 2017-09-28 Joseph Myers +- +- * config/aarch64/aarch64.c (aarch64_elf_asm_constructor) +- (aarch64_elf_asm_destructor): Pass SECTION_NOTYPE to get_section +- when creating .init_array and .fini_array sections with priority +- specified. +- +-2018-07-12 Richard Biener +- +- PR target/84829 +- * config/gnu-user.h (GNU_USER_TARGET_NO_PTHREADS_LIB_SPEC): +- Remove -mieee-fp handling. +- +-2018-07-10 Carl Love +- +- Backport from mainline +- 2017-09-07 Carl Love +- +- * config/rs6000/vsx.md (define_insn "*stxvl"): Add missing argument to +- the sldi instruction. +- +-2018-06-29 Martin Liska +- +- Backport from mainline +- 2018-01-10 Kelvin Nilsen +- +- * lex.c (search_line_fast): Remove illegal coercion of an +- unaligned pointer value to vector pointer type and replace with +- use of __builtin_vec_vsx_ld () built-in function, which operates +- on unaligned pointer values. +- +-2018-06-27 David Edelsohn +- +- 2018-06-19 Tony Reix +- Damien Bergamini +- David Edelsohn +- +- * collect2.c (static_obj): New variable. +- (static_libs): New variable. +- (is_in_list): Uncomment declaration. +- (main): Track AIX libraries linked statically. +- (is_in_list): Uncomment definition. +- (scan_prog_file): Don't add AIX shared libraries initializer +- to constructor list if linking statically. +- +-2018-06-26 Kelvin Nilsen +- +- Backported from mainline +- 2018-06-20 Kelvin Nilsen +- +- * config/rs6000/rs6000-c.c (altivec_overloaded_builtins): Change +- behavior of vec_packsu (vector unsigned long long, vector unsigned +- long long) to match behavior of vec_packs with same signature. +- +-2018-06-26 Robin Dapp +- +- * config/s390/s390.h (enum processor_flags): Do not use +- default tune parameter when -march was specified. +- +-2018-06-26 Jakub Jelinek +- +- PR target/86314 +- * config/i386/i386.md (setcc + movzbl to xor + setcc peephole2s): +- Check reg_overlap_mentioned_p in addition to reg_set_p with the same +- operands. +- +-2018-06-25 Michael Meissner +- +- Back port from trunk +- 2018-04-17 Michael Meissner +- +- PR target/85424 +- * config/rs6000/rs6000.md (pack): Do not try handle a pack +- where the inputs overlap with the output. +- +-2018-06-25 Jakub Jelinek +- +- PR target/84786 +- * config/i386/sse.md (vshift_count): New mode attr. +- (3): Use N instead of vN +- as last operand's constraint for VI2_AVX2_AVX512BW shifts. Use YvN +- instead of vN as last operand's constraint for VI48_AVX2 shifts. +- +-2018-06-23 Richard Sandiford +- +- PR tree-optimization/85989 +- * gimple-ssa-backprop.c (backprop::m_visited_phis): New member +- variable. +- (backprop::intersect_uses): Check it when deciding whether this +- is a backedge reference. +- (backprop::process_block): Add each phi to m_visited_phis +- after visiting it, then clear it at the end. +- +-2018-06-22 Jakub Jelinek +- +- Backported from mainline +- 2018-06-20 Jakub Jelinek +- +- PR tree-optimization/86231 +- * tree-vrp.c (union_ranges): For ( [ ) ] or ( )[ ] range and +- anti-range don't overwrite *vr0min before using it to compute *vr0max. +- +- 2018-06-15 Jakub Jelinek +- +- PR middle-end/85878 +- * expr.c (expand_assignment): Only call store_expr for halves if the +- mode is the same. +- +- 2018-06-14 Jakub Jelinek +- +- PR target/85945 +- * lower-subreg.c (find_decomposable_subregs): Don't decompose float +- subregs of multi-word pseudos unless the float mode has word size. +- +- 2018-06-04 Jakub Jelinek +- +- PR c++/86025 +- * tree.c (inchash::add_expr): Handle IDENTIFIER_NODE. +- +- 2018-05-06 Jakub Jelinek +- +- PR c++/85659 +- * cfgexpand.c (expand_asm_stmt): Don't create a temporary if +- the type is addressable. Don't force op into register if it has +- BLKmode. +- +- 2018-05-01 Jakub Jelinek +- +- PR web/85578 +- * doc/install.texi2html: Replace _002d with - and _002a with * in +- generated html files using sed. +- +- 2018-04-27 Jakub Jelinek +- +- PR tree-optimization/85529 +- * tree-ssa-reassoc.c (optimize_range_tests_var_bound): Add FIRST_BB +- argument. Don't call get_nonzero_bits if opcode is ERROR_MARK_NODE, +- rhs2 def stmt's bb is dominated by first_bb and it isn't an obvious +- zero extension or masking of the MSB bit. +- (optimize_range_tests): Add FIRST_BB argument, pass it through +- to optimize_range_tests_var_bound. +- (maybe_optimize_range_tests, reassociate_bb): Adjust +- optimize_range_tests callers. +- +- 2018-04-19 Jakub Jelinek +- +- PR tree-optimization/85446 +- * match.pd ((intptr_t) x eq/ne CST to x eq/ne (typeof x) cst): Require +- the integral and pointer types to have the same precision. +- +- 2018-04-18 David Malcolm +- +- PR jit/85384 +- * configure.ac (gcc-driver-name.h): Honor --with-gcc-major-version +- by using gcc_base_ver to generate a gcc_driver_version, and use +- it when generating GCC_DRIVER_NAME. +- * configure: Regenerate. +- +- 2018-04-17 Jakub Jelinek +- +- PR rtl-optimization/85431 +- * dse.c (record_store): Ignore zero width stores. +- +- PR target/85430 +- * config/i386/i386.md (*ashlqi3_1_slp): Use alu1 type instead of alu. +- +- 2018-04-10 Jakub Jelinek +- +- PR rtl-optimization/85300 +- * combine.c (subst): Handle subst of CONST_SCALAR_INT_P new_rtx also +- into FLOAT and UNSIGNED_FLOAT like ZERO_EXTEND, return a CLOBBER if +- simplify_unary_operation fails. +- +- 2018-04-07 Jakub Jelinek +- +- PR tree-optimization/85257 +- * fold-const.c (native_encode_vector): If not all elts could fit +- and off is -1, return 0 rather than offset. +- * tree-ssa-sccvn.c (vn_reference_lookup_3): Pass +- (offset - offset2) / BITS_PER_UNIT as 4th argument to +- native_encode_expr. Verify len * BITS_PER_UNIT >=3D maxsizei. Don't +- adjust buffer in native_interpret_expr call. +- +- 2018-04-06 Jakub Jelinek +- +- PR debug/85252 +- * dwarf2out.c (rtl_for_decl_init): For STRING_CST initializer only +- build CONST_STRING if TYPE_MAX_VALUE is non-NULL and is INTEGER_CST. +- +- 2018-04-03 Jakub Jelinek +- +- PR rtl-optimization/85167 +- * shrink-wrap.c (move_insn_for_shrink_wrap): Don't set bb_uses and +- bb_defs if *split_p, instead preinitialize it to NULL. +- +- 2018-03-28 Jakub Jelinek +- +- PR target/85095 +- * config/i386/i386.md (*add3_carry_0, *addsi3_carry_zext_0, +- *sub3_carry_0, *subsi3_carry_zext_0): New patterns. +- +- 2018-03-23 Jakub Jelinek +- +- PR inline-asm/85022 +- * emit-rtl.c (init_emit_regs): Indicate that VOIDmode MEMs don't have +- known size by default. +- +- PR inline-asm/85034 +- * function.c (match_asm_constraints_1): Don't optimize if input +- doesn't satisfy general_operand predicate for output's mode. +- +- PR inline-asm/85022 +- * alias.c (write_dependence_p): Don't require for x_canonicalized +- non-VOIDmode if x has VOIDmode. +- +- 2018-03-22 Jakub Jelinek +- +- PR inline-asm/84941 +- * function.c (match_asm_constraints_1): Don't do the optimization +- if input isn't a REG, SUBREG, MEM or constant. +- +- PR sanitizer/85018 +- * dwarf2asm.c (dw2_output_indirect_constant_1): Set +- DECL_INITIAL (decl) to decl at the end. +- * varasm.c (use_blocks_for_decl_p): Revert the 2018-03-20 change, +- adjust the comment. +- +- 2018-03-20 Jakub Jelinek +- +- PR debug/84875 +- * dce.c (delete_unmarked_insns): Don't remove frame related noop moves +- holding REG_CFA_RESTORE notes, instead turn them into a USE. +- +- PR c/84953 +- * builtins.c (fold_builtin_strpbrk): For strpbrk(x, "") use type +- instead of TREE_TYPE (s1) for the return value. +- +- PR target/84990 +- * dwarf2asm.c (dw2_output_indirect_constant_1): Temporarily turn off +- flag_section_anchors. +- * varasm.c (use_blocks_for_decl_p): Remove hack for +- dw2_force_const_mem. +- +- 2018-03-19 Jakub Jelinek +- +- PR sanitizer/78651 +- * dwarf2asm.c: Include fold-const.c. +- (dw2_output_indirect_constant_1): Set DECL_INITIAL (decl) to ADDR_EXPR +- of decl rather than decl itself. +- +- 2018-03-19 Maxim Ostapenko +- +- PR sanitizer/78651 +- * dwarf2asm.c (dw2_output_indirect_constant_1): Disable ASan before +- calling assemble_variable. +- +- 2018-03-16 Jakub Jelinek +- +- PR target/84899 +- * postreload.c (reload_combine_recognize_pattern): Perform +- INTVAL addition in unsigned HOST_WIDE_INT type to avoid UB and +- truncate_int_for_mode the result for the destination's mode. +- +- PR tree-optimization/84841 +- * tree-ssa-reassoc.c (INTEGER_CONST_TYPE): Change to 1 << 4 from +- 1 << 3. +- (FLOAT_ONE_CONST_TYPE): Define. +- (constant_type): Return FLOAT_ONE_CONST_TYPE for -1.0 and 1.0. +- (sort_by_operand_rank): Put entries with higher constant_type last +- rather than first to match comments. +- +- 2018-03-15 Jakub Jelinek +- +- PR c++/79085 +- * calls.c (expand_call): For TREE_ADDRESSABLE rettype ignore alignment +- check and use address of target always. +- +- PR target/84860 +- * optabs.c (emit_conditional_move): Pass address of cmode's copy +- rather than address of cmode as last argument to prepare_cmp_insn. +- +- 2018-03-13 Jakub Jelinek +- +- PR middle-end/84834 +- * match.pd ((A & C) !=3D 0 ? D : 0): Use INTEGER_CST@2 instead of +- integer_pow2p@2 and test integer_pow2p in condition. +- (A < 0 ? C : 0): Similarly for @1. +- +- PR target/84827 +- * config/i386/i386.md (round2): For 387 fancy math, disable +- pattern if -ftrapping-math -fno-fp-int-builtin-inexact. +- +- PR target/84786 +- * config/i386/sse.md (sse2_loadhpd): Use Yv constraint rather than v +- on the last operand. +- +- 2018-03-09 Jakub Jelinek +- +- PR target/84772 +- * config/rs6000/rs6000.c (rs6000_gimplify_va_arg): Mark va_arg_tmp +- temporary TREE_ADDRESSABLE before gimplification of BUILT_IN_MEMCPY. +- +- PR c++/84767 +- * tree-inline.c (copy_tree_body_r): For INDIRECT_REF of a remapped +- decl, use remap_type if we want to use the type. +- +- 2018-03-08 Jakub Jelinek +- +- PR tree-optimization/84739 +- * tree-tailcall.c (find_tail_calls): Check call arguments against +- DECL_ARGUMENTS (current_function_decl) rather than +- DECL_ARGUMENTS (func) when checking for tail recursion. +- +- 2018-03-05 Jakub Jelinek +- +- PR target/84700 +- * combine.c (combine_simplify_rtx): Don't try to simplify if +- if_then_else_cond returned non-NULL, but either true_rtx or false_rtx +- are equal to x. +- +-2018-06-22 Andre Vieira +- +- Backport from mainline +- 2018-06-05 Andre Vieira +- +- * config/arm/arm_cmse.h (cmse_nsfptr_create): Change typeof to +- __typeof__. +- (cmse_check_pointed_object): Likewise. +- +-2018-06-22 Andre Vieira +- +- Backport from mainline +- 2018-05-17 Jerome Lambourg +- +- * config/arm/arm_cmse.h (cmse_nsfptr_create, cmse_is_nsfptr): Remove +- #include . Replace intptr_t with __INTPTR_TYPE__. +- +-2018-06-21 Sebastian Huber +- +- Backport from mainline +- 2018-06-15 Sebastian Huber +- +- * config.gcc (riscv*-*-elf* | riscv*-*-rtems*): Use custom +- multilibs for *-*-rtems*. +- * config/riscv/t-rtems: New file. +- +-2018-06-19 Max Filippov +- +- Backport from mainline +- 2018-06-19 Max Filippov +- +- * config/xtensa/xtensa.md (UNSPEC_FRAME_BLOCKAGE): New unspec +- constant. +- (allocate_stack, frame_blockage, *frame_blockage): New patterns. +- +-2018-06-19 Eric Botcazou +- +- * gimplify.c (gimplify_init_constructor): Really never clear for an +- incomplete constructor if CONSTRUCTOR_NO_CLEARING is set. +- +-2018-06-18 Martin Sebor +- +- PR middle-end/82063 +- * calls.c (alloc_max_size): Correct a logic error/typo. +- Treat excessive arguments as infinite. Warn for invalid arguments. +- * doc/invoke.texi (-Walloc-size-larger-than): Update. +- +-2018-06-14 Sebastian Huber +- +- Backport from mainline +- 2018-06-14 Sebastian Huber +- +- * config/rtems.h (STDINT_LONG32): Define. +- +-2018-06-11 Peter Bergner +- +- Backport from mainline +- 2018-06-08 Peter Bergner +- +- PR target/85755 +- * config/rs6000/rs6000.c (mem_operand_gpr): Enable PRE_INC and PRE_DEC +- addresses. +- +-2018-06-07 Peter Bergner +- +- Backport from mainline +- 2018-06-06 Peter Bergner +- +- PR target/63177 +- * /config/rs6000/rs6000.h (ASM_CPU_SPEC): Add support for -mpower9. +- Don't handle -mcpu=3Dpower8 if -mpower9-vector is also used. +- +-2018-06-07 Richard Biener +- +- Backport from mainline +- 2018-05-04 Richard Biener +- +- PR middle-end/85588 +- * fold-const.c (negate_expr_p): Restrict negation of operand +- zero of a division to when we know that can happen without +- overflow. +- (fold_negate_expr_1): Likewise. +- +- 2018-05-02 Richard Biener +- +- PR middle-end/85567 +- * gimplify.c (gimplify_save_expr): When in SSA form allow +- SAVE_EXPRs to compute to SSA vars. +- +- 2018-05-02 Richard Biener +- +- PR tree-optimization/85597 +- * tree-vect-stmts.c (vectorizable_operation): For ternary SLP +- do not use split vect_get_vec_defs call but call vect_get_slp_defs +- directly. +- +-2018-06-05 Andreas Krebbel +- +- Backport from mainline +- 2018-06-05 Andreas Krebbel +- +- * config/s390/s390-builtin-types.def: Add void function type. +- * config/s390/s390-builtins.def: Use the function type for the +- tbeginc builtin. +- +-2018-06-01 Bill Schmidt +- +- PR tree-optimization/85712 +- Backport from mainline: +- 2018-05-23 Bill Schmidt +- +- PR tree-optimization/85712 +- * gimple-ssa-strength-reduction.c (struct slsr_cand_d): Add +- first_interp field. +- (alloc_cand_and_find_basis): Initialize first_interp field. +- (slsr_process_mul): Modify first_interp field. +- (slsr_process_add): Likewise. +- (slsr_process_cast): Modify first_interp field for each new +- interpretation. +- (slsr_process_copy): Likewise. +- (dump_candidate): Dump first_interp field. +- (replace_mult_candidate): Process all interpretations, not just +- subsequent ones. +- (replace_rhs_if_not_dup): Likewise. +- (replace_one_candidate): Likewise. +- +- Backport from mainline: +- 2018-05-25 Bill Schmidt +- +- PR tree-optimization/85712 +- * gimple-ssa-strength-reduction.c (replace_one_candidate): Skip if +- this candidate has already been replaced in-situ by a copy. +- +-2018-05-24 Uros Bizjak +- +- * config/i386/sse.md (cvtusi264): +- Add {q} suffix to insn mnemonic. +- +-2018-05-24 Uros Bizjak +- +- PR target/85903 +- * config/i386/sse.md (movdi_to_sse): Do not generate pseudo +- when memory input operand is handled. +- +-2018-05-21 Pat Haugen +- +- Backport from mainline +- 2018-05-17 Pat Haugen +- Segher Boessenkool +- +- PR target/85698 +- * config/rs6000/rs6000.c (rs6000_output_move_128bit): Check +- dest operand. +- +-2018-05-17 Martin Jambor +- +- Backport from mainline +- 2018-05-11 Martin Jambor +- +- PR ipa/85655 +- * ipa-cp.c (intersect_with_plats): Check that the lattice contains +- single const. +- +-2018-05-01 Tom de Vries +- +- backport from trunk: +- 2018-04-16 Cesar Philippidis +- Tom de Vries +- +- PR middle-end/84955 +- * omp-expand.c (expand_oacc_for): Add dummy false branch for +- tiled basic blocks without omp continue statements. +- +-2018-04-26 Richard Biener +- +- Backport from mainline +- 2018-04-09 Richard Biener +- +- PR tree-optimization/85284 +- * tree-ssa-loop-niter.c (number_of_iterations_exit_assumptions): +- Only use the niter constraining form of simple_iv when the exit +- is always executed. +- +- 2018-04-06 Richard Biener +- +- PR middle-end/85244 +- * tree-dfa.c (get_ref_base_and_extent): Reset seen_variable_array_ref +- after seeing a component reference with an adjacent field. Treat +- refs to arrays at struct end of external decls similar to +- refs to unconstrained commons. +- +- 2018-04-04 Richard Biener +- +- PR tree-optimization/85168 +- * tree-ssa-sccvn.c (vn_reference_maybe_forwprop_address): Avoid +- propagating abnormals. +- +-2018-04-24 Martin Liska +- +- Backport from mainline +- 2018-04-17 Martin Liska +- +- PR lto/85405 +- * ipa-devirt.c (odr_types_equivalent_p): Remove trailing +- in message, remote space in between '_G' and '('. +- +-2018-04-24 Martin Liska +- +- Backport from mainline +- 2018-04-17 Jan Hubicka +- +- PR lto/85405 +- * ipa-devirt.c (odr_types_equivalent_p): Handle bit fields. +- +-2018-04-24 Martin Liska +- +- Backport from mainline +- 2018-03-28 Jakub Jelinek +- Martin Liska +- +- PR sanitizer/85081 +- * gimplify.c (asan_poison_variable): Don't do the check for +- gimplify_omp_ctxp here. +- (gimplify_decl_expr): Do it here. +- (gimplify_target_expr): Likewise. +- +-2018-04-24 Martin Liska +- +- Backport from mainline +- 2018-03-21 Martin Liska +- +- PR ipa/84963 +- * ipa-icf.c (sem_item_optimizer::fixup_points_to_sets): Remove +- not intended return statement. +- +-2018-04-24 Martin Liska +- +- Backport from mainline +- 2018-03-13 Martin Liska +- +- PR ipa/84658. +- * (sem_item_optimizer::sem_item_optimizer): Initialize new +- vector. +- (sem_item_optimizer::~sem_item_optimizer): Release it. +- (sem_item_optimizer::merge_classes): Register variable aliases. +- (sem_item_optimizer::fixup_pt_set): New function. +- (sem_item_optimizer::fixup_points_to_sets): Likewise. +- * ipa-icf.h: Declare new variables and functions. +- +-2018-04-23 Aaron Sawdey +- +- Backport from mainline +- 2018-04-16 Aaron Sawdey +- +- PR target/83660 +- * config/rs6000/rs6000-c.c (altivec_resolve_overloaded_builtin): Mark +- vec_extract expression as having side effects to make sure it gets +- a cleanup point. +- +-2018-04-23 Eric Botcazou +- +- PR middle-end/85496 +- * expr.c (store_field): In the bitfield case, if the value comes from +- a function call and is returned in registers by means of a PARALLEL, +- do not change the mode of the temporary unless BLKmode and VOIDmode. +- +-2018-04-20 Peter Bergner +- +- Backport from mainline +- 2018-03-09 Peter Bergner +- +- PR target/83969 +- * config/rs6000/rs6000.c (rs6000_offsettable_memref_p): New prototype. +- Add strict argument and use it. +- (rs6000_split_multireg_move): Update for new strict argument. +- (mem_operand_gpr): Disallow all non-offsettable addresses. +- * config/rs6000/rs6000.md (*movdi_internal64): Use YZ constraint. +- +-2018-04-18 Thomas Preud'homme +- +- Backport from mainline +- 2018-04-11 Thomas Preud'homme +- +- PR target/85261 +- * config/arm/arm-builtins.c (arm_expand_builtin): Force input operand +- into register. +- +-2018-04-12 Andreas Krebbel +- +- Backport from mainline +- 2018-04-12 Andreas Krebbel +- +- * config/s390/s390.c (s390_output_indirect_thunk_function): Check +- also for flag_dwarf2_cfi_asm. +- +-2018-04-11 Uros Bizjak +- +- * config/alpha/alpha.md (stack_probe_internal): Rename +- from "probe_stack". Update all callers. +- +-2018-04-11 Thomas Preud'homme +- +- Backport from mainline +- 2018-04-04 Thomas Preud'homme +- +- PR target/85203 +- * config/arm/arm-builtins.c (arm_expand_builtin): Change +- expansion to perform a bitwise AND of the argument followed by a +- boolean negation of the result. +- +-2018-04-10 Kyrylo Tkachov +- +- Backport from mainline +- 2018-03-08 Kyrylo Tkachov +- +- PR target/84748 +- * config/aarch64/aarch64.md (*compare_cstore_insn): Mark pattern +- as clobbering CC_REGNUM. +- +-2018-04-06 Eric Botcazou +- +- PR target/85196 +- * config/sparc/sparc.c (sparc_expand_move): Deal with symbolic operands +- based on LABEL_REF. Remove useless assertion. +- (pic_address_needs_scratch): Fix formatting. +- (sparc_legitimize_pic_address): Minor tweaks. +- (sparc_delegitimize_address): Adjust assertion accordingly. +- * config/sparc/sparc.md (movsi_pic_label_ref): Change label_ref_operand +- into symbolic_operand. +- (movsi_high_pic_label_ref): Likewise. +- (movsi_lo_sum_pic_label_ref): Likewise. +- (movdi_pic_label_ref): Likewise. +- (movdi_high_pic_label_ref): Likewise. +- (movdi_lo_sum_pic_label_ref): Likewise. +- +-2018-04-06 Amaan Cheval +- +- * config.gcc (x86_64-*-rtems*): Add rtems.h to tm_file for +- custom LIB_SPEC setup. +- +-2018-04-05 Uros Bizjak +- +- PR target/85193 +- * config/i386/i386.md (define_attr "memory"): Handle rotate1 type. +- +-2018-04-04 Peter Bergner +- +- Backport from mainline +- 2018-04-04 Peter Bergner +- +- PR rtl-optimization/84878 +- * ddg.c (add_cross_iteration_register_deps): Use DF_REF_BB to determine +- the basic block. Assert the use reference is not artificial and that +- it has an associated insn. +- +-2018-04-03 Uros Bizjak +- +- * config/i386/i386.c (emit_i387_cw_initialization): Always use logic +- instructions when changing rounding bits to preserve precision bits +- in the x87 control word. +- +-2018-04-03 Cesar Philippidis +- +- Backport from mainline +- 2018-03-27 Cesar Philippidis +- +- PR target/85056 +- * config/nvptx/nvptx.c (nvptx_assemble_decl_begin): Add '[]' to +- extern array declarations. +- +-2018-04-02 Peter Bergner +- +- Backport from mainline +- 2018-03-28 Peter Bergner +- +- PR target/84912 +- * config/rs6000/rs6000.h: Update copyright date. +- (RS6000_BTM_POWERPC64): New define. +- (RS6000_BTM_COMMON): Add RS6000_BTM_POWERPC64. +- * config/rs6000/rs6000.c: Update copyright date. +- (rs6000_builtin_mask_calculate): Add support for RS6000_BTM_POWERPC64. +- (rs6000_invalid_builtin): Add handling for RS6000_BTM_POWERPC64 +- (rs6000_builtin_mask_names): Add RS6000_BTM_POWERPC64. +- * config/rs6000/rs6000-builtin.def: Update copyright date. +- (BU_P7_POWERPC64_MISC_2): New macro definition. +- (DIVDE): Use it. +- (DIVDEU): Likewise. +- +- Backport from mainline +- 2018-03-28 Peter Bergner +- +- PR target/84912 +- * config/rs6000/rs6000-builtin.def (DIVWEO): Delete macro expansion. +- (DIVWEUO): Likewise. +- (DIVDEO): Likewise. +- (DIVDEUO): Likewise. +- * config/rs6000/rs6000.c (builtin_function_type): Remove support for +- DIVWEUO and DIVDEUO. +- * config/rs6000/rs6000.md: Update copyright date. +- (UNSPEC_DIVEO, UNSPEC_DIVEUO): Delete unspecs. +- (UNSPEC_DIV_EXTEND): Remove deleted unspecs. +- (div_extend): Likewise. +- * doc/extend.texi: Update copyright date. +- (__builtin_divweo): Remove documentation for deleted builtin function. +- (__builtin_divweuo): Likewise. +- (__builtin_divdeo): Likewise. +- (__builtin_divdeuo): Likewise. +- +-2018-04-02 Peter Bergner +- +- Backport from mainline +- 2018-03-30 Peter Bergner +- +- PR target/80546 +- * config/rs6000/vsx.md (??r): New mode attribute. +- (*vsx_mov_64bit): Use it. +- (*vsx_mov_32bit): Likewise. +- +-2018-03-29 Sebastian Peryt +- +- PR c++/84783 +- * config/i386/avx512vlintrin.h (_mm256_permutexvar_epi64) +- (_mm256_permutexvar_epi32, _mm256_permutex_epi64): New intrinsics. +- +-2018-03-29 Sudakshina Das +- +- Backport from mainline +- 2018-03-22 Sudakshina Das +- +- PR target/84826 +- * config/arm/arm.h (machine_function): Add static_chain_stack_bytes. +- * config/arm/arm.c (arm_compute_static_chain_stack_bytes): Avoid +- re-computing once computed. +- (arm_expand_prologue): Compute machine->static_chain_stack_bytes. +- (arm_init_machine_status): Initialize +- machine->static_chain_stack_bytes. +- +-2018-03-28 Sudakshina Das +- +- 2018-03-19 Sudakshina Das +- PR target/81647 +- +- * config/aarch64/aarch64-simd.md (vec_cmp): Modify +- instructions for UNLT, UNLE, UNGT, UNGE, UNEQ, UNORDERED and ORDERED. +- +-2018-03-28 Kyrylo Tkachov +- +- Backport from mainline +- 2018-03-23 Kyrylo Tkachov +- +- PR target/85026 +- * config/arm/arm.md (unaligned_loadhis): Remove first alternative. +- Clean up attributes. +- +-2018-03-28 Segher Boessenkool +- +- Backport from mainline +- 2018-03-08 Segher Boessenkool +- +- PR target/82411 +- * config/rs6000/rs6000.c (rs6000_elf_in_small_data_p): Don't put +- readonly data in sdata, if that is disabled. +- * config/rs6000/sysv4.opt (mreadonly-in-sdata): New option. +- * doc/invoke.texi (RS/6000 and PowerPC Options): Document +- -mreadonly-in-sdata option. +- +-2018-03-27 Sudakshina Das +- +- Backport from mainline: +- 2018-03-20 Sudakshina Das +- +- PR target/82989 +- * config/arm/neon.md (ashldi3_neon): Update ?s for constraints +- to favor GPR over NEON registers. +- (di3_neon): Likewise. +- +-2018-03-27 Kyrylo Tkachov +- +- Backport from mainline +- 2018-03-20 Kyrylo Tkachov +- +- PR target/82518 +- * config/arm/arm.c (arm_array_mode_supported_p): Return false for +- BYTES_BIG_ENDIAN. +- +-2018-03-23 Peter Bergner +- +- Backport from mainline +- 2018-03-20 Peter Bergner +- +- PR target/83789 +- * config/rs6000/altivec.md (altivec_lvx__2op): Delete define_insn. +- (altivec_lvx__1op): Likewise. +- (altivec_stvx__2op): Likewise. +- (altivec_stvx__1op): Likewise. +- (altivec_lvx_): New define_expand. +- (altivec_stvx_): Likewise. +- (altivec_lvx__2op_): New define_insn. +- (altivec_lvx__1op_): Likewise. +- (altivec_stvx__2op_): Likewise. +- (altivec_stvx__1op_): Likewise. +- * config/rs6000/rs6000.c (altivec_expand_lv_builtin): Likewise. +- (altivec_expand_stv_builtin): Likewise. +- (altivec_expand_builtin): Likewise. +- * config/rs6000/vector.md: Likewise. +- +-2018-03-23 Carl Love +- +- Backport from mainline: +- 2018-03-14 Carl Love +- +- * config/rs6000/r6000.c (rtx_is_swappable_p): Add case UNSPEC_VPERMXOR. +- +-2018-03-22 Tom de Vries +- +- backport from trunk: +- 2018-03-22 Tom de Vries +- +- PR tree-optimization/84956 +- * tree-ssa-tail-merge.c (find_clusters_1): Skip bbs with +- bb_has_abnormal_pred. +- +-2018-03-19 H.J. Lu +- +- Backport from mainline +- 2018-03-15 H.J. Lu +- +- PR target/84574 +- * config/i386/i386.c (indirect_thunk_needed): Update comments. +- (indirect_thunk_bnd_needed): Likewise. +- (indirect_thunks_used): Likewise. +- (indirect_thunks_bnd_used): Likewise. +- (indirect_return_needed): New. +- (indirect_return_bnd_needed): Likewise. +- (output_indirect_thunk_function): Add a bool argument for +- function return. +- (output_indirect_thunk_function): Don't generate alias for +- function return thunk. +- (ix86_code_end): Call output_indirect_thunk_function to generate +- function return thunks. +- (ix86_output_function_return): Set indirect_return_bnd_needed +- and indirect_return_needed instead of indirect_thunk_bnd_needed +- and indirect_thunk_needed. +- +-2018-03-14 John David Anglin +- +- PR target/83451 +- * config/pa/pa.c (pa_emit_move_sequence): Always emit secondary reload +- insn for floating-point loads and stores. +- +-2018-03-12 Jonathan Wakely +- +- * doc/invoke.texi (-mclflushopt): Fix spelling of option. +- +-2018-03-12 Richard Sandiford +- +- PR tree-optimization/84485 +- * tree-vect-data-refs.c (vect_analyze_data_ref_dependence): Return +- true for zero dependence distances if the step might be zero, +- and if there is no metadata that guarantees correctness. +- (vect_analyze_data_ref_access): Check safelen as well as +- force_vectorize. +- +-2018-03-11 John David Anglin +- +- Backport from mainline +- 2018-02-14 John David Anglin +- +- PR target/83984 +- * config/pa/pa.md: Load address of PIC label using the linkage table +- if the label is nonlocal. +- +- Backport from mainline +- 2018-03-06 John David Anglin +- +- * config/pa/pa.h (ASM_GENERATE_INTERNAL_LABEL): Revise to use +- sprint_ul. +- (ASM_OUTPUT_ADDR_VEC_ELT): Revise for above change. +- (ASM_OUTPUT_ADDR_DIFF_ELT): Likewise. +- * config/pa/pa64-hpux.h (ASM_GENERATE_INTERNAL_LABEL): Revise as above. +- +-2018-03-09 Kugan Vivekanandarajah +- +- Backport from mainline +- 2017-09-13 Kugan Vivekanandarajah +- +- * config/aarch64/aarch64.c (aarch64_override_options_after_change_1): +- Disable pc relative literal load irrespective of +- TARGET_FIX_ERR_A53_84341 for default. +- +-2018-03-06 Denis Chertykov +- +- Backport from mainline +- 2018-02-07 Georg-Johann Lay +- +- PR target/84209 +- * config/avr/avr.h (GENERAL_REGNO_P, GENERAL_REG_P): New macros. +- * config/avr/avr.md: Only post-reload split REG-REG moves if +- either register is GENERAL_REG_P. +- +-2018-03-06 Carl Love +- +- Backport from mainline +- 2/16/18 commit 257748 Carl Love +- +- * config/rs6000/altivec.h: Remove vec_vextract4b and vec_vinsert4b. +- * config/rs6000/rs6000-builtin.def: Remove macro expansion for +- VINSERT4B_DI and VINSERT4B. +- * config/rs6000/rs6000.c: Remove case statements for +- P9V_BUILTIN_VINSERT4B, P9V_BUILTIN_VINSERT4B_DI, +- and P9V_BUILTIN_VEC_VINSERT4B. +- * config/rs6000/rs6000-c.c (altivec_expand_builtin): Remove entries for +- P9V_BUILTIN_VEC_VEXTRACT4B and P9V_BUILTIN_VEC_VINSERT4B. +- * config/rs6000/vsx.md: Remove define_expand vinsert4b, +- define_insn *vinsert4b_internal, define_insn "*vinsert4b_di_internal. +- * doc/extend.texi: Remove vec_vextract4b, non ABI definitions for +- vec_insert4b. +- +-2018-03-06 Martin Liska +- +- Backport from mainline +- 2018-02-20 Martin Liska +- +- PR c/84310 +- PR target/79747 +- * final.c (shorten_branches): Build align_tab array with one +- more element. +- * opts.c (finish_options): Add alignment option limit check. +- (MAX_CODE_ALIGN): Likewise. +- (MAX_CODE_ALIGN_VALUE): Likewise. +- * doc/invoke.texi: Document maximum allowed option value for +- all -falign-* options. +- +-2018-03-06 Martin Liska +- +- Backport from mainline +- 2018-02-19 Martin Liska +- +- PR other/80589 +- * doc/invoke.texi: Fix typo. +- * params.def (PARAM_MAX_LOOP_HEADER_INSNS): Likewise. +- +-2018-03-06 Martin Liska +- +- Backport from mainline +- 2018-02-05 Martin Liska +- +- PR gcov-profile/84137 +- * doc/gcov.texi: Fix typo in documentation. +- +-2018-03-06 Martin Liska +- +- Backport from mainline +- 2018-02-05 Martin Liska +- +- PR gcov-profile/83879 +- * doc/gcov.texi: Document necessity of --dynamic-list-data when +- using dlopen functionality. +- +-2018-03-06 Martin Liska +- +- Backport from mainline +- 2017-12-19 Martin Liska +- +- PR rtl-optimization/82675 +- * loop-unroll.c (unroll_loop_constant_iterations): Allocate one +- more element in sbitmap. +- +-2018-03-06 Martin Liska +- +- Backport from mainline +- 2018-03-05 Martin Liska +- +- * ipa-utils.c (ipa_merge_profiles): Do not merge alias or +- a function without profile. +- +-2018-03-06 Martin Liska +- +- Backport from mainline +- 2018-02-21 Jan Hubicka +- +- PR c/84229 +- * ipa-cp.c (determine_versionability): Do not version functions caling +- va_arg_pack. +- +-2018-03-06 Martin Liska +- +- Backport from mainline +- 2018-02-08 Jan Hubicka +- +- PR ipa/81360 +- * cgraph.h (symtab_node::output_to_lto_symbol_table_p): Declare +- * symtab.c: Include builtins.h +- (symtab_node::output_to_lto_symbol_table_p): Move here +- from lto-streamer-out.c:output_symbol_p. +- * lto-streamer-out.c (write_symbol): Turn early exit to assert. +- (output_symbol_p): Move all logic to symtab.c +- (produce_symtab): Update. +- +-2018-03-06 Peter Bergner +- +- Backport from mainline +- 2018-02-22 Vladimir Makarov +- +- PR target/81572 +- * lra-int.h (LRA_UNKNOWN_ALT, LRA_NON_CLOBBERED_ALT): New macros. +- * lra.c (lra_set_insn_recog_data, lra_update_insn_recog_data): Use +- LRA_UNKNOWN_ALT. +- * lra-constraints.c (curr_insn_transform): Set up +- LRA_NON_CLOBBERED_ALT for moves processed on the fast path. Use +- LRA_UNKNOWN_ALT. +- (remove_inheritance_pseudos): Use LRA_UNKNOWN_ALT. +- * lra-eliminations.c (spill_pseudos): Ditto. +- (process_insn_for_elimination): Ditto. +- * lra-lives.c (reg_early_clobber_p): Use the new macros. +- * lra-spills.c (spill_pseudos): Use LRA_UNKNOWN_ALT and +- LRA_NON_CLOBBERED_ALT. +- +-2018-03-06 Richard Biener +- +- Backport from mainline +- 2018-03-05 Richard Biener +- +- PR tree-optimization/84486 +- * tree-ssa-pre.c (create_expression_by_pieces): Remove dead code. +- When inserting a __builtin_assume_aligned call set the LHS +- SSA name alignment info accordingly. +- +- 2018-02-28 Richard Biener +- +- PR middle-end/84607 +- * genmatch.c (capture_info::walk_match): Do not mark +- captured expressions without operands as expr_p given +- they act more like predicates and should be subject to +- "lost tail" side-effect preserving. +- +-2018-03-05 Jakub Jelinek +- +- PR target/84524 +- * config/i386/sse.md (*3): Replace with +- orig,vex. +- (*3): Likewise. Remove uses. +- +-2018-03-03 Jakub Jelinek +- +- Backported from mainline +- 2018-03-02 Jakub Jelinek +- Richard Biener +- +- PR ipa/84628 +- * expr.c (expand_expr_real_1) : Don't emit diagnostics +- for error or warning attributes if CALL_FROM_THUNK_P is set. +- Formatting fixes. +- +- 2018-03-02 Jakub Jelinek +- +- PR inline-asm/84625 +- * config/i386/i386.c (ix86_print_operand): Use conditional +- output_operand_lossage instead of gcc_assert if CONST_VECTOR is not +- zero vector. +- +- 2018-02-23 Jakub Jelinek +- +- * ipa-prop.c (ipa_vr_ggc_hash_traits::hash): Hash p->min and +- p->max as pointers rather than using iterative_hash_expr. +- +- 2017-11-10 Jakub Jelinek +- +- PR bootstrap/82916 +- * gimple-ssa-store-merging.c +- (pass_store_merging::terminate_all_aliasing_chains): For +- gimple_store_p stmts also call refs_output_dependent_p. +- +- 2018-02-19 Jakub Jelinek +- +- PR c++/84444 +- * builtins.c (builtin_mathfn_code): Don't check if CALL_EXPR_FN (t) +- is ADDR_EXPR. +- +- 2018-02-16 Jakub Jelinek +- +- PR ipa/84425 +- * ipa-inline.c (inline_small_functions): Fix a typo. +- +- 2018-02-13 Jakub Jelinek +- +- PR c/82210 +- * stor-layout.c (place_field): For variable length fields, adjust +- offset_align afterwards not just based on the field's alignment, +- but also on the size. +- +- 2018-02-10 Jakub Jelinek +- +- PR sanitizer/83987 +- * omp-low.c (maybe_remove_omp_member_access_dummy_vars, +- remove_member_access_dummy_vars): New functions. +- (lower_omp_for, lower_omp_taskreg, lower_omp_target, +- lower_omp_1, execute_lower_omp): Use them. +- +- PR rtl-optimization/84308 +- * shrink-wrap.c (spread_components): Release todo vector. +- +- 2018-02-09 Jakub Jelinek +- +- PR sanitizer/84285 +- * gcc.c (STATIC_LIBASAN_LIBS, STATIC_LIBTSAN_LIBS, +- STATIC_LIBLSAN_LIBS, STATIC_LIBUBSAN_LIBS): Handle -static like +- -static-lib*san. +- +- 2018-02-09 Marek Polacek +- Jakub Jelinek +- +- PR c++/83659 +- * fold-const.c (fold_indirect_ref_1): Use VECTOR_TYPE_P macro. +- Formatting fixes. Verify first that tree_fits_shwi_p (op01). +- Sync some changes from cxx_fold_indirect_ref. +- +- 2018-02-07 Jakub Jelinek +- +- * tree-eh.c (operation_could_trap_helper_p): Ignore honor_trapv for +- *DIV_EXPR and *MOD_EXPR. +- +- 2018-02-01 Jakub Jelinek +- +- PR tree-optimization/81661 +- PR tree-optimization/84117 +- * tree-eh.h (rewrite_to_non_trapping_overflow): Declare. +- * tree-eh.c: Include gimplify.h. +- (find_trapping_overflow, replace_trapping_overflow, +- rewrite_to_non_trapping_overflow): New functions. +- * tree-vect-loop.c: Include tree-eh.h. +- (vect_get_loop_niters): Use rewrite_to_non_trapping_overflow. +- +- 2018-01-30 Jakub Jelinek +- +- PR rtl-optimization/83986 +- * sched-deps.c (sched_analyze_insn): For frame related insns, add anti +- dependence against last_pending_memory_flush in addition to +- pending_jump_insns. +- +- 2018-01-27 Jakub Jelinek +- +- PR middle-end/84040 +- * sched-deps.c (sched_macro_fuse_insns): Return immediately if +- !insn_set. +- +- 2018-01-24 Jakub Jelinek +- +- PR middle-end/83977 +- * tree-inline.c (tree_function_versioning): Remove "omp declare simd" +- attributes from DECL_ATTRIBUTES (new_decl) without affecting +- DECL_ATTRIBUTES (old_decl). +- +- 2018-01-20 Jakub Jelinek +- +- PR middle-end/83945 +- * tree-emutls.c: Include gimplify.h. +- (lower_emutls_2): New function. +- (lower_emutls_1): If ADDR_EXPR is a gimple invariant and walk_tree +- with lower_emutls_2 callback finds some TLS decl in it, unshare_expr +- it before further processing. +- +- PR target/83930 +- * simplify-rtx.c (simplify_binary_operation_1) : Use +- UINTVAL (trueop1) instead of INTVAL (op1). +- +- 2018-01-09 Jakub Jelinek +- +- PR preprocessor/83722 +- * gcc.c (try_generate_repro): Pass +- &temp_stderr_files[RETRY_ICE_ATTEMPTS - 1] rather than +- &temp_stdout_files[RETRY_ICE_ATTEMPTS - 1] as last argument to +- do_report_bug. +- +- 2018-01-05 Jakub Jelinek +- +- PR tree-optimization/83605 +- * gimple-ssa-strength-reduction.c: Include tree-eh.h. +- (find_candidates_dom_walker::before_dom_children): Ignore stmts that +- can throw. +- +-2018-03-01 H.J. Lu +- +- Backport from mainline +- 2018-02-26 H.J. Lu +- +- PR target/84039 +- * config/i386/constraints.md (Bs): Replace +- ix86_indirect_branch_register with +- TARGET_INDIRECT_BRANCH_REGISTER. +- (Bw): Likewise. +- * config/i386/i386.md (indirect_jump): Likewise. +- (tablejump): Likewise. +- (*sibcall_memory): Likewise. +- (*sibcall_value_memory): Likewise. +- Peepholes of indirect call and jump via memory: Likewise. +- (*sibcall_GOT_32): Disallowed for TARGET_INDIRECT_BRANCH_REGISTER. +- (*sibcall_value_GOT_32): Likewise. +- * config/i386/predicates.md (indirect_branch_operand): Likewise. +- (GOT_memory_operand): Likewise. +- (call_insn_operand): Likewise. +- (sibcall_insn_operand): Likewise. +- (GOT32_symbol_operand): Likewise. +- * config/i386/i386.h (TARGET_INDIRECT_BRANCH_REGISTER): New. +- +-2018-03-01 H.J. Lu +- +- Backport from mainline +- 2018-02-26 H.J. Lu +- +- * config/i386/i386.c (ix86_output_indirect_jmp): Update comments. +- +- 2018-02-26 H.J. Lu +- +- PR target/84530 +- * config/i386/i386-protos.h (ix86_output_indirect_jmp): Remove +- the bool argument. +- (ix86_output_indirect_function_return): New prototype. +- (ix86_split_simple_return_pop_internal): Likewise. +- * config/i386/i386.c (indirect_return_via_cx): New. +- (indirect_return_via_cx_bnd): Likewise. +- (indirect_thunk_name): Handle return va CX_REG. +- (output_indirect_thunk_function): Create alias for +- __x86_return_thunk_[re]cx and __x86_return_thunk_[re]cx_bnd. +- (ix86_output_indirect_jmp): Remove the bool argument. +- (ix86_output_indirect_function_return): New function. +- (ix86_split_simple_return_pop_internal): Likewise. +- * config/i386/i386.md (*indirect_jump): Don't pass false +- to ix86_output_indirect_jmp. +- (*tablejump_1): Likewise. +- (simple_return_pop_internal): Change it to define_insn_and_split. +- Call ix86_split_simple_return_pop_internal to split it for +- -mfunction-return=3D. +- (simple_return_indirect_internal): Call +- ix86_output_indirect_function_return instead of +- ix86_output_indirect_jmp. +- +-2017-03-02 Thomas Schwinge +- +- Backport from trunk r256891: +- 2018-01-19 Cesar Philippidis +- +- PR target/83790 +- * config/nvptx/nvptx.c (output_init_frag): Don't use generic address +- spaces for function labels. +- +-2018-02-26 Carl Love +- +- Backport from mainline: commit 257747 on 2018-02-16. +- +- * config/rs6000/altivec.h: Add builtin names vec_extract4b +- vec_insert4b. +- * config/rs6000/rs6000-builtin.def: Add INSERT4B and EXTRACT4B +- definitions. +- * config/rs6000/rs6000-c.c: Add the definitions for +- P9V_BUILTIN_VEC_EXTRACT4B and P9V_BUILTIN_VEC_INSERT4B. +- * config/rs6000/rs6000.c (altivec_expand_builtin): Add +- P9V_BUILTIN_EXTRACT4B and P9V_BUILTIN_INSERT4B case statements. +- * config/rs6000/vsx.md: Add define_insn extract4b. Add define_expand +- definition for insert4b and define insn *insert3b_internal. +- * doc/extend.texi: Add documentation for vec_extract4b. +- +-2018-02-26 Eric Botcazou +- +- PR rtl-optimization/83496 +- * reorg.c (steal_delay_list_from_target): Change REDUNDANT array from +- booleans to RTXes. Call fix_reg_dead_note on every non-null element. +- (steal_delay_list_from_fallthrough): Call fix_reg_dead_note on a +- redundant insn, if any. +- (relax_delay_slots): Likewise. +- (update_reg_unused_notes): Rename REDUNDANT_INSN to OTHER_INSN. +- +-2018-02-22 Sudakshina Das +- Bin Cheng +- +- Backport from mainline: +- 2017-12-14 Sudakshina Das +- Bin Cheng +- +- PR target/81228 +- * config/aarch64/aarch64.c (aarch64_select_cc_mode): Move LTGT to +- CCFPEmode. +- * config/aarch64/aarch64-simd.md (vec_cmp): Add +- LTGT. +- +-2018-02-16 Jozef Lawrynowicz +- +- PR target/79242 +- * machmode.def: Define a complex mode for PARTIAL_INT. +- * genmodes.c (complex_class): Return MODE_COMPLEX_INT for +- MODE_PARTIAL_INT. +- * doc/rtl.texi: Document CSPImode. +- * config/msp430/msp430.c (msp430_hard_regno_nregs): Add CPSImode +- handling. +- (msp430_hard_regno_nregs_with_padding): Likewise. +- +-2018-02-16 Sudakshina Das +- +- Backport from trunk +- 2018-01-10 Sudakshina Das +- +- PR target/82096 +- * expmed.c (emit_store_flag_force): Swap if const op0 +- and change VOIDmode to mode of op0. +- +-2018-02-16 Richard Biener +- +- PR tree-optimization/84190 +- * tree-ssa.c (non_rewritable_mem_ref_base): Do not touch +- volatile accesses if the decl isn't volatile. +- +-2018-02-15 Michael Meissner +- +- Back port from trunk +- 2018-02-07 Michael Meissner +- +- PR target/84154 +- * config/rs6000/rs6000.md (fix_trunc2): +- Convert from define_expand to be define_insn_and_split. Rework +- float/double/_Float128 conversions to QI/HI/SImode to work with +- both ISA 2.07 (power8) or ISA 3.0 (power9). Fix regression where +- conversions to QI/HImode types did a store and then a load to +- truncate the value. For conversions to VSX registers, don't split +- the insn, instead emit the code directly. Use the code iterator +- any_fix to combine signed and unsigned conversions. +- (fix_truncsi2_p8): Likewise. +- (fixuns_trunc2): Likewise. +- (fix_trunc2): Likewise. +- (fix_trunc2): Likewise. +- (fix_di2_hw): Likewise. +- (fixuns_di2_hw): Likewise. +- (fix_si2_hw): Likewise. +- (fixuns_si2_hw): Likewise. +- (fix_2_hw): Likewise. +- (fix_trunc2): Likewise. +- (fctiwz__smallint): Rename fctiwz__smallint to +- fix_truncsi2_p8. +- (fix_trunc2_internal): Delete, no longer +- used. +- (fixuns_trunc2_internal): Likewise. +- (fix__mem): Likewise. +- (fctiwz__mem): Likewise. +- (fix__mem): Likewise. +- (fix_trunc2_mem): On ISA 3.0, prevent +- the register allocator from doing a direct move to the GPRs to do +- a store, and instead use the ISA 3.0 store byte/half-word from +- vector register instruction. For IEEE 128-bit floating point, +- also optimize stores of 32-bit ints. +- (fix_trunc2_mem): Likewise. +- +-2018-02-15 Aaron Sawdey +- +- Back port from mainline +- 2018-01-30 Aaron Sawdey +- +- PR target/83758 +- * config/rs6000/rs6000.c (rs6000_internal_arg_pointer): Only return +- a reg rtx. +- +-2018-02-14 Peter Bergner +- +- Back port from mainline +- 2018-02-13 Peter Bergner +- +- PR target/84279 +- * config/rs6000/rs6000.c (mem_operand_gpr): Disallow altivec addresses. +- +-2018-02-14 Martin Jambor +- +- PR c++/83990 +- * ipa-prop.c (ipa_modify_call_arguments): Use location of call +- statements, also set location of a load to a temporary. +- +-2018-02-10 John David Anglin +- +- * config/pa/pa.c (hppa_profile_hook): Mark SYMBOL_REF for _mcount as +- function label. +- +- Backport from mainline +- 2018-02-01 Aldy Hernandez +- +- PR target/84089 +- * config/pa/predicates.md (base14_operand): Handle VOIDmode. +- +-2018-02-09 Martin Jambor +- +- Backport from mainline +- 2018-02-08 Martin Jambor +- +- * hsa-gen.c (get_symbol_for_decl): Set program allocation for +- static local variables. +- +-2018-02-09 Andreas Krebbel +- +- Backport from mainline +- 2018-02-09 Andreas Krebbel +- +- PR target/PR84295 +- * config/s390/s390.c (s390_set_current_function): Invoke +- s390_indirect_branch_settings also if fndecl didn't change. +- +-2018-02-08 Iain Sandoe +- +- PR target/84113 +- * config/rs6000/altivec.md (*restore_world): Remove LR use. +- * config/rs6000/predicates.md (restore_world_operation): Adjust op +- count, remove one USE. +- +-2018-02-08 Andreas Krebbel +- +- Backport from mainline +- 2018-02-08 Andreas Krebbel +- +- * config/s390/s390-opts.h (enum indirect_branch): Define. +- * config/s390/s390-protos.h (s390_return_addr_from_memory) +- (s390_indirect_branch_via_thunk) +- (s390_indirect_branch_via_inline_thunk): Add function prototypes. +- (enum s390_indirect_branch_type): Define. +- * config/s390/s390.c (struct s390_frame_layout, struct +- machine_function): Remove. +- (indirect_branch_prez10thunk_mask, indirect_branch_z10thunk_mask) +- (indirect_branch_table_label_no, indirect_branch_table_name): +- Define variables. +- (INDIRECT_BRANCH_NUM_OPTIONS): Define macro. +- (enum s390_indirect_branch_option): Define. +- (s390_return_addr_from_memory): New function. +- (s390_handle_string_attribute): New function. +- (s390_attribute_table): Add new attribute handler. +- (s390_execute_label): Handle UNSPEC_EXECUTE_JUMP patterns. +- (s390_indirect_branch_via_thunk): New function. +- (s390_indirect_branch_via_inline_thunk): New function. +- (s390_function_ok_for_sibcall): When jumping via thunk disallow +- sibling call optimization for non z10 compiles. +- (s390_emit_call): Force indirect branch target to be a single +- register. Add r1 clobber for non-z10 compiles. +- (s390_emit_epilogue): Emit return jump via return_use expander. +- (s390_reorg): Handle JUMP_INSNs as execute targets. +- (s390_option_override_internal): Perform validity checks for the +- new command line options. +- (s390_indirect_branch_attrvalue): New function. +- (s390_indirect_branch_settings): New function. +- (s390_set_current_function): Invoke s390_indirect_branch_settings. +- (s390_output_indirect_thunk_function): New function. +- (s390_code_end): Implement target hook. +- (s390_case_values_threshold): Implement target hook. +- (TARGET_ASM_CODE_END, TARGET_CASE_VALUES_THRESHOLD): Define target +- macros. +- * config/s390/s390.h (struct s390_frame_layout) +- (struct machine_function): Move here from s390.c. +- (TARGET_INDIRECT_BRANCH_NOBP_RET) +- (TARGET_INDIRECT_BRANCH_NOBP_JUMP) +- (TARGET_INDIRECT_BRANCH_NOBP_JUMP_THUNK) +- (TARGET_INDIRECT_BRANCH_NOBP_JUMP_INLINE_THUNK) +- (TARGET_INDIRECT_BRANCH_NOBP_CALL) +- (TARGET_DEFAULT_INDIRECT_BRANCH_TABLE) +- (TARGET_INDIRECT_BRANCH_THUNK_NAME_EXRL) +- (TARGET_INDIRECT_BRANCH_THUNK_NAME_EX) +- (TARGET_INDIRECT_BRANCH_TABLE): Define macros. +- * config/s390/s390.md (UNSPEC_EXECUTE_JUMP) +- (INDIRECT_BRANCH_THUNK_REGNUM): Define constants. +- (mnemonic attribute): Add values which aren't recognized +- automatically. +- ("*cjump_long", "*icjump_long", "*basr", "*basr_r"): Disable +- pattern for branch conversion. Fix mnemonic attribute. +- ("*c", "*sibcall_br", "*sibcall_value_br", "*return"): Emit +- indirect branch via thunk if requested. +- ("indirect_jump", ""): Expand patterns for branch conversion. +- ("*indirect_jump"): Disable for branch conversion using out of +- line thunks. +- ("indirect_jump_via_thunk_z10") +- ("indirect_jump_via_thunk") +- ("indirect_jump_via_inlinethunk_z10") +- ("indirect_jump_via_inlinethunk", "*casesi_jump") +- ("casesi_jump_via_thunk_z10", "casesi_jump_via_thunk") +- ("casesi_jump_via_inlinethunk_z10") +- ("casesi_jump_via_inlinethunk", "*basr_via_thunk_z10") +- ("*basr_via_thunk", "*basr_r_via_thunk_z10") +- ("*basr_r_via_thunk", "return_prez10"): New pattern. +- ("*indirect2_jump"): Disable for branch conversion. +- ("casesi_jump"): Turn into expander and expand patterns for branch +- conversion. +- ("return_use"): New expander. +- ("*return"): Emit return via thunk and rename it to ... +- ("*return"): ... this one. +- * config/s390/s390.opt: Add new options and and enum for the +- option values. +- +-2018-02-08 Richard Biener +- +- PR tree-optimization/84233 +- * tree-ssa-phiprop.c (propagate_with_phi): Use separate +- changed flag instead of boguously re-using phi_inserted. +- +-2018-02-07 Bill Schmidt +- +- Backport from mainline +- 2018-02-06 Bill Schmidt +- +- * config/rs6000/rs6000.c (rs6000_option_override_internal): +- Display warning message for -mno-speculate-indirect-jumps. +- +-2018-02-05 Rainer Orth +- +- Backport from mainline +- 2018-01-30 Rainer Orth +- +- PR bootstrap/84017 +- * configure.ac (gcc_cv_as_shf_merge): Disable on Solaris 10/x86. +- * configure: Regenerate. +- +-2018-02-05 Peter Bergner +- +- Back port from mainline +- 2018-02-01 Peter Bergner +- +- PR target/56010 +- PR target/83743 +- * config/rs6000/driver-rs6000.c: #include "diagnostic.h". +- #include "opts.h". +- (rs6000_supported_cpu_names): New static variable. +- (linux_cpu_translation_table): Likewise. +- (elf_platform) : Define new static variable and use it. +- Translate kernel AT_PLATFORM name to canonical name if needed. +- Error if platform name is unknown. +- +-2018-02-02 H.J. Lu +- +- Backport from mainline +- 2018-02-02 H.J. Lu +- +- * config/i386/i386.c (ix86_output_function_return): Pass +- INVALID_REGNUM, instead of -1, as invalid register number to +- indirect_thunk_name and output_indirect_thunk. +- +-2018-02-01 Uros Bizjak +- +- Backport from mainline +- 2018-01-31 Uros Bizjak +- +- PR rtl-optimization/84123 +- * combine.c (change_zero_ext): Check if hard register satisfies +- can_change_dest_mode before calling gen_lowpart_SUBREG. +- +-2018-02-01 Renlin Li +- +- Backport from mainline +- 2018-02-01 Renlin Li +- +- PR target/83370 +- * config/aarch64/aarch64.c (aarch64_class_max_nregs): Handle +- TAILCALL_ADDR_REGS. +- (aarch64_register_move_cost): Likewise. +- * config/aarch64/aarch64.h (reg_class): Rename CALLER_SAVE_REGS to +- TAILCALL_ADDR_REGS. +- (REG_CLASS_NAMES): Likewise. +- (REG_CLASS_CONTENTS): Rename CALLER_SAVE_REGS to +- TAILCALL_ADDR_REGS. Remove IP registers. +- * config/aarch64/aarch64.md (Ucs): Update register constraint. +- +-2018-02-01 Richard Biener +- +- Backport from mainline +- 2017-11-02 Richard Biener +- +- PR tree-optimization/82795 +- * tree-if-conv.c (predicate_mem_writes): Remove bogus assert. +- +-2018-01-31 Richard Biener +- Kelvin Nilsen +- +- Backport from mainline +- 2018-01-29 Richard Biener +- Kelvin Nilsen +- +- PR bootstrap/80867 +- * tree-vect-stmts.c (vectorizable_call): Don't call +- targetm.vectorize_builtin_md_vectorized_function if callee is +- NULL. +- +-2018-01-31 Eric Botcazou +- +- PR rtl-optimization/84071 +- * doc/tm.texi.in (WORD_REGISTER_OPERATIONS): Add explicit case. +- * doc/tm.texi: Regenerate. +- +-2018-01-31 Eric Botcazou +- +- PR rtl-optimization/84071 +- * combine.c (record_dead_and_set_regs_1): Record the source unmodified +- for a paradoxical SUBREG on a WORD_REGISTER_OPERATIONS target. +- +-2018-01-29 Joseph Myers +- +- Backport from mainline +- 2018-01-24 Joseph Myers +- +- PR target/68467 +- * config/m68k/m68k.c (m68k_promote_function_mode): New function. +- (TARGET_PROMOTE_FUNCTION_MODE): New macro. +- +-2018-01-29 Uros Bizjak +- +- Backport from mainline +- 2018-01-26 Uros Bizjak +- +- PR target/81763 +- * config/i386/i386.md (*andndi3_doubleword): Add earlyclobber +- to (=3D&r,r,rm) alternative. Add (=3Dr,0,rm) and (=3Dr,r,0) alternatives. +- +-2018-01-29 Alan Modra +- +- Backport from mainline +- 2018-01-26 Alan Modra +- PR target/84033 +- * config/rs6000/rs6000.c (rtx_is_swappable_p): Exclude +- UNSPEC_VBPERMQ. +- +-2018-01-27 H.J. Lu +- +- Backport from mainline +- 2018-01-27 H.J. Lu +- +- * doc/invoke.texi: Replace -mfunction-return=3D=3D@var{choice} with +- -mfunction-return=3D@var{choice}. +- +-2018-01-27 H.J. Lu +- +- Backport from mainline +- 2018-01-23 H.J. Lu +- +- PR target/83905 +- * config/i386/i386.c (ix86_expand_prologue): Use cost reference +- of struct ix86_frame. +- (ix86_expand_epilogue): Likewise. Add a local variable for +- the reg_save_offset field in struct ix86_frame. +- +-2018-01-26 Jakub Jelinek +- +- PR rtl-optimization/83985 +- * dce.c (deletable_insn_p): Return false for separate shrink wrapping +- REG_CFA_RESTORE insns. +- (delete_unmarked_insns): Don't ignore separate shrink wrapping +- REG_CFA_RESTORE insns here. +- +-2018-01-25 Uros Bizjak +- +- Backport from mainline +- 2018-01-17 Uros Bizjak +- +- * config/i386/i386.c (indirect_thunk_name): Declare regno +- as unsigned int. Compare regno with INVALID_REGNUM. +- (output_indirect_thunk): Ditto. +- (output_indirect_thunk_function): Ditto. +- (ix86_code_end): Declare regno as unsigned int. Use INVALID_REGNUM +- in the call to output_indirect_thunk_function. +- +-2018-01-25 Michael Meissner +- +- Back port from trunk +- 2018-01-22 Michael Meissner +- +- PR target/83862 +- * config/rs6000/rs6000-protos.h (rs6000_split_signbit): Delete, +- no longer used. +- * config/rs6000/rs6000.c (rs6000_split_signbit): Likewise. +- * config/rs6000/rs6000.md (signbit2): Change code for IEEE +- 128-bit to produce an UNSPEC move to get the double word with the +- signbit and then a shift directly to do signbit. +- (signbit2_dm): Replace old IEEE 128-bit signbit +- implementation with a new version that just does either a direct +- move or a regular move. Move memory interface to separate insns. +- Move insns so they are next to the expander. +- (signbit2_dm_mem_be): New combiner insns to combine load +- with signbit move. Split big and little endian case. +- (signbit2_dm_mem_le): Likewise. +- (signbit2_dm_ext): Delete, no longer used. +- (signbit2_dm2): Likewise. +- +-2018-01-25 Peter Bergner +- +- Back port from mainline +- 2018-01-10 Peter Bergner +- +- PR target/83399 +- * config/rs6000/rs6000.c (print_operand) <'y'>: Use +- VECTOR_MEM_ALTIVEC_OR_VSX_P. +- * config/rs6000/vsx.md (*vsx_le_perm_load_ for VSX_D): Use +- indexed_or_indirect_operand predicate. +- (*vsx_le_perm_load_ for VSX_W): Likewise. +- (*vsx_le_perm_load_v8hi): Likewise. +- (*vsx_le_perm_load_v16qi): Likewise. +- (*vsx_le_perm_store_ for VSX_D): Likewise. +- (*vsx_le_perm_store_ for VSX_W): Likewise. +- (*vsx_le_perm_store_v8hi): Likewise. +- (*vsx_le_perm_store_v16qi): Likewise. +- (eight unnamed splitters): Likewise. +- +-2018-01-25 Bill Schmidt +- +- Backport from mainline +- 2018-01-02 Bill Schmidt +- +- * config/rs6000/rs6000-p8swap.c (swap_feeds_both_load_and_store): +- New function. +- (rs6000_analyze_swaps): Mark a web unoptimizable if it contains a +- swap associated with both a load and a store. +- +-2018-01-25 Richard Biener +- +- * BASE-VER: Increment to 7.3.1. +- +-2018-01-25 Release Manager +- +- * GCC 7.3.0 released. +- +-2018-01-23 Eric Botcazou +- +- PR rtl-optimization/81443 +- * rtlanal.c (num_sign_bit_copies1) : Do not propagate results +- from inner REGs to paradoxical SUBREGs. +- +-2018-01-21 Bill Schmidt +- +- Backport from mainline +- 2018-01-21 Bill Schmidt +- David Edelsohn +- +- PR target/83946 +- * config/rs6000/rs6000.md (*call_indirect_nonlocal_sysv): +- Change "crset eq" to "crset 2". +- (*call_value_indirect_nonlocal_sysv): Likewise. +- (*call_indirect_aix_nospec): Likewise. +- (*call_value_indirect_aix_nospec): Likewise. +- (*call_indirect_elfv2_nospec): Likewise. +- (*call_value_indirect_elfv2_nospec): Likewise. +- (*sibcall_nonlocal_sysv): Change "crset eq" to "crset 2"; +- change assembly output from . to $. +- (*sibcall_value_nonlocal_sysv): Likewise. +- (indirect_jump_nospec): Change assembly output from . to $. +- (*tablejump_internal1_nospec): Likewise. +- +-2018-01-21 Oleg Endo +- +- Backport from mainline +- 2018-01-21 Oleg Endo +- +- PR target/80870 +- * config/sh/sh_optimize_sett_clrt.cc: +- Use INCLUDE_ALGORITHM and INCLUDE_VECTOR instead of direct includes. +- +-2018-01-17 Bill Schmidt +- +- Backport from mainline +- 2018-01-16 Bill Schmidt +- +- * config/rs6000/rs6000.c (rs6000_opt_vars): Add entry for +- -mspeculate-indirect-jumps. +- * config/rs6000/rs6000.md (*call_indirect_elfv2): Disable +- for -mno-speculate-indirect-jumps. +- (*call_indirect_elfv2_nospec): New define_insn. +- (*call_value_indirect_elfv2): Disable for +- -mno-speculate-indirect-jumps. +- (*call_value_indirect_elfv2_nospec): New define_insn. +- (indirect_jump): Emit different RTL for +- -mno-speculate-indirect-jumps. +- (*indirect_jump): Disable for +- -mno-speculate-indirect-jumps. +- (*indirect_jump_nospec): New define_insn. +- (tablejump): Emit different RTL for +- -mno-speculate-indirect-jumps. +- (tablejumpsi): Disable for -mno-speculate-indirect-jumps. +- (tablejumpsi_nospec): New define_expand. +- (tablejumpdi): Disable for -mno-speculate-indirect-jumps. +- (tablejumpdi_nospec): New define_expand. +- (*tablejump_internal1): Disable for +- -mno-speculate-indirect-jumps. +- (*tablejump_internal1_nospec): New define_insn. +- * config/rs6000/rs6000.opt (mspeculate-indirect-jumps): New +- option. +- +- Backport from mainline +- 2018-01-17 Bill Schmidt +- +- * config/rs6000/rs6000.md (*call_indirect_nonlocal_sysv): +- Generate different code for -mno-speculate-indirect-jumps. +- (*call_value_indirect_nonlocal_sysv): Likewise. +- (*call_indirect_aix): Disable for +- -mno-speculate-indirect-jumps. +- (*call_indirect_aix_nospec): New define_insn. +- (*call_value_indirect_aix): Disable for +- -mno-speculate-indirect-jumps. +- (*call_value_indirect_aix_nospec): New define_insn. +- (*sibcall_nonlocal_sysv): Generate different code for +- -mno-speculate-indirect-jumps. +- (*sibcall_value_nonlocal_sysv): Likewise. +- +-2018-01-17 Richard Biener +- +- Backport from mainline +- 2017-12-18 Richard Biener +- +- PR tree-optimization/81877 +- * tree-ssa-loop-im.c (ref_indep_loop_p): Remove safelen parameters. +- (outermost_indep_loop): Adjust. +- (ref_indep_loop_p_1): Likewise. Remove safelen handling again. +- (can_sm_ref_p): Adjust. +- +- 2017-12-08 Richard Biener +- +- PR middle-end/81782 +- * tree-ssa-uninit.c (warn_uninitialized_vars): Properly +- handle accesses outside of zero-sized vars. +- +-2018-01-17 Kyrylo Tkachov +- +- Backport from mailine +- 2018-01-15 Kyrylo Tkachov +- +- PR target/83687 +- * config/arm/iterators.md (VF): New mode iterator. +- * config/arm/neon.md (neon_vabd_2): Use the above. +- Remove integer-related logic from pattern. +- (neon_vabd_3): Likewise. +- +-2018-01-17 Martin Liska +- +- Backport from mainline +- 2018-01-04 Martin Liska +- +- PR ipa/82352 +- * ipa-icf.c (sem_function::merge): Do not cross comdat boundary. +- +-2018-01-17 Martin Liska +- +- Backport from mainline +- 2018-01-03 Martin Liska +- +- PR ipa/83549 +- * cif-code.def (VARIADIC_THUNK): New enum value. +- * ipa-inline-analysis.c (compute_inline_parameters): +- Do not inline variadic thunks. +- +-2018-01-17 Martin Liska +- +- Backport from mainline +- 2017-12-27 Martin Liska +- +- PR tree-optimization/83552 +- * tree-ssa-strlen.c (fold_strstr_to_strncmp): Assign result +- of get_string_lenth to a SSA_NAME if not a GIMPLE value. +- +-2018-01-16 Segher Boessenkool +- +- Backport from mainline +- 2017-12-18 Segher Boessenkool +- +- PR rtl-optimization/83424 +- * rtlanal.c (dead_or_set_regno_p): Handle CLOBBER just like SET. +- +-2018-01-16 H.J. Lu +- +- * config/i386/i386.c (ix86_expand_prologue): Don't use reference +- of struct ix86_frame. +- (ix86_expand_epilogue): Likewise. +- +-2018-01-16 H.J. Lu +- +- Backport from mainline +- 2018-01-14 H.J. Lu +- +- * config/i386/i386.c (ix86_set_indirect_branch_type): Disallow +- -mcmodel=3Dlarge with -mindirect-branch=3Dthunk, +- -mindirect-branch=3Dthunk-extern, -mfunction-return=3Dthunk and +- -mfunction-return=3Dthunk-extern. +- * doc/invoke.texi: Document -mcmodel=3Dlarge is incompatible with +- -mindirect-branch=3Dthunk, -mindirect-branch=3Dthunk-extern, +- -mfunction-return=3Dthunk and -mfunction-return=3Dthunk-extern. +- +-2018-01-16 H.J. Lu +- +- Backport from mainline +- 2018-01-14 H.J. Lu +- +- * config/i386/i386.c (print_reg): Print the name of the full +- integer register without '%'. +- (ix86_print_operand): Handle 'V'. +- * doc/extend.texi: Document 'V' modifier. +- +-2018-01-16 H.J. Lu +- +- Backport from mainline +- 2018-01-15 H.J. Lu +- +- * config/i386/predicates.md (indirect_branch_operand): Rewrite +- ix86_indirect_branch_register logic. +- +- Backport from mainline +- 2018-01-15 H.J. Lu +- +- * config/i386/constraints.md (Bs): Update +- ix86_indirect_branch_register check. Don't check +- ix86_indirect_branch_register with GOT_memory_operand. +- (Bw): Likewise. +- * config/i386/predicates.md (GOT_memory_operand): Don't check +- ix86_indirect_branch_register here. +- (GOT32_symbol_operand): Likewise. +- +- Backport from mainline +- 2018-01-15 H.J. Lu +- +- * config/i386/predicates.md (constant_call_address_operand): +- Rewrite ix86_indirect_branch_register logic. +- (sibcall_insn_operand): Likewise. +- +- Backport from mainline +- 2018-01-15 H.J. Lu +- +- * config/i386/constraints.md (Bs): Replace +- ix86_indirect_branch_thunk_register with +- ix86_indirect_branch_register. +- (Bw): Likewise. +- * config/i386/i386.md (indirect_jump): Likewise. +- (tablejump): Likewise. +- (*sibcall_memory): Likewise. +- (*sibcall_value_memory): Likewise. +- Peepholes of indirect call and jump via memory: Likewise. +- * config/i386/i386.opt: Likewise. +- * config/i386/predicates.md (indirect_branch_operand): Likewise. +- (GOT_memory_operand): Likewise. +- (call_insn_operand): Likewise. +- (sibcall_insn_operand): Likewise. +- (GOT32_symbol_operand): Likewise. +- +- Backport from mainline +- 2018-01-14 H.J. Lu +- +- * config/i386/constraints.md (Bs): Disallow memory operand for +- -mindirect-branch-register. +- (Bw): Likewise. +- * config/i386/predicates.md (indirect_branch_operand): Likewise. +- (GOT_memory_operand): Likewise. +- (call_insn_operand): Likewise. +- (sibcall_insn_operand): Likewise. +- (GOT32_symbol_operand): Likewise. +- * config/i386/i386.md (indirect_jump): Call convert_memory_address +- for -mindirect-branch-register. +- (tablejump): Likewise. +- (*sibcall_memory): Likewise. +- (*sibcall_value_memory): Likewise. +- Disallow peepholes of indirect call and jump via memory for +- -mindirect-branch-register. +- (*call_pop): Replace m with Bw. +- (*call_value_pop): Likewise. +- (*sibcall_pop_memory): Replace m with Bs. +- * config/i386/i386.opt (mindirect-branch-register): New option. +- * doc/invoke.texi: Document -mindirect-branch-register option. +- +-2018-01-16 H.J. Lu +- +- Backport from mainline +- 2018-01-15 H.J. Lu +- +- PR target/83839 +- * config/i386/i386.c (output_indirect_thunk_function): Use +- ASM_OUTPUT_LABEL, instead of ASM_OUTPUT_DEF, for TARGET_MACHO +- for __x86.return_thunk. +- +- Backport from mainline +- 2018-01-14 H.J. Lu +- +- * config/i386/i386-protos.h (ix86_output_function_return): New. +- * config/i386/i386.c (ix86_set_indirect_branch_type): Also +- set function_return_type. +- (indirect_thunk_name): Add ret_p to indicate thunk for function +- return. +- (output_indirect_thunk_function): Pass false to +- indirect_thunk_name. +- (ix86_output_indirect_branch_via_reg): Likewise. +- (ix86_output_indirect_branch_via_push): Likewise. +- (output_indirect_thunk_function): Create alias for function +- return thunk if regno < 0. +- (ix86_output_function_return): New function. +- (ix86_handle_fndecl_attribute): Handle function_return. +- (ix86_attribute_table): Add function_return. +- * config/i386/i386.h (machine_function): Add +- function_return_type. +- * config/i386/i386.md (simple_return_internal): Use +- ix86_output_function_return. +- (simple_return_internal_long): Likewise. +- * config/i386/i386.opt (mfunction-return=3D): New option. +- (indirect_branch): Mention -mfunction-return=3D. +- * doc/extend.texi: Document function_return function attribute. +- * doc/invoke.texi: Document -mfunction-return=3D option. +- +-2018-01-16 H.J. Lu +- +- Backport from mainline +- 2018-01-14 H.J. Lu +- +- * config/i386/i386-opts.h (indirect_branch): New. +- * config/i386/i386-protos.h (ix86_output_indirect_jmp): Likewise. +- * config/i386/i386.c (ix86_using_red_zone): Disallow red-zone +- with local indirect jump when converting indirect call and jump. +- (ix86_set_indirect_branch_type): New. +- (ix86_set_current_function): Call ix86_set_indirect_branch_type. +- (indirectlabelno): New. +- (indirect_thunk_needed): Likewise. +- (indirect_thunk_bnd_needed): Likewise. +- (indirect_thunks_used): Likewise. +- (indirect_thunks_bnd_used): Likewise. +- (INDIRECT_LABEL): Likewise. +- (indirect_thunk_name): Likewise. +- (output_indirect_thunk): Likewise. +- (output_indirect_thunk_function): Likewise. +- (ix86_output_indirect_branch_via_reg): Likewise. +- (ix86_output_indirect_branch_via_push): Likewise. +- (ix86_output_indirect_branch): Likewise. +- (ix86_output_indirect_jmp): Likewise. +- (ix86_code_end): Call output_indirect_thunk_function if needed. +- (ix86_output_call_insn): Call ix86_output_indirect_branch if +- needed. +- (ix86_handle_fndecl_attribute): Handle indirect_branch. +- (ix86_attribute_table): Add indirect_branch. +- * config/i386/i386.h (machine_function): Add indirect_branch_type +- and has_local_indirect_jump. +- * config/i386/i386.md (indirect_jump): Set has_local_indirect_jump +- to true. +- (tablejump): Likewise. +- (*indirect_jump): Use ix86_output_indirect_jmp. +- (*tablejump_1): Likewise. +- (simple_return_indirect_internal): Likewise. +- * config/i386/i386.opt (mindirect-branch=3D): New option. +- (indirect_branch): New. +- (keep): Likewise. +- (thunk): Likewise. +- (thunk-inline): Likewise. +- (thunk-extern): Likewise. +- * doc/extend.texi: Document indirect_branch function attribute. +- * doc/invoke.texi: Document -mindirect-branch=3D option. +- +-2018-01-16 Richard Biener +- +- Backport from mainline +- 2017-09-29 Vladimir Makarov +- +- PR target/81481 +- * ira-costs.c (scan_one_insn): Don't take into account PIC equiv +- with a symbol for LRA. +- +-2018-01-15 Segher Boessenkool +- +- Backport from mainline +- 2018-01-10 Segher Boessenkool +- +- PR target/83629 +- * config/rs6000/rs6000.md (load_toc_v4_PIC_2, load_toc_v4_PIC_3b, +- load_toc_v4_PIC_3c): Wrap const term in CONST RTL. +- +-2018-01-15 H.J. Lu +- +- Backport from mainline +- PR target/83330 +- * config/i386/i386.c (ix86_function_arg_advance): Set +- outgoing_args_on_stack to true if there are outgoing arguments +- on stack. +- (ix86_function_arg): Likewise. +- (ix86_compute_frame_layout): Align stack frame if argument is +- passed on stack. +- * config/i386/i386.h (machine_function): Add +- outgoing_args_on_stack. +- +-2018-01-15 H.J. Lu +- +- Backport from mainline +- * config/i386/i386.c (ix86_expand_prologue): Use reference of +- struct ix86_frame. +- (ix86_expand_epilogue): Likewise. +- +-2018-01-15 H.J. Lu +- +- Backport from mainline +- 2017-11-06 H.J. Lu +- +- * config/i386/i386.c (ix86_can_use_return_insn_p): Use reference +- of struct ix86_frame. +- (ix86_initial_elimination_offset): Likewise. +- (ix86_expand_split_stack_prologue): Likewise. +- +-2018-01-15 H.J. Lu +- +- Backport from mainline +- 2017-06-01 Bernd Edlinger +- +- * config/i386/i386.c (ix86_frame): Moved to ... +- * config/i386/i386.h (ix86_frame): Here. +- (machine_function): Add frame. +- * config/i386/i386.c (ix86_compute_frame_layout): Repace the +- frame argument with &cfun->machine->frame. +- (ix86_can_use_return_insn_p): Don't pass &frame to +- ix86_compute_frame_layout. Copy frame from cfun->machine->frame. +- (ix86_can_eliminate): Likewise. +- (ix86_expand_prologue): Likewise. +- (ix86_expand_epilogue): Likewise. +- (ix86_expand_split_stack_prologue): Likewise. +- +-2018-01-14 Bill Schmidt +- +- Backport from mainline +- 2018-01-08 Bill Schmidt +- +- PR target/83677 +- * config/rs6000/altivec.md (*altivec_vpermr__internal): +- Reverse order of second and third operands in first alternative. +- * config/rs6000/rs6000.c (rs6000_expand_vector_set): Reverse order +- of first and second elements in UNSPEC_VPERMR vector. +- (altivec_expand_vec_perm_le): Likewise. +- +-2018-01-14 Uros Bizjak +- +- Backport from mainline +- 2018-01-12 Uros Bizjak +- +- PR target/83628 +- * config/alpha/alpha.md (*saddsi_1): New insn_ans_split pattern. +- (*saddl_se_1): Ditto. +- (*ssubsi_1): Ditto. +- (*ssubl_se_1): Ditto. +- +- Backport from mainline +- 2018-01-09 Uros Bizjak +- +- PR target/83628 +- * combine.c (force_int_to_mode) : Use mode instead of +- op_mode in the force_to_mode call. +- +-2018-01-12 Oleg Endo +- +- Backport from mainline +- 2018-01-12 Oleg Endo +- +- PR target/81819 +- * config/rx/rx.c (rx_is_restricted_memory_address): +- Handle SUBREG case. +- +-2018-01-12 Eric Botcazou +- +- PR rtl-optimization/83565 +- * rtlanal.c (nonzero_bits1): On WORD_REGISTER_OPERATIONS machines, do +- not extend the result to a larger mode for rotate operations. +- (num_sign_bit_copies1): Likewise. +- +-2018-01-12 Rainer Orth +- +- Backport from mainline +- 2018-01-04 Rainer Orth +- +- PR bootstrap/81926 +- * cgraphunit.c (symbol_table::compile): Switch to text_section +- before calling assembly_start debug hook. +- +-2018-01-11 Oleg Endo +- +- Backport from mainline +- 2018-01-11 Oleg Endo +- +- PR target/81821 +- * config/rx/rx.md (BW): New mode attribute. +- (sync_lock_test_and_setsi): Add mode suffix to insn output. +- +-2018-01-09 Richard Biener +- +- Backport from mainline +- 2018-01-08 Richard Biener +- +- PR middle-end/83713 +- * convert.c (do_narrow): Properly guard TYPE_OVERFLOW_WRAPS checks. +- +-2018-01-08 Jim Wilson +- +- Backport from mainline +- 2018-01-08 Monk Chiang +- Kito Cheng +- +- * config/riscv/riscv.c (machine_function::is_leaf): Remove field. +- (riscv_leaf_function_p): Delete. +- (riscv_function_ok_for_sibcall): Return false when TARGET_SAVE_RESTORE. +- +-2018-01-08 Kyrylo Tkachov +- +- Backport from mainline +- 2017-12-20 Kyrylo Tkachov +- +- PR target/82975 +- * config/arm/arm.h (TEST_REGNO): Adjust comment as expected in r255830. +- +-2018-01-08 Sebastian Huber +- +- Backported from mainline +- 2018-01-05 Sebastian Huber +- +- * config.gcc (epiphany-*-elf*): Add (epiphany-*-rtems*) configuration. +- * config/epiphany/rtems.h: New file. +- +-2018-01-04 Uros Bizjak +- +- PR target/83628 +- * config/alpha/alpha.md (*sadd): Use ASHIFT +- instead of MULT rtx. Update all corresponding splitters. +- (*saddl_se): Ditto. +- (*ssub): Ditto. +- (*ssubl_se): Ditto. +- (*cmp_sadd_di): Update split patterns. +- (*cmp_sadd_si): Ditto. +- (*cmp_sadd_sidi): Ditto. +- (*cmp_ssub_di): Ditto. +- (*cmp_ssub_si): Ditto. +- (*cmp_ssub_sidi): Ditto. +- * config/alpha/predicates.md (const23_operand): New predicate. +- * config/alpha/alpha.c (alpha_rtx_costs) [PLUS, MINUS]: +- Look for ASHIFT, not MULT inner operand. +- (alpha_split_conditional_move): Update for *sadd change. +- +-2018-01-02 Andrew Waterman +- +- * config/riscv/linux.h (ICACHE_FLUSH_FUNC): New. +- * config/riscv/riscv.md (clear_cache): Use it. +- +-2018-01-01 Jakub Jelinek +- +- PR middle-end/83608 +- * expr.c (store_expr_with_bounds): Use simplify_gen_subreg instead of +- convert_modes if target mode has the right side, but different mode +- class. +- +- PR middle-end/83609 +- * expr.c (expand_assignment): Fix up a typo in simplify_gen_subreg +- last argument when extracting from CONCAT. If either from_real or +- from_imag is NULL, use expansion through memory. If result is not +- a CONCAT and simplify_gen_subreg fails, try to simplify_gen_subreg +- the parts directly to inner mode, if even that fails, use expansion +- through memory. +- +- PR middle-end/83623 +- * expmed.c (expand_shift_1): For 2-byte rotates by BITS_PER_UNIT, +- check for bswap in mode rather than HImode and use that in expand_unop +- too. +- +-2017-12-23 Jakub Jelinek +- +- PR c++/83553 +- * fold-const.c (struct contains_label_data): New type. +- (contains_label_1): Return non-NULL even for CASE_LABEL_EXPR, unless +- inside of a SWITCH_BODY seen during the walk. +- (contains_label_p): Use walk_tree instead of +- walk_tree_without_duplicates, prepare data for contains_label_1 and +- provide own pset. +- +-2017-12-22 Martin Jambor +- +- PR lto/82027 +- * lto-cgraph.c (output_cgraph_opt_summary_p): Also check former +- clones. +- +-2017-12-22 Jakub Jelinek +- +- Backported from mainline +- 2017-12-21 Jakub Jelinek +- +- PR c/83448 +- * gimple-ssa-sprintf.c (maybe_warn): Don't call set_caret_index +- if navail is >=3D dir.len. +- +- PR rtl-optimization/80747 +- PR rtl-optimization/83512 +- * cfgrtl.c (force_nonfallthru_and_redirect): When splitting +- succ edge from ENTRY, copy partition from e->dest to the newly +- created bb. +- * bb-reorder.c (reorder_basic_blocks_simple): If last_tail is +- ENTRY, use BB_PARTITION of its successor block as current_partition. +- Don't copy partition when splitting succ edge from ENTRY. +- +- PR tree-optimization/83523 +- * tree-ssa-math-opts.c (is_widening_mult_p): Return false if +- for INTEGER_TYPE TYPE_OVERFLOW_TRAPS. +- (convert_mult_to_fma): Likewise. +- +- PR tree-optimization/83521 +- * tree-ssa-phiopt.c (factor_out_conditional_conversion): Use +- gimple_build_assign without code on result of +- fold_build1 (VIEW_CONVERT_EXPR, ...), as it might not create +- a VIEW_CONVERT_EXPR. +- +- 2017-12-19 Jakub Jelinek +- +- PR ipa/82801 +- PR ipa/83346 +- * ipa-inline.c (flatten_remove_node_hook): New function. +- (ipa_inline): Keep only nodes with flatten attribute at the end of +- the array in the order from ipa_reverse_postorder, only walk that +- portion of array for flattening, if there is more than one such +- node, temporarily register a removal hook and ignore removed nodes. +- +-2017-12-21 Uros Bizjak +- +- PR target/83467 +- * config/i386/i386.md (*ashl3_mask): Add operand +- constraints to operand 2. +- (*3_mask): Ditto. +- (*3_mask): Ditto. +- +-2017-12-19 Bin Cheng +- +- Backport from mainline +- 2017-11-15 Bin Cheng +- +- PR tree-optimization/82726 +- PR tree-optimization/70754 +- * tree-predcom.c (order_drefs_by_pos): New function. +- (combine_chains): Move code setting has_max_use_after to... +- (try_combine_chains): ...here. New parameter. Sort combined chains +- according to position information. +- (tree_predictive_commoning_loop): Update call to above function. +- (update_pos_for_combined_chains, pcom_stmt_dominates_stmt_p): New. +- +- 2017-11-15 Bin Cheng +- +- PR tree-optimization/82726 +- Revert +- 2017-01-23 Bin Cheng +- +- PR tree-optimization/70754 +- * tree-predcom.c (stmt_combining_refs): New parameter INSERT_BEFORE. +- (reassociate_to_the_same_stmt): New parameter INSERT_BEFORE. Insert +- combined stmt before it if not NULL. +- (combine_chains): Process refs reversely and compute dominance point +- for root ref. +- +- Revert +- 2017-02-23 Bin Cheng +- +- PR tree-optimization/79663 +- * tree-predcom.c (combine_chains): Process refs in reverse order +- only for ZERO length chains, and add explaining comment. +- +-2017-12-19 Sebastian Huber +- +- Backport from mainline +- 2017-12-19 Sebastian Huber +- +- PR target/83387 +- * config/rs6000/t-rtems (MULTILIB_REQUIRED): Remove 64-bit soft-float +- multilib. +- +-2017-12-19 Daniel Cederman +- +- Backport from mainline +- 2017-12-19 Daniel Cederman +- +- * config/sparc/sparc.c (sparc_do_work_around_errata): Make sure +- the jump is to a label. +- +-2017-12-17 John David Anglin +- +- Backport from mainline +- 2017-12-03 John David Anglin +- +- * config/pa/pa.c (pa_legitimate_address_p): For scaled indexing, +- require base operand is a REG_POINTER prior to reload on targets +- with non-equivalent space registers. +- +-2017-12-15 Jakub Jelinek +- +- PR tree-optimization/83269 +- * fold-const.c (fold_binary_loc): Perform (-A) - B -> (-B) - A +- subtraction in arg0's type if type is signed and arg0 is unsigned. +- Formatting fix. +- +- Backported from mainline +- 2017-12-14 Jakub Jelinek +- +- PR tree-optimization/83198 +- * gimple-ssa-sprintf.c (format_floating): Set type solely based on +- dir.modifier, regardless of TREE_TYPE (arg). Assume non-REAL_CST +- value if arg is a REAL_CST with incompatible type. +- +- 2017-12-12 Jakub Jelinek +- +- PR tree-optimization/80631 +- * tree-vect-loop.c (get_initial_def_for_reduction): Fix comment typo. +- (vect_create_epilog_for_reduction): Add INDUC_VAL argument, for +- INTEGER_INDUC_COND_REDUCTION use INDUC_VAL instead of +- hardcoding zero as the value if COND_EXPR is never true. For +- INTEGER_INDUC_COND_REDUCTION don't emit the final COND_EXPR if +- INDUC_VAL is equal to INITIAL_DEF. +- (vectorizable_reduction): Compute INDUC_VAL for +- vect_create_epilog_for_reduction, if no value is suitable, don't +- use INTEGER_INDUC_COND_REDUCTION for now. Formatting fixes. +- +- 2017-12-08 Joseph Myers +- Alexander Monakov +- Jakub Jelinek +- +- PR target/81906 +- * config/i386/i386.c (ix86_expand_rint): Handle flag_rounding_math. +- +- 2017-12-02 Jakub Jelinek +- +- PR c++/81212 +- * tree-cfg.c (pass_warn_function_return::execute): Handle +- __builtin_ubsan_handle_missing_return like __builtin_unreachable +- with BUILTINS_LOCATION. +- +- PR target/78643 +- PR target/80583 +- * expr.c (get_inner_reference): If DECL_MODE of a non-bitfield +- is BLKmode for vector field with vector raw mode, use TYPE_MODE +- instead of DECL_MODE. +- +- 2017-11-29 Jakub Jelinek +- +- PR target/80819 +- * config/i386/sse.md (vec_concatv2di): Remove * from (=3DYr,0,*rm) +- alternative. +- +- 2017-11-25 Jakub Jelinek +- +- PR rtl-optimization/81553 +- * combine.c (simplify_if_then_else): In (if_then_else COND (OP Z C1) Z) +- to (OP Z (mult COND (C1 * STORE_FLAG_VALUE))) optimization, if OP +- is a shift where C1 has different mode than the whole shift, use C1's +- mode for MULT rather than the shift's mode. +- +- 2017-11-24 Jakub Jelinek +- +- PR sanitizer/83014 +- * ubsan.c (ubsan_type_descriptor): Use pp_unsigned_wide_integer +- instead of pp_printf with HOST_WIDE_INT_PRINT_DEC. Avoid calling +- tree_to_uhwi twice. +- +- * tree-object-size.c (pass_through_call): Do not handle +- BUILT_IN_STPNCPY_CHK which is not a pass through call. +- +- 2017-11-23 Jakub Jelinek +- +- PR middle-end/82253 +- * expr.c (expand_assignment): For CONCAT to_rtx, complex type from and +- bitpos/bitsize covering the whole destination, use store_expr only if +- the complex mode is the same. Otherwise, use expand_normal and if +- it returns CONCAT, subreg each part separately instead of trying to +- subreg the whole result. +- +- 2017-11-22 Jakub Jelinek +- +- PR debug/83084 +- * valtrack.c (propagate_for_debug_subst, propagate_for_debug): Reset +- debug insns if they would contain UNSPEC_VOLATILE or volatile asm. +- (dead_debug_insert_temp): Likewise, but also ignore even non-volatile +- asm. +- +- 2017-11-21 James Cowgill +- Jakub Jelinek +- +- PR target/82880 +- * config/mips/frame-header-opt.c (mips_register_frame_header_opt): +- Remove static keyword from f variable. +- +-2017-12-15 Richard Biener +- +- PR bootstrap/83439 +- * tree-ssa-pre.c (eliminate_dom_walker::before_dom_children): +- Adjust remaining gimple_set_modified to use the modified +- variable instead. +- +-2017-12-15 Eric Botcazou +- +- PR target/66488 +- * ggc-page.c (HOST_BITS_PER_PTR): Do not define here... +- * hwint.h (HOST_BITS_PER_PTR): ...but here instead. +- * config/i386/xm-mingw32.h (HOST_BITS_PER_PTR): Delete. +- +-2017-12-15 Richard Biener +- +- Backport from mainline +- PR tree-optimization/82060 +- * tree-ssa-pre.c (eliminate_dom_walker::before_dom_children): +- Move devirtualization after stmt folding and before EH/AB/noreturn +- cleanup to get the stmt refs canonicalized. Use a bool instead +- of gimple_modified_p since that doesn't work for NOPs. Schedule +- NOPs generated by folding for removal. +- +-2017-12-15 Richard Biener +- +- Backport from mainline +- 2017-09-05 Richard Biener +- +- PR tree-optimization/82102 +- * tree-ssa-pre.c (eliminate): Check if lhs is NULL. +- +- 2017-09-13 Richard Biener +- +- PR middle-end/82128 +- * gimple-fold.c (gimple_fold_call): Update SSA name in-place to +- default-def to avoid breaking iterator update with the weird +- interaction with cgraph_update_edges_for_call_stmt_node. +- +-2017-12-15 Richard Biener +- +- Backport from mainline +- 2017-11-24 Richard Biener +- +- PR tree-optimization/82402 +- * tree-vect-loop-manip.c (create_lcssa_for_virtual_phi): Properly +- set SSA_NAME_OCCURS_IN_ABNORMAL_PHI. +- +- 2017-10-24 Richard Biener +- +- PR tree-optimization/82697 +- * tree-ssa-phiopt.c (cond_store_replacement): Use alias-set +- zero for conditional load and unconditional store. +- +- 2017-11-02 Richard Biener +- +- PR middle-end/82765 +- * varasm.c (decode_addr_const): Make offset HOST_WIDE_INT. +- Truncate ARRAY_REF index and element size. +- +- 2017-11-09 Richard Biener +- +- PR tree-optimization/82902 +- * tree-ssa-phiprop.c (propagate_with_phi): Test proper type. +- +-2017-12-14 Peter Bergner +- +- Backport from mainline +- 2017-10-02 Peter Bergner +- +- PR target/80210 +- * config/rs6000/rs6000.c (rs6000_option_override_internal): Rewrite +- function to not use the have_cpu variable. Do not set cpu_index, +- rs6000_cpu_index or rs6000_tune_index if we end up using TARGET_DEFAULT +- or the default cpu. +- (rs6000_valid_attribute_p): Remove duplicate initializations of +- old_optimize and func_optimize. +- (rs6000_pragma_target_parse): Call rs6000_activate_target_options (). +- (rs6000_activate_target_options): Make global. +- * config/rs6000/rs6000-protos.h (rs6000_activate_target_options): Add +- prototype. +- +-2017-12-13 Peter Bergner +- +- Backport from mainline +- 2017-12-13 Peter Bergner +- +- * config/rs6000/ppc-auxv.h (PPC_FEATURE2_HTM_NO_SUSPEND): New define. +- * config/rs6000/rs6000.c (cpu_supports_info): Use it. +- +-2017-12-11 Michael Meissner +- +- Back port from trunk +- 2017-12-01 Michael Meissner +- +- PR target/81959 +- * config/rs6000/rs6000.c (rs6000_address_for_fpconvert): Check for +- whether we can allocate pseudos before trying to fix an address. +- * config/rs6000/rs6000.md (float_si2_hw): Make sure the +- memory address is indexed or indirect. +- (floatuns_si2_hw2): Likewise. +- +-2017-12-11 Sudakshina Das +- +- Backported from trunk +- 2017-12-01 Sudakshina Das +- +- * config/arm/vfp.md (*movhf_vfp_fp16): Add conds attribute. +- +-2017-12-07 Kelvin Nilsen +- +- Backport from trunk +- 2017-05-08 Kelvin Nilsen +- +- PR target/80101 +- * config/rs6000/power6.md: Replace store_data_bypass_p calls with +- rs6000_store_data_bypass_p in seven define_bypass directives and +- in several comments. +- * config/rs6000/rs6000-protos.h: Add prototype for +- rs6000_store_data_bypass_p function. +- * config/rs6000/rs6000.c (rs6000_store_data_bypass_p): New +- function implements slightly different (rs6000-specific) semantics +- than store_data_bypass_p, returning false rather than aborting +- with assertion error when arguments do not satisfy the +- requirements of store data bypass. +- (rs6000_adjust_cost): Replace six calls of store_data_bypass_p with +- rs6000_store_data_bypass_p. +- +-2017-12-06 Eric Botcazou +- +- Revert +- 2017-11-29 Martin Aberg +- +- * config/sparc/sparc.md (divdf3_fix): Add NOP and adjust length +- to prevent b2bst errata sequence. +- (sqrtdf2_fix): Likewise. +- +-2017-12-05 Max Filippov +- +- Backport from mainline +- 2017-12-05 Max Filippov +- * config/xtensa/xtensa.c (xtensa_asan_shadow_offset): New +- function. +- (TARGET_ASAN_SHADOW_OFFSET): New macro definition. +- * config/xtensa/xtensa.h (FRAME_GROWS_DOWNWARD): Set to 1 if +- ASAN is enabled. +- +-2017-12-05 Max Filippov +- +- Backport from mainline +- 2017-05-08 Max Filippov +- * config/xtensa/xtensa-protos.h +- (xtensa_initial_elimination_offset): New declaration. +- * config/xtensa/xtensa.c (xtensa_initial_elimination_offset): +- New function. Move its body from the INITIAL_ELIMINATION_OFFSET +- macro definition, add case for FRAME_POINTER_REGNUM when +- FRAME_GROWS_DOWNWARD. +- * config/xtensa/xtensa.h (FRAME_GROWS_DOWNWARD): New macro +- definition. +- (INITIAL_ELIMINATION_OFFSET): Replace body with call to +- xtensa_initial_elimination_offset. +- +-2017-12-04 Eric Botcazou +- +- * config/sparc/sparc.c (sparc_do_work_around_errata): Use mem_ref +- instead of MEM_P in a couple more places. Fix formatting issues. +- +-2017-12-04 Sebastian Peryt +- H.J. Lu +- +- Bakcported from trunk +- PR target/82941 +- PR target/82942 +- PR target/82990 +- * config/i386/i386.c (pass_insert_vzeroupper): Remove +- TARGET_AVX512F check from gate condition. +- (ix86_check_avx256_register): Changed to ... +- (ix86_check_avx_upper_register): ... this. Add extra check for +- VALID_AVX512F_REG_OR_XI_MODE. +- (ix86_avx_u128_mode_needed): Changed +- ix86_check_avx256_register to ix86_check_avx_upper_register. +- (ix86_check_avx256_stores): Changed to ... +- (ix86_check_avx_upper_stores): ... this. Changed +- ix86_check_avx256_register to ix86_check_avx_upper_register. +- (ix86_avx_u128_mode_after): Changed +- avx_reg256_found to avx_upper_reg_found. Changed +- ix86_check_avx256_stores to ix86_check_avx_upper_stores. +- (ix86_avx_u128_mode_entry): Changed +- ix86_check_avx256_register to ix86_check_avx_upper_register. +- (ix86_avx_u128_mode_exit): Ditto. +- (ix86_option_override_internal): Set MASK_VZEROUPPER if +- neither -mzeroupper nor -mno-zeroupper is used and +- TARGET_EMIT_VZEROUPPER is set. +- * config/i386/i386.h: (host_detect_local_cpu): New define. +- (TARGET_EMIT_VZEROUPPER): New. +- * config/i386/x86-tune.def: Add X86_TUNE_EMIT_VZEROUPPER +- +-2017-12-01 Segher Boessenkool +- +- Backport from mainline +- 2017-11-28 Segher Boessenkool +- +- PR 81288/target +- * config/rs6000/rs6000.c (rs6000_rtx_costs): Do not handle +- TARGET_ISEL && !TARGET_MFCRF differently. Simplify code. +- +-2017-11-30 Jim Wilson +- +- Backport from mainline +- 2017-11-30 Jim Wilson +- * doc/invoke.texi (RISC-V Options): Delete nonexistent -mmemcpy and +- -mno-memcpy options. For -mplt, -mfdiv, -mdiv, -msave-restore, and +- -mstrict-align, add info on default value. Delete redundant lines for +- -mabi. Add missing -mexplicit-relocs docs. +- +- Backport from mainline +- 2017-11-01 Palmer Dabbelt +- * doc/invoke.texi (RISC-V Options): Use "@minus{}2 GB", not "-2 GB". +- * doc/invoke.texi (RISC-V Options): Explicitly name the medlow +- and medany code models, and describe what they do. +- +- 2017-10-27 Palmer Dabbelt +- PR target/82717 +- * doc/invoke.texi (RISC-V) <-mabi>: Correct and improve. +- +-2017-11-29 Martin Jambor +- +- PR ipa/82808 +- * tree.c (expr_type_first_operand_type_p): New function. +- * tree.h (expr_type_first_operand_type_p): Declare it. +- * ipa-cp.c (ipa_get_jf_pass_through_result): Use it. +- +-2017-11-29 Daniel Cederman +- +- * config/sparc/sparc.c (sparc_do_work_around_errata): Treat the +- movsi_pic_gotdata_op instruction as a load for the UT699 errata +- workaround. +- +-2017-11-29 Martin Aberg +- +- * config/sparc/sparc.md (divdf3_fix): Add NOP and adjust length +- to prevent b2bst errata sequence. +- (sqrtdf2_fix): Likewise. +- +-2017-11-29 Daniel Cederman +- +- * config/sparc/sparc.c (fpop_reg_depend_p): New function. +- (div_sqrt_insn_p): New function. +- (sparc_do_work_around_errata): Insert NOP instructions to +- prevent sequences that could trigger the TN-0013 errata for +- certain LEON3 processors. +- (pass_work_around_errata::gate): Also test sparc_fix_lost_divsqrt. +- (sparc_option_override): Set sparc_fix_lost_divsqrt appropriately. +- * config/sparc/sparc.md (fix_lost_divsqrt): New attribute. +- (in_branch_delay): Prevent div and sqrt in delay slot if +- fix_lost_divsqrt. +- * config/sparc/sparc.opt (sparc_fix_lost_divsqrt): New variable. +- +-2017-11-29 Daniel Cederman +- +- * config/sparc/sparc.c (atomic_insn_p): New function. +- (sparc_do_work_around_errata): Insert NOP instructions to +- prevent sequences that could trigger the TN-0010 errata for +- UT700. +- * config/sparc/sync.md (atomic_compare_and_swap_leon3_1): Make +- instruction referable in atomic_insns_p. +- +-2017-11-29 Daniel Cederman +- +- * config/sparc/sync.md (swapsi): 16-byte align if sparc_fix_gr712rc. +- (atomic_compare_and_swap_leon3_1): Likewise. +- (ldstub): Likewise. +- +-2017-11-29 Daniel Cederman +- +- * config/sparc/sparc.c (fpop_insn_p): New function. +- (sparc_do_work_around_errata): Insert NOP instructions to +- prevent sequences that could trigger the TN-0012 errata for +- GR712RC. +- (pass_work_around_errata::gate): Also test sparc_fix_gr712rc. +- * config/sparc/sparc.md (fix_gr712rc): New attribute. +- (in_branch_annul_delay): Prevent floating-point instructions +- in delay slot of annulled integer branch. +- +-2017-11-28 Jim Wilson +- +- Backport from mainline +- 2017-11-04 Andrew Waterman +- +- * config/riscv/riscv.c (riscv_option_override): Conditionally set +- TARGET_STRICT_ALIGN based upon -mtune argument. +- +- Backport from mainline +- 2017-05-04 Andrew Waterman +- +- * config/riscv/riscv.opt (mstrict-align): New option. +- * config/riscv/riscv.h (STRICT_ALIGNMENT): Use it. Update comment. +- (SLOW_UNALIGNED_ACCESS): Define. +- (riscv_slow_unaligned_access): Declare. +- * config/riscv/riscv.c (riscv_tune_info): Add slow_unaligned_access +- field. +- (riscv_slow_unaligned_access): New variable. +- (rocket_tune_info): Set slow_unaligned_access to true. +- (optimize_size_tune_info): Set slow_unaligned_access to false. +- (riscv_cpu_info_table): Add entry for optimize_size_tune_info. +- (riscv_valid_lo_sum_p): Use TARGET_STRICT_ALIGN. +- (riscv_option_override): Set riscv_slow_unaligned_access. +- * doc/invoke.texi: Add -mstrict-align to RISC-V. +- +- Backport from mainline +- 2017-11-07 Michael Clark +- +- * config/riscv/linux.h (MUSL_ABI_SUFFIX): New define. +- (MUSL_DYNAMIC_LINKER): Likewise. +- +-2017-11-27 Jim Wilson +- +- Backport from mainline +- 2017-10-25 Palmer Dabbelt +- +- * config/riscv/riscv.md (ZERO_EXTEND_LOAD): Define. +- * config/riscv/pic.md (local_pic_load): Rename to local_pic_load_s, +- mark as a sign-extending load. +- (local_pic_load_u): Define. +- +- Backport from mainline +- 2017-11-03 Kito Cheng +- +- * config/riscv/riscv.c (riscv_legitimize_move): Handle +- non-legitimate address. +- +-2017-11-24 Segher Boessenkool +- +- Backport from mainline +- 2017-11-17 Segher Boessenkool +- +- PR rtl-optimization/82621 +- * combine.c (try_combine): Do not split PARALLELs of two SETs if the +- dest of one of those SETs is unused. +- +-2017-11-23 Oleg Endo +- +- Backport from mainline +- 2017-11-23 Oleg Endo +- +- PR target/83111 +- * config/sh/sh.md (udivsi3, divsi3, sibcall_value_pcrel, +- sibcall_value_pcrel_fdpic): Use local variable instead of +- operands[3]. +- (calli_tbr_rel): Add missing operand 2. +- (call_valuei_tbr_rel): Add missing operand 3. +- +-2017-11-22 Richard Biener +- +- Revert +- 2017-11-21 Martin Liska +- +- Backport from mainline +- 2017-11-21 Martin Liska +- +- PR rtl-optimization/82044 +- PR tree-optimization/82042 +- * dse.c (check_mem_read_rtx): Check for overflow. +- +-2017-11-21 Martin Liska +- +- Backport from mainline +- 2017-10-27 Martin Liska +- +- PR gcov-profile/82457 +- * doc/invoke.texi: Document that one needs a non-strict ISO mode +- for fork-like functions to be properly instrumented. +- +-2017-11-21 Pat Haugen +- +- Backport from mainline +- 2017-11-21 Pat Haugen +- +- * config/rs6000/ppc-asm.h (f50, vs50): Fix values. +- +-2017-11-21 Thomas Preud'homme +- +- Backport from mainline +- 2017-11-09 Thomas Preud'homme +- +- * config/arm/arm.c (output_return_instruction): Add comments to +- indicate requirement for cmse_nonsecure_entry return to account +- for the size of clearing instruction output here. +- (thumb_exit): Likewise. +- * config/arm/thumb2.md (thumb2_cmse_entry_return): Fix length for +- return in hardfloat mode. +- +-2017-11-21 Martin Liska +- +- Backport from mainline +- 2017-11-21 Martin Liska +- +- PR rtl-optimization/82044 +- PR tree-optimization/82042 +- * dse.c (check_mem_read_rtx): Check for overflow. +- +-2017-11-21 Martin Liska +- +- Backport from mainline +- 2017-11-08 Martin Liska +- +- * gimplify.c (expand_FALLTHROUGH_r): Simplify usage +- of gimple_call_internal_p. +- +-2017-11-21 Martin Liska +- +- Backport from mainline +- 2017-11-08 Martin Liska +- +- PR sanitizer/82792 +- * gimplify.c (expand_FALLTHROUGH_r): Skip IFN_ASAN_MARK. +- +-2017-11-21 Martin Liska +- +- Backport from mainline +- 2017-10-31 Martin Liska +- +- PR gcov-profile/82633 +- * doc/gcov.texi: Document -fkeep-{static,inline}-functions and +- their interaction with GCOV infrastructure. +- +-2017-11-21 Martin Liska +- +- Backport from mainline +- 2017-10-19 Martin Liska +- +- PR driver/81829 +- * file-find.c (remove_prefix): Remove. +- * file-find.h (remove_prefix): Likewise. +- * gcc-ar.c: Remove smartness of lookup. +- +-2017-11-21 Martin Liska +- +- Backport from mainline +- 2017-10-18 Martin Liska +- +- PR sanitizer/82545 +- * asan.c (asan_expand_poison_ifn): Do not put gimple stmt +- on an abnormal edge. +- +-2017-11-21 Martin Liska +- +- Backport from mainline +- 2017-10-11 Martin Liska +- +- * print-rtl.c (print_insn): Move declaration of idbuf +- to same scope as name. +- +-2017-11-21 Claudiu Zissulescu +- +- Backport from mainline +- 2017-11-17 Vineet Gupta +- +- * config/arc/linux.h: GLIBC_DYNAMIC_LINKER update per glibc +- upstreaming review comments. +- +-2017-11-21 Rainer Orth +- +- Backport from mainline +- 2017-11-14 Rainer Orth +- +- * config.gcc (*-*-solaris2*): Enable default_use_cxa_atexit since +- Solaris 11. Update comment. +- * configure.ac (gcc_cv_ld_pid): Adapt comment for Solaris 12 +- renaming. +- * config/sol2.h (STARTFILE_SPEC): Likewise. +- * configure: Regenerate. +- +-2017-11-20 Segher Boessenkool +- +- Backport from mainline +- 2017-09-20 Segher Boessenkool +- +- PR target/77687 +- * config/rs6000/rs6000.md (stack_restore_tie): Store to a scratch +- address instead of to r1 and r11. +- +-2017-11-17 Vineet Gupta +- +- * config.gcc: Remove uclibc from arc target spec. +- +-2017-11-16 Uros Bizjak +- +- * config/i386/i386.c (x86_print_call_or_nop): Emit 5 byte nop +- explicitly as a stream of bytes. +- +-2017-11-15 Richard Biener +- +- PR tree-optimization/82985 +- Backport from mainline +- 2017-08-15 Richard Biener +- +- PR tree-optimization/81790 +- * tree-ssa-sccvn.c (vn_lookup_simplify_result): Handle both +- CONSTRUCTORs from simplifying and VN. +- +-2017-11-15 Pierre-Marie de Rodat +- +- Backport from mainline +- 2017-09-25 Pierre-Marie de Rodat +- +- PR debug/82155 +- * dwarf2out.c (dwarf2out_early_global_decl): Call dwarf2out_decl +- on the FUNCTION_DECL function context if it has a DIE that is a +- declaration. +- +-2017-11-13 Rainer Orth +- +- Backport from mainline +- 2017-10-26 Rainer Orth +- +- * configure.ac (gcc_cv_as_ix86_xbrace_comment): Check if assembler +- supports -xbrace_comment option. +- * configure: Regenerate. +- * config.in: Regenerate. +- * config/i386/sol2.h (ASM_XBRACE_COMMENT_SPEC): Define. +- (ASM_CPU_SPEC): Use it. +- +-2017-11-09 Segher Boessenkool +- +- Backport from mainline +- 2017-11-01 Segher Boessenkool +- +- PR rtl-optimization/64682 +- PR rtl-optimization/69567 +- PR rtl-optimization/69737 +- PR rtl-optimization/82683 +- * combine.c (distribute_notes) : If the new I2 sets the same +- register mentioned in the note, drop the note, unless it came from I3, +- in which case it should go to I3 again. +- +-2017-11-07 Eric Botcazou +- +- Backport from mainline +- 2017-10-31 Matthew Fortune +- Eric Botcazou +- +- PR rtl-optimization/81803 +- * lra-constraints.c (curr_insn_transform): Also reload the whole +- register for a strict subreg no wider than a word if this is for +- a WORD_REGISTER_OPERATIONS target. +- +-2017-11-03 Wilco Dijkstra +- +- PR middle-end/60580 +- * config/aarch64/aarch64.c (aarch64_frame_pointer_required) +- Check special value of flag_omit_frame_pointer. +- (aarch64_can_eliminate): Likewise. +- (aarch64_override_options_after_change_1): Simplify handling of +- -fomit-frame-pointer and -fomit-leaf-frame-pointer. +- +-2017-11-01 Martin Jambor +- +- PR c++/81702 +- * gimple-fold.c (gimple_get_virt_method_for_vtable): Remove assert. +- +-2017-10-31 Uros Bizjak +- +- PR target/82772 +- * config/alpha/sync.md (fetchop_constr) : Change to "rINM". +- +-2017-10-27 Jakub Jelinek +- +- Backported from mainline +- 2017-10-12 Jakub Jelinek +- +- PR c++/82159 +- * expr.c (store_field): Don't optimize away bitsize =3D=3D 0 store +- from CALL_EXPR with addressable return type. +- +- 2017-09-21 Jakub Jelinek +- +- PR sanitizer/81715 +- * tree-inline.c (expand_call_inline): Emit clobber stmts for +- VAR_DECLs to which addressable non-volatile parameters are mapped +- and for id->retvar after the return value assignment, though +- for -fsanitize=3Dkernel-address only. Clear id->retval and id->retbnd +- after inlining. +- +- 2017-09-18 Jakub Jelinek +- +- PR c/82234 +- * doc/extend.texi: Add @findex entry for __builtin_shuffle. +- +- 2017-09-15 Jakub Jelinek +- +- PR rtl-optimization/82192 +- * combine.c (make_extraction): Don't look through non-paradoxical +- SUBREGs or TRUNCATE if pos + len is or might be bigger than +- inner's mode. +- +-2017-10-27 Jakub Jelinek +- +- PR target/82703 +- * config/i386/i386-protos.h (maybe_get_pool_constant): Removed. +- * config/i386/i386.c (maybe_get_pool_constant): Removed. +- (ix86_split_to_parts): Use avoid_constant_pool_reference instead of +- maybe_get_pool_constant. +- * config/i386/predicates.md (zero_extended_scalar_load_operand): +- Likewise. +- +-2017-10-24 Qing Zhao +- Wilco Dijkstra +- +- * builtins.c (expand_builtin_update_setjmp_buf): Add a +- converstion to Pmode from the buf_addr. +- +-2017-10-20 Richard Biener +- +- PR tree-optimization/82603 +- * tree-if-conv.c (predicate_mem_writes): Make sure to only +- remove false predicated stores. +- +-2017-10-20 Richard Biener +- +- Backport from mainline +- 2017-10-06 Richard Biener +- +- PR tree-optimization/82436 +- * tree-vect-slp.c (vect_supported_load_permutation_p): More +- conservatively choose the vectorization factor when checking +- whether we can perform the required load permutation. +- (vect_transform_slp_perm_load): Assert when we may not fail. +- +-2017-10-19 Richard Earnshaw +- +- PR target/82445 +- * config/arm/arm.c (align_ok_ldrd_strd): New function. +- (mem_ok_for_ldrd_strd): New parameter align. Extract the alignment of +- the mem into it. +- (gen_operands_ldrd_strd): Validate the alignment of the accesses. +- +-2017-10-18 Segher Boessenkool +- +- PR rtl-optimization/82602 +- * ira.c (rtx_moveable_p): Return false for volatile asm. +- +-2017-10-18 Vladimir Makarov +- +- PR middle-end/82556 +- * lra-constraints.c (curr_insn_transform): Use non-input operand +- instead of output one for matched reload. +- +-2017-10-17 Jakub Jelinek +- +- PR tree-optimization/82549 +- * fold-const.c (optimize_bit_field_compare, fold_truth_andor_1): +- Formatting fixes. Instead of calling make_bit_field_ref with negative +- bitpos return 0. +- +-2017-10-13 Jakub Jelinek +- +- PR target/82274 +- * internal-fn.c (expand_mul_overflow): If both operands have +- the same highpart of -1 or 0 and the topmost bit of lowpart +- is different, overflow is if res <=3D 0 rather than res < 0. +- +- PR target/82524 +- * config/i386/i386.md (addqi_ext_1, andqi_ext_1, +- *andqi_ext_1_cc, *qi_ext_1, *xorqi_ext_1_cc): Change +- =3DQ constraints to +Q and into insn condition add check +- that operands[0] and operands[1] are equal. +- (*addqi_ext_2, *andqi_ext_2, *qi_ext_2): Change +- =3DQ constraints to +Q and into insn condition add check +- that operands[0] is equal to either operands[1] or operands[2]. +- +-2017-10-10 Andreas Tobler +- +- Backported from mainline r253602 +- 2017-10-10 Andreas Tobler +- +- * config.gcc: (armv7*-*-freebsd*): New target. +- (armv6*-*-freebsd*): Remove obsolete TARGET_FREEBSD_ARMv6 define. +- +-2017-10-06 Christophe Lyon +- +- Backport from mainline r253242. +- 2017-09-27 Christophe Lyon +- +- PR target/71727 +- * config/aarch64/aarch64.c +- (aarch64_builtin_support_vector_misalignment): Always return false +- when misalignment is unknown. +- +-2017-10-04 Jason Merrill +- +- PR c++/82406 - C++ error with noexcept function type +- PR c++/70029 - ICE with ref-qualifier and -flto +- * langhooks.h (struct lang_hooks_for_types): Add +- copy_lang_qualifiers. +- * attribs.c (build_type_attribute_qual_variant): Use it. +- * langhooks-def.h (LANG_HOOKS_COPY_LANG_QUALIFIERS): Default to +- NULL. +- (LANG_HOOKS_FOR_TYPES_INITIALIZER): Use it. +- * tree.c (verify_type): Re-enable TYPE_CANONICAL main variant check. +- +-2017-10-02 Bill Schmidt +- +- Backport from mainline +- 2017-09-29 Bill Schmidt +- +- PR tree-optimization/82337 +- * gimple-ssa-strength-reduction.c (find_phi_def): Don't record a +- phi definition if the PHI result appears in an abnormal PHI. +- (find_basis_for_base_expr): Don't record a basis if the LHS of the +- basis appears in an abnormal PHI. +- +-2017-09-30 Jakub Jelinek +- +- * config/i386/i386.c (ix86_split_idivmod): Use mode instead of +- always SImode for DIV and MOD in REG_EQUAL notes. +- +- Backported from mainline +- 2017-09-27 Jakub Jelinek +- +- PR c++/82159 +- * gimplify.c (gimplify_modify_expr): Don't optimize away zero sized +- lhs from calls if the lhs has addressable type. +- +-2017-09-29 Krister Walfridsson +- +- Backport from mainline +- 2017-06-29 Maya Rashish +- +- PR target/77480 +- * config/netbsd.h (NETBSD_LIB_SPEC): Add -lc when creating shared +- objects. +- +-2017-09-29 Krister Walfridsson +- +- Backport from mainline +- 2017-09-26 Krister Walfridsson +- +- PR target/39570 +- * gcc/config/netbsd-protos.h: New file. +- * gcc/config/netbsd.c: New file. +- * gcc/config/netbsd.h (SUBTARGET_INIT_BUILTINS): Define. +- * gcc/config/t-netbsd: New file. +- * gcc/config.gcc (tm_p_file): Add netbsd-protos.h. +- (tmake_file) Add t-netbsd. +- (extra_objs) Add netbsd.o. +- +-2017-09-28 Krister Walfridsson +- +- Backport from mainline +- 2017-05-14 Krister Walfridsson +- +- PR target/80600 +- * config/netbsd.h (NETBSD_LIBGCC_SPEC): Always add -lgcc. +- +-2017-09-27 Christophe Lyon +- +- Backport from trunk r249639. +- 2017-06-26 Christophe Lyon +- +- * doc/sourcebuild.texi (ARM-specific attributes): Document new +- arm_neon_ok_no_float_abi effective target. +- +-2017-09-26 Richard Biener +- +- Backport from mainline +- 2017-09-19 Richard Biener +- +- PR tree-optimization/82244 +- * tree-vrp.c (remove_range_assertions): Do not propagate +- a constant to abnormals but replace the assert with a copy. +- +- 2017-09-21 Richard Biener +- +- PR tree-optimization/82276 +- PR tree-optimization/82244 +- * tree-vrp.c (build_assert_expr_for): Set +- SSA_NAME_OCCURS_IN_ABNORMAL_PHI if the variable we assert on +- has it set. +- (remove_range_assertions): Revert earlier change. +- +- 2017-09-20 Richard Biener +- +- PR tree-optimization/82264 +- * tree-ssa-sccvn.c (vn_phi_eq): Use safe_dyn_cast to check +- for GIMPLE_CONDs. +- (vn_phi_lookup): Likewise. +- (vn_phi_insert): Likewise. +- * is-a.h (safe_dyn_cast): New. +- +- 2017-09-25 Richard Biener +- +- PR tree-optimization/82285 +- * tree-vect-patterns.c (vect_recog_bool_pattern): Also handle +- enumeral types. +- +- 2017-09-22 Richard Biener +- +- PR tree-optimization/82291 +- * tree-if-conv.c (predicate_mem_writes): Make sure to +- remove writes in blocks predicated with false. +- +-2017-09-21 Alan Modra +- +- PR target/81996 +- * gcc/config/rs6000/rs6000.c (rs6000_return_addr): Use +- stack_pointer_rtx for count 0. Update comments. Break up +- large rtl expression. +- +-2017-09-21 Wilco Dijkstra +- +- PR target/71951 +- * config/aarch64/aarch64.h (LIBGCC2_UNWIND_ATTRIBUTE): Define. +- +-2017-09-19 Uros Bizjak +- +- * config/i386/i386.c (fold_builtin_cpu): Add M_AMDFAM17H +- to processor_model and "amdfam17h" to arch_names_table. +- * doc/extend.texi (__builtin_cpu_is): Document amdfam17h CPU name. +- +-2017-09-19 Martin Liska +- +- PR c++/81355 +- * config/i386/i386.c (sorted_attr_string): Skip empty strings. +- +-2017-09-19 Martin Liska +- +- Revert backport: +- 2017-08-10 Martin Liska +- +- PR c++/81355 +- * c-attribs.c (handle_target_attribute): +- Report warning for an empty string argument of target attribute. +- +-2017-09-18 Richard Biener +- +- Backport from mainline +- 2017-09-04 Richard Biener +- +- PR tree-optimization/82084 +- * fold-const.h (can_native_encode_string_p): Declare. +- * fold-const.c (can_native_encode_string_p): Factor out from ... +- (native_encode_string): ... here. +- * tree-vect-stmts.c (vectorizable_store): Call it to avoid +- vectorizing stores from constants we later cannot handle. +- +- 2017-09-06 Richard Biener +- +- PR tree-optimization/82108 +- * tree-vect-stmts.c (vectorizable_load): Fix pointer adjustment +- for gap in the non-permutation SLP case. +- +-2017-09-15 Jakub Jelinek +- +- Backported from mainline +- 2017-09-14 Jakub Jelinek +- +- PR target/81325 +- * cfgbuild.c (find_bb_boundaries): Ignore debug insns in decisions +- if and where to split a bb, except for splitting before debug insn +- sequences followed by non-label real insn. Delete debug insns +- in between basic blocks. +- +- 2017-09-12 Jakub Jelinek +- +- PR target/82112 +- * config/rs6000/rs6000-c.c (altivec_resolve_overloaded_builtin): For +- ALTIVEC_BUILTIN_VEC_LD if arg1 has array type call default_conversion +- on it early, rather than manual conversion late. For +- ALTIVEC_BUILTIN_VEC_ST if arg2 has array type call default_conversion +- instead of performing manual conversion. +- +-2017-09-15 Martin Liska +- +- Backport from mainline +- 2017-09-14 Martin Liska +- +- * gimple-ssa-strength-reduction.c (create_add_on_incoming_edge): +- Add proper printf format. +- +-2017-09-15 Martin Liska +- +- Backport from mainline +- 2017-08-30 Martin Liska +- +- PR inline-asm/82001 +- * ipa-icf-gimple.c (func_checker::compare_tree_list_operand): +- Rename to ... +- (func_checker::compare_asm_inputs_outputs): ... this function. +- (func_checker::compare_gimple_asm): Use the function to compare +- also ASM constrains. +- * ipa-icf-gimple.h: Rename the function. +- +-2017-09-15 Martin Liska +- +- Backport from mainline +- 2017-08-29 Martin Liska +- +- PR other/39851 +- * gcc.c (driver_handle_option): Add new argument. +- * opts-common.c (handle_option): Pass +- target_option_override_hook. +- * opts-global.c (lang_handle_option): Add new option. +- (set_default_handlers): Add new argument. +- (decode_options): Likewise. +- * opts.c (target_handle_option): Likewise. +- (common_handle_option): Call target_option_override_hook. +- * opts.h (struct cl_option_handler_func): Add hook for +- target option override. +- (struct cl_option_handlers): Likewise. +- (set_default_handlers): Add new argument. +- (decode_options): Likewise. +- (common_handle_option): Likewise. +- (target_handle_option): Likewise. +- * toplev.c (toplev::main): Pass targetm.target_option.override +- hook. +- +-2017-09-15 Martin Liska +- +- Backport from mainline +- 2017-08-10 Martin Liska +- +- PR c++/81355 +- * c-attribs.c (handle_target_attribute): +- Report warning for an empty string argument of target attribute. +- +-2017-09-15 Martin Liska +- +- Backport from mainline +- 2017-08-08 Martin Liska +- +- PR tree-opt/81696 +- * ipa-icf-gimple.c (func_checker::compare_cst_or_decl): Consider +- LABEL_DECLs that can be from a different function. +- +-2017-09-15 Martin Liska +- +- Backport from mainline +- 2017-06-28 Martin Liska +- +- PR ipa/81128 +- * ipa-visibility.c (non_local_p): Handle visibility. +- +-2017-09-12 Bill Schmidt +- +- Backport from mainline +- 2017-09-05 Bill Schmidt +- +- PR target/81833 +- * config/rs6000/altivec.md (altivec_vsum2sws): Convert from a +- define_insn to a define_expand. +- (altivec_vsum2sws_direct): New define_insn. +- (altivec_vsumsws): Convert from a define_insn to a define_expand. +- +-2017-09-11 Max Filippov +- +- Backport from mainline +- PR target/82181 +- * config/xtensa/xtensa.c (xtensa_mem_offset): Check that both +- words of DImode object are reachable by xtensa_uimm8x4 access. +- +-2017-09-10 Bill Schmidt +- +- Backport from mainline +- 2017-05-11 Bill Schmidt +- +- PR target/80695 +- * config/rs6000/rs6000.c (rs6000_builtin_vectorization_cost): +- Account for direct move costs for vec_construct of integer +- vectors. +- +- Backport from mainline +- 2017-07-23 Bill Schmidt +- +- PR target/80695 +- * config/rs6000/rs6000.c (rs6000_builtin_vectorization_cost): +- Reduce cost estimate for direct moves. +- +-2017-09-08 Eric Botcazou +- +- PR target/81988 +- * config/sparc/sparc.md (mulsi3): Rename into *mulsi3_sp32. +- (*mulsi3_sp64): New instruction. +- (mulsi3): New expander. +- +-2017-09-07 Jakub Jelinek +- +- Backported from mainline +- 2017-09-05 Jakub Jelinek +- +- PR middle-end/81768 +- * omp-low.c (lower_omp_for): Recompute tree invariant if +- gimple_omp_for_initial/final is ADDR_EXPR. +- +- PR middle-end/81768 +- * omp-expand.c (expand_omp_simd): Force second operands of COND_EXPR +- into gimple val before gimplification fo the COND_EXPR. +- +- 2017-09-04 Jakub Jelinek +- +- * lra-remat.c (reg_overlap_for_remat_p): Fix a pasto. +- +- 2017-09-01 Jakub Jelinek +- +- PR sanitizer/81923 +- * asan.c (create_odr_indicator): Strip name encoding from assembler +- name before appending it after __odr_asan_. +- +- 2017-08-09 Jakub Jelinek +- +- PR c/81687 +- * omp-low.c (omp_copy_decl): Don't remap FORCED_LABEL or DECL_NONLOCAL +- LABEL_DECLs. +- * tree-cfg.c (move_stmt_op): Don't adjust DECL_CONTEXT of FORCED_LABEL +- or DECL_NONLOCAL labels. +- (move_stmt_r) : Adjust DECL_CONTEXT of FORCED_LABEL +- or DECL_NONLOCAL labels here. +- +- 2017-08-03 Jakub Jelinek +- +- PR target/81621 +- * bb-reorder.c (pass_partition_blocks::execute): Return TODO_df_finish +- after setting changeable df flags. +- +- PR driver/81650 +- * calls.c (alloc_max_size): Use HOST_WIDE_INT_UC (10??) +- instead of 10??LU, perform unit multiplication in wide_int, +- don't change alloc_object_size_limit if the limit is larger +- than SSIZE_MAX. +- +- PR middle-end/81052 +- * omp-low.c (diagnose_sb_0): Handle flag_openmp_simd like flag_openmp. +- (pass_diagnose_omp_blocks::gate): Enable also for flag_openmp_simd. +- +-2017-09-06 Bill Schmidt +- +- Backport from mainline: +- 2017-08-30 Bill Schmidt +- +- PR tree-optimization/81987 +- * gimple-ssa-strength-reduction.c (insert_initializers): Don't +- insert an initializer in a location not dominated by the stride +- definition. +- +-2017-09-05 Bill Schmidt +- +- Backport from mainline +- 2017-08-29 Bill Schmidt +- Jakub Jelinek +- Richard Biener +- +- PR tree-optimization/81503 +- * gimple-ssa-strength-reduction.c (replace_mult_candidate): Ensure +- folded constant fits in the target type; reorder tests for clarity. +- +-2017-09-05 Pierre-Marie de Rodat +- +- Backport from trunk +- PR ada/79542 +- * dwarf2out.c (modified_type_die): For C typedef types that have +- an ultimate origin, process the ultimate origin instead of the +- input type. +- (gen_typedef_die): Assert that input DECLs have no ultimate +- origin. +- (gen_type_die_with_usage): For typedef variants that have an +- ultimate origin, just call gen_decl_die on the original DECL. +- (process_scope_var): Avoid creating DIEs for local typedefs and +- concrete static variables. +- +-2017-08-31 Bill Schmidt +- +- Backport from mainline +- 2017-08-25 Bill Schmidt +- +- PR target/81504 +- * config/rs6000/rs6000.c (find_alignment_op): Add reference +- parameter and_insn and return it. +- (recombine_lvx_pattern): Insert a copy to ensure availability of +- the base register of the copied masking operation at the point of +- the instruction replacement. +- (recombine_stvx_pattern): Likewise. +- +-2017-08-29 Michael Meissner +- +- Back port from trunk +- 2017-08-07 Michael Meissner +- +- PR target/81593 +- * config/rs6000/vsx.md (vsx_concat__1): New combiner insns +- to recognize inserting into a vector from a double word element +- that was extracted from another vector, and eliminate extra +- XXPERMDI instructions. +- (vsx_concat__2): Likewise. +- (vsx_concat__3): Likewise. +- (vsx_set_, VSX_D): Rewrite vector set in terms of vector +- concat to allow optimizing inserts from previous extracts. +- +-2017-08-29 Alan Modra +- +- Apply from mainline +- 2017-08-12 Alan Modra +- PR target/81170 +- PR target/81295 +- * config/rs6000/sysv4.h (STARTFILE_LINUX_SPEC): Upgrade to +- match gnu-user.h startfile. +- (ENDFILE_LINUX_SPEC): Similarly. +- +- 2017-08-08 Alan Modra +- H.J. Lu +- PR target/81170 +- PR target/81295 +- PR driver/81523 +- * gcc.c (NO_PIE_SPEC): Delete. +- (PIE_SPEC): Define as !no-pie/pie. Move static|shared|r +- exclusion.. +- (LINK_PIE_SPEC): ..to here. +- (LINK_COMMAND_SPEC): Support -no-pie. +- * config/gnu-user.h (GNU_USER_TARGET_STARTFILE_SPEC): Correct +- chain of crtbegin*.o selection, update for PIE_SPEC changes and +- format. +- (GNU_USER_TARGET_ENDFILE_SPEC): Similarly. +- * config/sol2.h (STARTFILE_CRTBEGIN_SPEC): Similarly. +- (ENDFILE_CRTEND_SPEC): Similarly. +- +-2017-08-29 Richard Biener +- +- Backport from mainline +- 2017-08-28 Richard Biener +- +- PR tree-optimization/81977 +- * tree-ssa-sccvn.c (vn_reference_lookup_3): Fix look through +- memcpy. +- +- 2017-08-28 Richard Biener +- +- PR debug/81993 +- * dwarf2out.c (gen_remaining_tmpl_value_param_die_attributes): +- Do nothing for removed DIEs. +- +-2017-08-28 Richard Biener +- +- Backport from mainline +- 2017-06-14 Richard Biener +- +- PR middle-end/81088 +- * fold-const.c (split_tree): Drop TREE_OVERFLOW flag from +- literal constants. +- (fold_binary_loc): When associating do not treat pre-existing +- TREE_OVERFLOW on literal constants as a reason to allow +- TREE_OVERFLOW on associated literal constants. +- +- 2017-06-13 Richard Biener +- +- PR middle-end/81065 +- * fold-const.c (extract_muldiv_1): Remove bogus distribution +- case of C * (x * C2 + C3). +- (fold_addr_of_array_ref_difference): Properly fold index difference. +- +- 2017-06-07 Marek Polacek +- +- PR sanitizer/80932 +- * fold-const.c (extract_muldiv_1) : Add +- TYPE_OVERFLOW_WRAPS check. +- +-2017-08-28 Richard Biener +- +- Backport from mainline +- 2017-08-21 Richard Biener +- +- PR middle-end/81884 +- * tree-ssa-alias.c (stmt_kills_ref_p): Handle array accesses +- at struct end conservatively when comparing common bases. +- +- 2017-05-04 Richard Biener +- +- * tree.c (array_at_struct_end_p): Handle arrays at struct +- end with flexarrays more conservatively. Refactor and treat +- arrays of arrays or aggregates more strict. Fix +- VIEW_CONVERT_EXPR handling. Remove allow_compref argument. +- * tree.h (array_at_struct_end_p): Adjust prototype. +- * gimple-fold.c (get_range_strlen): Likewise. +- * tree-chkp.c (chkp_may_narrow_to_field): Likewise. +- +-2017-08-28 Richard Biener +- +- Backport from mainline +- 2017-08-01 Richard Biener +- +- PR tree-optimization/81181 +- * tree-ssa-pre.c (compute_antic_aux): Defer clean() to ... +- (compute_antic): ... end of iteration here. +- +- 2017-08-08 Richard Biener +- +- PR tree-optimization/81723 +- * tree-vect-slp.c (struct bst_traits): New hash traits. +- (bst_fail): New global. +- (vect_build_slp_tree_2): New worker, split out from ... +- (vect_build_slp_tree): ... this now wrapping it with using +- bst_fail set to cache SLP tree build fails. Properly handle +- max_tree_size. +- (vect_analyze_slp_instance): Allocate and free bst_fail. +- +- 2017-08-24 Richard Biener +- +- PR target/81921 +- * config/i386/i386.c: Include symbol-summary.h, ipa-prop.h +- and ipa-inline.h. +- (ix86_can_inline_p): When ix86_fpmath flags do not match +- check whether the callee uses FP math at all. +- +-2017-08-23 Peter Bergner +- +- Backport from mainline +- 2017-08-17 Peter Bergner +- +- PR target/72804 +- * config/rs6000/vsx.md (*vsx_le_permute_): Add support for +- operands residing in integer registers. +- (*vsx_le_perm_load_): Likewise. +- (*vsx_le_perm_store_): Likewise. +- (define_peephole2): Add peepholes to optimize the above. +- +-2017-08-22 Peter Bergner +- +- Backport from mainline +- 2017-08-17 Peter Bergner +- +- PR target/80210 +- * config/rs6000/rs6000.c (rs6000_activate_target_options): New function. +- (rs6000_set_current_function): Rewrite function to use it. +- +-2017-08-22 Sebastian Huber +- +- Backport from mainline +- 2017-08-22 Sebastian Huber +- +- * config.gcc (powerpc-*-rtems*): Add rs6000/linux64.opt. +- * config/rs6000/rtems.h (ASM_PREFERRED_EH_DATA_FORMAT): New define. +- (DOT_SYMBOLS): Likewise. +- (MINIMAL_TOC_SECTION_ASM_OP): Likewise. +- (RELOCATABLE_NEEDS_FIXUP): Likewise. +- (RS6000_ABI_NAME): Likewise. +- (TARGET_CMODEL): Likewise. +- (TOC_SECTION_ASM_OP): Likewise. +- (SET_CMODEL): New macro. +- (SUBSUBTARGET_OVERRIDE_OPTIONS): Evaluate cmodel options. +- +-2017-08-22 Georg-Johann Lay +- +- Backport from 2017-08-22 trunk r251256. +- +- PR target/81910 +- * config/avr/avr.c (avr_handle_addr_attribute): Early return if +- not VAR_P. Filter attribute warnings with OPT_Wattributes. +- (avr_attribute_table) : Initialize +- .decl_required with true. +- +-2017-08-21 Georg-Johann Lay +- +- PR target/79883 +- * config/avr/avr.c (avr_set_current_function): Typo in diagnostic. +- +-2017-08-19 Uros Bizjak +- +- PR target/81894 +- * doc/extend.texi (x86 Built-in Functions): Correct the name of +- __builtin_ia32_lzcnt_u16. +- +-2017-08-17 Uros Bizjak +- +- Backport from mainline +- 2017-08-17 Maxim Ostapenko +- +- PR target/81861 +- * config/i386/i386.c (ix86_option_override_internal): Save target +- specific options after ix86_stack_protector_guard_reg was changed. +- +-2017-08-16 Bill Schmidt +- +- Backport from mainline +- 2017-08-08 Bill Schmidt +- +- PR tree-optimization/81354 +- * gimple-ssa-strength-reduction.c (create_add_on_incoming_edge): +- Insert on edges rather than explicitly creating landing pads. +- (analyze_candidates_and_replace): Commit edge inserts. +- +-2017-08-15 Joseph Myers +- +- PR target/78460 +- PR target/67712 +- * config/sh/sh-mem.cc (sh_expand_cmpnstr): Only unroll for +- constant count if that count is less than 32. +- +-2017-08-14 Richard Biener +- +- * BASE-VER: Set to 7.2.1. +- +-2017-08-14 Release Manager +- +- * GCC 7.2.0 released. +- +-2017-08-08 Richard Biener +- +- PR middle-end/81766 +- * function.c (thread_prologue_and_epilogue_insns): Restore +- behavior of always calling find_many_sub_basic_blocks on +- the inserted prologue. +- +-2017-08-02 Jakub Jelinek +- +- PR middle-end/79499 +- * function.c (thread_prologue_and_epilogue_insns): Determine blocks +- for find_many_sub_basic_blocks bitmap by looking up BLOCK_FOR_INSN +- of first NONDEBUG_INSN_P in each of the split_prologue_seq and +- prologue_seq sequences - if any. +- +-2017-08-01 Uros Bizjak +- +- PR target/81641 +- * config/i386/i386.c (ix86_print_operand_address_as): For -masm=3Dintel +- print "ds:" only for immediates in generic address space. +- +-2017-08-01 Jakub Jelinek +- +- PR target/81622 +- * config/rs6000/rs6000-c.c (altivec_resolve_overloaded_builtin): For +- __builtin_vec_cmpne verify both arguments are compatible vectors +- before looking at TYPE_MODE on the element type. For __builtin_vec_ld +- verify arg1_type is a pointer or array type. For __builtin_vec_st, +- move computation of aligned to after checking the argument types. +- Formatting fixes. +- +-2017-08-01 Martin Liska +- +- Backport from mainline +- 2017-07-26 Martin Liska +- +- PR gcov-profile/81561 +- * gcov.c (unblock): Make unblocking safe as we need to preserve +- index correspondence of blocks and block_lists. +- +-2017-08-01 Richard Biener +- +- PR tree-optimization/71752 +- PR tree-optimization/81633 +- * tree-vect-slp.c (vect_get_slp_defs): Handle null operands +- in the original suggested way. +- +-2017-08-01 Richard Sandiford +- +- PR tree-optimization/80769 +- * tree-ssa-strlen.c (strinfo): Document that "stmt" is also used +- for malloc and calloc. Document the new invariant that all related +- strinfos have delayed lengths or none do. +- (get_next_strinfo): New function. +- (verify_related_strinfos): Move earlier in file. +- (set_endptr_and_length): New function, split out from... +- (get_string_length): ...here. Also set the lengths of related +- strinfos. +- +-2017-08-01 Jakub Jelinek +- +- PR tree-optimization/81588 +- * tree-ssa-reassoc.c (optimize_range_tests_var_bound): If +- ranges[i].in_p, invert comparison code ccode. For >/>=3D, +- swap rhs1 and rhs2 and comparison code unconditionally, +- for rank is BIT_IOR_EXPR. +- +-2017-07-31 Andreas Krebbel +- +- Backport from mainline +- 2017-07-31 Andreas Krebbel +- +- * config.gcc: Add z14. +- * config/s390/driver-native.c (s390_host_detect_local_cpu): Add +- CPU model numbers for z13s and z14. +- * config/s390/s390-c.c (s390_resolve_overloaded_builtin): Replace +- arch12 with z14. +- * config/s390/s390-opts.h (enum processor_type): Rename +- PROCESSOR_ARCH12 to PROCESSOR_3906_Z14. +- * config/s390/s390.c (processor_table): Add field for CPU name to +- be passed to Binutils. +- (s390_asm_output_machine_for_arch): Use the new field in +- processor_table for Binutils. +- (s390_expand_builtin): Replace arch12 with z14. +- (s390_issue_rate): Rename PROCESSOR_ARCH12 to PROCESSOR_3906_Z14. +- (s390_get_sched_attrmask): Likewise. +- (s390_get_unit_mask): Likewise. +- * config/s390/s390.opt: Add z14 to processor_type enum. +- +-2017-07-31 Jakub Jelinek +- +- PR sanitizer/81604 +- * ubsan.c (ubsan_type_descriptor): For UBSAN_PRINT_ARRAY don't +- change type to the element type, instead add eltype variable and +- use it where we are interested in the element type. +- +-2017-07-28 Peter Bergner +- +- Backport from mainline +- 2017-07-28 Peter Bergner +- +- * config/rs6000/ppc-auxv.h (PPC_FEATURE2_DARN): New define. +- (PPC_FEATURE2_SCV): Likewise. +- * config/rs6000/rs6000.c (cpu_supports_info): Use them. +- +-2017-07-28 David Edelsohn +- +- Backport from mainline +- 2017-07-25 David Edelsohn +- +- * dwarf2asm.c (dw2_asm_output_nstring): Encode double quote +- character for AIX. +- * dwarf2out.c (output_macinfo): Copy debug_line_section_label +- to dl_section_ref. On AIX, append an expression to subtract +- the size of the section length to dl_section_ref. +- +-2017-07-28 Bin Cheng +- +- Backport from mainline r250496 +- 2017-07-25 Bin Cheng +- +- PR target/81414 +- * config/aarch64/cortex-a57-fma-steering.c (analyze): Skip fmul/fmac +- instructions if no du chain is found. +- +-2017-07-28 Sebastian Huber +- +- Backport from mainline +- 2017-07-28 Sebastian Huber +- +- * config.gcc (powerpc-*-rtems*): Remove rs6000/eabi.h. Add +- rs6000/biarch64.h. +- * config/rs6000/rtems.h (ASM_DECLARE_FUNCTION_SIZE): New macro. +- (ASM_OUTPUT_SPECIAL_POOL_ENTRY_P): Likewise. +- (CRT_CALL_STATIC_FUNCTION): Likewise. +- (ASM_DEFAULT_SPEC): New define. +- (ASM_SPEC32): Likewise. +- (ASM_SPEC64): Likewise. +- (ASM_SPEC_COMMON): Likewise. +- (ASM_SPEC): Likewise. +- (INVALID_64BIT): Likewise. +- (LINK_OS_DEFAULT_SPEC): Likewise. +- (LINK_OS_SPEC32): Likewise. +- (LINK_OS_SPEC64): Likewise. +- (POWERPC_LINUX): Likewise. +- (PTRDIFF_TYPE): Likewise. +- (RESTORE_FP_PREFIX): Likewise. +- (RESTORE_FP_SUFFIX): Likewise. +- (SAVE_FP_PREFIX): Likewise. +- (SAVE_FP_SUFFIX): Likewise. +- (SIZE_TYPE): Likewise. +- (SUBSUBTARGET_OVERRIDE_OPTIONS): Likewise. +- (TARGET_64BIT): Likewise. +- (TARGET_64BIT): Likewise. +- (TARGET_AIX): Likewise. +- (WCHAR_TYPE_SIZE): Likewise. +- (WCHAR_TYPE): Undefine. +- (TARGET_OS_CPP_BUILTINS): Add 64-bit PowerPC defines. +- (CPP_OS_DEFAULT_SPEC): Use previous CPP_OS_RTEMS_SPEC. +- (CPP_OS_RTEMS_SPEC): Delete. +- (SUBSUBTARGET_EXTRA_SPECS): Remove cpp_os_rtems. Add +- asm_spec_common, asm_spec32, asm_spec64, link_os_spec32, and +- link_os_spec64. +- * config/rs6000/t-rtems: Add mcpu=3De6500/m64 multilibs. +- +-2017-07-28 Sebastian Huber +- +- Backport from mainline +- 2017-07-27 Sebastian Huber +- +- * config.gcc (riscv*-*-elf*): Add (riscv*-*-rtems*). +- * config/riscv/rtems.h: New file. +- +-2017-07-27 Eric Botcazou +- +- * config/sparc/sparc.c (sparc_option_override): Set MASK_FSMULD flag +- earlier and only if MASK_FPU is set. Adjust formatting. +- +-2017-07-27 Andreas Krebbel +- +- Backport from mainline +- 2017-07-27 Andreas Krebbel +- +- PR target/81534 +- * config/s390/s390.md ("*atomic_compare_and_swap_1") +- ("*atomic_compare_and_swapdi_2", "*atomic_compare_and_swapsi_3"): +- Change s_operand to memory_operand. +- +-2017-07-27 Jakub Jelinek +- +- PR tree-optimization/81555 +- PR tree-optimization/81556 +- * tree-ssa-reassoc.c (rewrite_expr_tree): Add NEXT_CHANGED argument, +- if true, force CHANGED for the recursive invocation. +- (reassociate_bb): Remember original length of ops array, pass +- len !=3D orig_len as NEXT_CHANGED in rewrite_expr_tree call. +- +-2017-07-27 Martin Liska +- +- Backport from mainline +- 2017-07-17 Martin Liska +- +- PR sanitizer/81302 +- * opts.c (finish_options): Do not allow -fgnu-tm +- w/ -fsanitize=3D{kernel-,}address. Say sorry. +- +-2017-07-27 Martin Liska +- +- Backport from mainline +- 2017-07-26 Martin Liska +- +- PR sanitize/81186 +- * function.c (expand_function_start): Make expansion of +- nonlocal_goto_save_area after parm_birth_insn. +- +-2017-07-27 Martin Liska +- +- Backport from mainline +- 2017-06-30 Martin Liska +- +- PR sanitizer/81021 +- * tree-eh.c (lower_resx): Call BUILT_IN_ASAN_HANDLE_NO_RETURN +- before BUILT_IN_UNWIND_RESUME when ASAN is used. +- +-2017-07-27 Martin Liska +- +- Backport from mainline +- 2017-06-28 Martin Liska +- +- PR sanitizer/81224 +- * asan.c (instrument_derefs): Bail out inner references +- that are hard register variables. +- +-2017-07-26 Sebastian Huber +- +- Backport from mainline +- 2017-07-26 Sebastian Huber +- +- * config/sparc/sparc.c (dump_target_flag_bits): Dump MASK_FSMULD. +- (sparc_option_override): Honour MASK_FSMULD. +- * config/sparc/sparc.h (MASK_FEATURES): Add MASK_FSMULD. +- * config/sparc/sparc.md (muldf3_extend): Use TARGET_FSMULD. +- * config/sparc/sparc.opt (mfsmuld): New option. +- * doc/invoke.texi (mfsmuld): Document option. +- +-2017-07-26 Georg-Johann Lay +- +- Backport from 2017-07-25 trunk r250499. +- +- PR 81487 +- * hsa-brig.c (brig_init): Use xasprintf instead of asprintf. +- * gimple-pretty-print.c (dump_probability): Same. +- * tree-ssa-structalias.c (alias_get_name): Same. +- +-2017-07-26 Richard Biener +- +- Backport from mainline +- 2017-06-18 Richard Biener +- +- PR tree-optimization/81410 +- * tree-vect-stmts.c (vectorizable_load): Properly adjust for +- the gap in the ! slp_perm SLP case after each group. +- +- 2017-07-25 Richard Biener +- +- PR tree-optimization/81455 +- * tree-ssa-loop-unswitch.c (find_loop_guard): Make sure to +- not walk in cycles when looking for guards. +- +- 2017-07-25 Richard Biener +- +- PR middle-end/81505 +- * fold-const.c (fold_negate_const): TREE_OVERFLOW should be +- sticky. +- +- 2017-06-28 Jakub Jelinek +- +- PR target/81175 +- * config/i386/i386.c (ix86_init_mmx_sse_builtins): Use def_builtin +- rather than def_builtin_pure for __builtin_ia32_gatherpf*. +- +- 2017-06-26 Richard Biener +- +- PR target/81175 +- * config/i386/i386.c (ix86_init_mmx_sse_builtins): +- Use def_builtin_pure for all gather builtins. +- +- 2017-06-21 Marc Glisse +- +- * config/i386/i386.c (struct builtin_isa): New field pure_p. +- Reorder for compactness. +- (def_builtin, def_builtin2, ix86_add_new_builtins): Handle pure_p. +- (def_builtin_pure, def_builtin_pure2): New functions. +- (ix86_init_mmx_sse_builtins) [__builtin_ia32_stmxcsr]: Mark as pure. +- +-2017-07-26 Sebastian Huber +- +- Backport from mainline +- 2017-07-26 Sebastian Huber +- +- * config/sparc/sparc.c (sparc_option_override): Remove MASK_FPU +- from all CPU target flags enable members. +- +-2017-07-26 Sebastian Huber +- +- Backport from mainline +- 2017-07-25 Sebastian Huber +- +- PR libgcc/61152 +- * config/aarch64/rtems.h: Add GCC Runtime Library Exception. +- Format changes. +- * config/arm/rtems.h: Likewise. +- * config/bfin/rtems.h: Likewise. +- * config/i386/rtemself.h: Likewise. +- * config/lm32/rtems.h: Likewise. +- * config/m32c/rtems.h: Likewise. +- * config/m68k/rtemself.h: Likewise. +- * config/microblaze/rtems.h: Likewise. +- * config/mips/rtems.h: Likewise. +- * config/moxie/rtems.h: Likewise. +- * config/nios2/rtems.h: Likewise. +- * config/rs6000/rtems.h: Likewise. +- * config/rtems.h: Likewise. +- * config/sh/rtems.h: Likewise. +- * config/sh/rtemself.h: Likewise. +- * config/sparc/rtemself.h: Likewise. +- +-2017-07-25 Bill Schmidt +- +- Backport from mainline +- 2017-07-14 Bill Schmidt +- +- PR tree-optimization/81162 +- * gimple-ssa-strength-reduction.c (replace_mult_candidate): Don't +- replace a negate with an add. +- +-2017-07-25 Georg-Johann Lay +- +- Backport from 2017-07-12 trunk r250151. +- +- PR target/81407 +- * config/avr/avr.c (avr_encode_section_info) +- [progmem && !TREE_READONLY]: Error if progmem object needs +- constructing. +- +-2017-07-25 Wilco Dijkstra +- +- PR target/79041 +- * config/aarch64/aarch64.c (aarch64_classify_symbol): +- Avoid SYMBOL_SMALL_ABSOLUTE for literals with pc-relative literals. +- +-2017-07-25 Georg-Johann Lay +- +- Backport from trunk r247719. +- +- 2017-05-06 Richard Sandiford +- +- PR rtl-optimization/75964 +- * simplify-rtx.c (simplify_const_relational_operation): Remove +- invalid handling of comparisons of integer ABS. +- +-2017-07-25 Bin Cheng +- +- Backport from 2017-07-20 trunk r250384. +- +- PR tree-optimization/81388 +- Revert r238585: +- 2016-07-21 Bin Cheng +- +- * tree-ssa-loop-niter.c (number_of_iterations_lt_to_ne): Clean up +- by removing computation of may_be_zero. +- +-2017-07-23 Uros Bizjak +- +- PR target/80569 +- * config/i386/i386.c (ix86_option_override_internal): Disable +- BMI, BMI2 and TBM instructions for -m16. +- +-2017-07-19 Michael Meissner +- +- Back port from trunk +- 2017-07-12 Michael Meissner +- +- PR target/81193 +- * config/rs6000/rs6000-c.c (rs6000_cpu_cpp_builtins): If GLIBC +- provides the hardware capability bits, define the macro +- __BUILTIN_CPU_SUPPORTS__. +- * config/rs6000/rs6000.c (cpu_expand_builtin): Generate a warning +- if GLIBC does not provide the hardware capability bits. Add a +- gcc_unreachable call if the built-in cpu function is neither +- __builtin_cpu_is nor __builtin_cpu_supports. +- * doc/extend.texi (PowerPC built-in functions): Document that +- GLIBC 2.23 or newer is needed by __builtin_cpu_is and +- __builtin_cpu_supports. Document the macros defined by GCC if the +- newer GLIBC is available. +- +-2017-07-18 Uros Bizjak +- +- PR target/81471 +- * config/i386/i386.md (rorx_immediate_operand): New mode attribute. +- (*bmi2_rorx3_1): Use rorx_immediate_operand as +- operand 2 predicate. +- (*bmi2_rorxsi3_1_zext): Use const_0_to_31_operand as +- operand 2 predicate. +- (ror,rol -> rorx splitters): Use const_int_operand as +- operand 2 predicate. +- +-2017-07-18 Tom de Vries +- +- backport from mainline: +- PR target/81069 +- 2017-07-17 Tom de Vries +- +- * config/nvptx/nvptx.c (nvptx_single): Insert diverging branch as late +- as possible. +- +-2017-07-18 Georg-Johann Lay +- +- Backport from 2017-07-18 trunk r250301. +- +- PR target/81473 +- * config/avr/avr.c (avr_optimize_casesi): Don't use +- INT8_MIN, INT8_MAX, UINT8_MAX, INT16_MIN, INT16_MAX, UINT16_MAX. +- +-2017-07-17 Jakub Jelinek +- +- PR tree-optimization/81428 +- * match.pd (X / X -> one): Don't optimize _Fract divisions, as 1 +- can't be built for those types. +- +- PR tree-optimization/81365 +- * tree-ssa-phiprop.c (propagate_with_phi): When considering hoisting +- aggregate moves onto bb predecessor edges, make sure there are no +- loads that could alias the lhs in between the start of bb and the +- loads from *phi. +- +- Backported from mainline +- 2017-06-30 Jakub Jelinek +- +- PR target/81225 +- * config/i386/sse.md (vec_extract_lo_): For +- V8FI, V16FI and VI8F_256 iterators, use instead +- of nonimmediate_operand and instead of m for +- the input operand. For V8FI iterator, always split if input is a MEM. +- For V16FI and V8SF_256 iterators, don't test if both operands are MEM +- if . For VI4F_256 iterator, use +- instead of register_operand and instead of v for +- the input operand. Make sure both operands aren't MEMs for if not +- . +- +-2017-07-17 Georg-Johann Lay +- +- Backport from 2017-07-17 trunk r250258. +- +- PR 80929 +- * config/avr/avr.c (avr_mul_highpart_cost): New static function. +- (avr_rtx_costs_1) [TRUNCATE]: Use it to compute mul_highpart cost. +- [LSHIFTRT, outer_code =3D TRUNCATE]: Same. +- +-2017-07-17 Sebastian Huber +- +- Backport from mainline +- 2017-07-17 Sebastian Huber +- +- * gcc/config/sparc/rtemself.h (TARGET_OS_CPP_BUILTINS): Add +- conditional builtin define __FIX_LEON3FT_B2BST. +- +-2017-07-17 Daniel Cederman +- +- Backport from mainline +- 2017-07-17 Daniel Cederman +- +- * config/sparc/t-rtems: Add mfix-gr712rc multilibs. Replace +- MULTILIB_EXCEPTIONS with MULTILIB_REQUIRED. Match -mfix-gr712rc +- with -mfix-ut700. +- +-2017-07-16 Eric Botcazou +- +- PR rtl-optimization/81424 +- * optabs.c (prepare_cmp_insn): Use copy_to_reg instead of force_reg +- to remove potential trapping from operands if -fnon-call-exceptions. +- +-2017-07-16 Daniel Cederman +- +- * config/sparc/sparc.md (divdf3_fix): Add NOP to prevent back +- to back store errata sensitive sequence from being generated. +- (sqrtdf2_fix): Likewise. +- +-2017-07-12 Georg-Johann Lay +- +- Backport from 2017-07-12 trunk r250156. +- +- PR target/79883 +- * config/avr/avr.c (avr_set_current_function): In diagnostic +- messages: Quote keywords and (parts of) identifiers. +- [WITH_AVRLIBC]: Warn for functions named "ISR", "SIGNAL" or +- "INTERRUPT". +- +-2017-07-11 Daniel Cederman +- +- * config/sparc/sparc.opt (mfix-ut700): New option. +- (mfix-gr712rc): Likewise. +- (sparc_fix_b2bst): New variable. +- * doc/invoke.texi (SPARC options): Document them. +- (ARM options): Fix warnings. +- * config/sparc/sparc.c (sparc_do_work_around_errata): Insert NOP +- instructions to prevent sequences that can trigger the store-store +- errata for certain LEON3FT processors. +- (pass_work_around_errata::gate): Also test sparc_fix_b2bst. +- (sparc_option_override): Set sparc_fix_b2bst appropriately. +- * config/sparc/sparc.md (fix_b2bst): New attribute. +- (in_branch_delay): Prevent stores in delay slot if fix_b2bst. +- +-2017-07-10 Uros Bizjak +- +- PR target/81375 +- * config/i386/i386.md (divsf3): Add TARGET_SSE to TARGET_SSE_MATH. +- (rcpps): Ditto. +- (*rsqrtsf2_sse): Ditto. +- (rsqrtsf2): Ditto. +- (div3): Macroize insn from divdf3 and divsf3 +- using MODEF mode iterator. +- +-2017-07-07 Michael Meissner +- +- Backport from mainline +- 2017-07-07 Michael Meissner +- +- PR target/81348 +- * config/rs6000/rs6000.md (HI sign_extend splitter): Use the +- correct operand in doing the split. +- +-2017-07-07 Jose E. Marchesi +- +- * config/sparc/m8.md: New file. +- * config/sparc/sparc.md: Include m8.md. +- +-2017-07-07 Jose E. Marchesi +- +- * config/sparc/sparc.opt: New option -mvis4b. +- * config/sparc/sparc.c (dump_target_flag_bits): Handle MASK_VIS4B. +- (sparc_option_override): Handle VIS4B. +- (enum sparc_builtins): Define +- SPARC_BUILTIN_DICTUNPACK{8,16,32}, +- SPARC_BUILTIN_FPCMP{LE,GT,EQ,NE}{8,16,32}SHL, +- SPARC_BUILTIN_FPCMPU{LE,GT}{8,16,32}SHL, +- SPARC_BUILTIN_FPCMPDE{8,16,32}SHL and +- SPARC_BUILTIN_FPCMPUR{8,16,32}SHL. +- (check_constant_argument): New function. +- (sparc_vis_init_builtins): Define builtins +- __builtin_vis_dictunpack{8,16,32}, +- __builtin_vis_fpcmp{le,gt,eq,ne}{8,16,32}shl, +- __builtin_vis_fpcmpu{le,gt}{8,16,32}shl, +- __builtin_vis_fpcmpde{8,16,32}shl and +- __builtin_vis_fpcmpur{8,16,32}shl. +- (sparc_expand_builtin): Check that the constant operands to +- __builtin_vis_fpcmp*shl and _builtin_vis_dictunpack* are indeed +- constant and in range. +- * config/sparc/sparc-c.c (sparc_target_macros): Handle +- TARGET_VIS4B. +- * config/sparc/sparc.h (SPARC_IMM2_P): Define. +- (SPARC_IMM5_P): Likewise. +- * config/sparc/sparc.md (cpu_feature): Add new feagure "vis4b". +- (enabled): Handle vis4b. +- (UNSPEC_DICTUNPACK): New unspec. +- (UNSPEC_FPCMPSHL): Likewise. +- (UNSPEC_FPUCMPSHL): Likewise. +- (UNSPEC_FPCMPDESHL): Likewise. +- (UNSPEC_FPCMPURSHL): Likewise. +- (cpu_feature): New CPU feature `vis4b'. +- (dictunpack{8,16,32}): New insns. +- (FPCSMODE): New mode iterator. +- (fpcscond): New code iterator. +- (fpcsucond): Likewise. +- (fpcmp{le,gt,eq,ne}{8,16,32}{si,di}shl): New insns. +- (fpcmpu{le,gt}{8,16,32}{si,di}shl): Likewise. +- (fpcmpde{8,16,32}{si,di}shl): Likewise. +- (fpcmpur{8,16,32}{si,di}shl): Likewise. +- * config/sparc/constraints.md: Define constraints `q' for unsigned +- 2-bit integer constants and `t' for unsigned 5-bit integer +- constants. +- * config/sparc/predicates.md (imm5_operand_dictunpack8): New +- predicate. +- (imm5_operand_dictunpack16): Likewise. +- (imm5_operand_dictunpack32): Likewise. +- (imm2_operand): Likewise. +- * doc/invoke.texi (SPARC Options): Document -mvis4b. +- * doc/extend.texi (SPARC VIS Built-in Functions): Document the +- ditunpack* and fpcmp*shl builtins. +- +-2017-07-07 Jose E. Marchesi +- +- * config.gcc: Handle m8 in --with-{cpu,tune} options. +- * config.in: Add HAVE_AS_SPARC6 define. +- * config/sparc/driver-sparc.c (cpu_names): Add entry for the SPARC +- M8. +- * config/sparc/sol2.h (CPP_CPU64_DEFAULT_SPEC): Define for +- TARGET_CPU_m8. +- (ASM_CPU32_DEFAUILT_SPEC): Likewise. +- (CPP_CPU_SPEC): Handle m8. +- (ASM_CPU_SPEC): Likewise. +- * config/sparc/sparc-opts.h (enum processor_type): Add +- PROCESSOR_M8. +- * config/sparc/sparc.c (m8_costs): New struct. +- (sparc_option_override): Handle TARGET_CPU_m8. +- (sparc32_initialize_trampoline): Likewise. +- (sparc64_initialize_trampoline): Likewise. +- (sparc_issue_rate): Likewise. +- (sparc_register_move_cost): Likewise. +- * config/sparc/sparc.h (TARGET_CPU_m8): Define. +- (CPP_CPU64_DEFAULT_SPEC): Define for M8. +- (ASM_CPU64_DEFAULT_SPEC): Likewise. +- (CPP_CPU_SPEC): Handle M8. +- (ASM_CPU_SPEC): Likewise. +- (AS_M8_FLAG): Define. +- * config/sparc/sparc.md: Add m8 to the cpu attribute. +- * config/sparc/sparc.opt: New option -mcpu=3Dm8 for sparc targets. +- * configure.ac (HAVE_AS_SPARC6): Check for assembler support for +- M8 instructions. +- * configure: Regenerate. +- * doc/invoke.texi (SPARC Options): Document -mcpu=3Dm8 and +- -mtune=3Dm8. +- +-2017-07-07 Jose E. Marchesi +- +- * config/sparc/niagara7.md: Rework the DFA scheduler to use insn +- subtypes. +- * config/sparc/sparc.md: Remove the `v3pipe' insn attribute. +- ("*movdi_insn_sp32"): Do not set v3pipe. +- ("*movsi_insn"): Likewise. +- ("*movdi_insn_sp64"): Likewise. +- ("*movsf_insn"): Likewise. +- ("*movdf_insn_sp32"): Likewise. +- ("*movdf_insn_sp64"): Likewise. +- ("*zero_extendsidi2_insn_sp64"): Likewise. +- ("*sign_extendsidi2_insn"): Likewise. +- ("*mov_insn"): Likewise. +- ("*mov_insn_sp64"): Likewise. +- ("*mov_insn_sp32"): Likewise. +- ("3"): Likewise. +- ("3"): Likewise. +- ("*not_3"): Likewise. +- ("*nand_vis"): Likewise. +- ("*_not1_vis"): Likewise. +- ("*_not2_vis"): Likewise. +- ("one_cmpl2"): Likewise. +- ("faligndata_vis"): Likewise. +- ("alignaddrsi_vis"): Likewise. +- ("alignaddrdi_vis"): Likweise. +- ("alignaddrlsi_vis"): Likewise. +- ("alignaddrldi_vis"): Likewise. +- ("fcmp_vis"): Likewise. +- ("bmaskdi_vis"): Likewise. +- ("bmasksi_vis"): Likewise. +- ("bshuffle_vis"): Likewise. +- ("cmask8_vis"): Likewise. +- ("cmask16_vis"): Likewise. +- ("cmask32_vis"): Likewise. +- ("pdistn_vis"): Likewise. +- ("3"): Likewise. +- +-2017-07-07 Jose E. Marchesi +- +- * config/sparc/sparc.md ("subtype"): New insn attribute. +- ("*wrgsr_sp64"): Set insn subtype. +- ("*rdgsr_sp64"): Likewise. +- ("alignaddrsi_vis"): Likewise. +- ("alignaddrdi_vis"): Likewise. +- ("alignaddrlsi_vis"): Likewise. +- ("alignaddrldi_vis"): Likewise. +- ("3"): Likewise. +- ("fexpand_vis"): Likewise. +- ("fpmerge_vis"): Likewise. +- ("faligndata_vis"): Likewise. +- ("bshuffle_vis"): Likewise. +- ("cmask8_vis"): Likewise. +- ("cmask16_vis"): Likewise. +- ("cmask32_vis"): Likewise. +- ("fchksm16_vis"): Likewise. +- ("v3"): Likewise. +- ("fmean16_vis"): Likewise. +- ("fp64_vis"): Likewise. +- ("v8qi3"): Likewise. +- ("3"): Likewise. +- ("3"): Likewise. +- ("3"): Likewise. +- ("v8qi3"): Likewise. +- ("3"): Likewise. +- ("*movqi_insn"): Likewise. +- ("*movhi_insn"): Likewise. +- ("*movsi_insn"): Likewise. +- ("movsi_pic_gotdata_op"): Likewise. +- ("*movdi_insn_sp32"): Likewise. +- ("*movdi_insn_sp64"): Likewise. +- ("movdi_pic_gotdata_op"): Likewise. +- ("*movsf_insn"): Likewise. +- ("*movdf_insn_sp32"): Likewise. +- ("*movdf_insn_sp64"): Likewise. +- ("*zero_extendhisi2_insn"): Likewise. +- ("*zero_extendqihi2_insn"): Likewise. +- ("*zero_extendqisi2_insn"): Likewise. +- ("*zero_extendqidi2_insn"): Likewise. +- ("*zero_extendhidi2_insn"): Likewise. +- ("*zero_extendsidi2_insn_sp64"): Likewise. +- ("ldfsr"): Likewise. +- ("prefetch_64"): Likewise. +- ("prefetch_32"): Likewise. +- ("tie_ld32"): Likewise. +- ("tie_ld64"): Likewise. +- ("*tldo_ldub_sp32"): Likewise. +- ("*tldo_ldub1_sp32"): Likewise. +- ("*tldo_ldub2_sp32"): Likewise. +- ("*tldo_ldub_sp64"): Likewise. +- ("*tldo_ldub1_sp64"): Likewise. +- ("*tldo_ldub2_sp64"): Likewise. +- ("*tldo_ldub3_sp64"): Likewise. +- ("*tldo_lduh_sp32"): Likewise. +- ("*tldo_lduh1_sp32"): Likewise. +- ("*tldo_lduh_sp64"): Likewise. +- ("*tldo_lduh1_sp64"): Likewise. +- ("*tldo_lduh2_sp64"): Likewise. +- ("*tldo_lduw_sp32"): Likewise. +- ("*tldo_lduw_sp64"): Likewise. +- ("*tldo_lduw1_sp64"): Likewise. +- ("*tldo_ldx_sp64"): Likewise. +- ("*mov_insn"): Likewise. +- ("*mov_insn_sp64"): Likewise. +- ("*mov_insn_sp32"): Likewise. +- +-2017-07-07 Jose E. Marchesi +- +- * config/sparc/sparc.md ("type"): New insn type viscmp. +- ("fcmp_vis"): Set insn type to +- viscmp. +- ("fpcmp8_vis"): Likewise. +- ("fucmp8_vis"): Likewise. +- ("fpcmpu_vis"): Likewise. +- * config/sparc/niagara7.md ("n7_vis_logical_v3pipe"): Handle +- viscmp. +- ("n7_vis_logical_11cycle"): Likewise. +- * config/sparc/niagara4.md ("n4_vis_logical"): Likewise. +- * config/sparc/niagara2.md ("niag3_vis": Likewise. +- * config/sparc/niagara.md ("niag_vis"): Likewise. +- * config/sparc/ultra3.md ("us3_fga"): Likewise. +- * config/sparc/ultra1_2.md ("us1_fga_double"): Likewise. +- +-2017-07-07 Jose E. Marchesi +- +- * config/sparc/sparc.md: New instruction type `bmask'. +- (bmaskdi_vis): Use the `bmask' type. +- (bmasksi_vis): Likewise. +- * config/sparc/ultra3.md (us3_array): Likewise. +- * config/sparc/niagara7.md (n7_array): Likewise. +- * config/sparc/niagara4.md (n4_array): Likewise. +- * config/sparc/niagara2.md (niag2_vis): Likewise. +- (niag3_vis): Likewise. +- * config/sparc/niagara.md (niag_vis): Likewise. +- +-2017-07-05 Georg-Johann Lay +- +- Backport from 2017-07-05 trunk r249995. +- +- PR target/81305 +- * config/avr/avr.c (avr_out_movhi_mr_r_xmega) [CONSTANT_ADDRESS_P]: +- Don't depend on "optimize > 0". +- (out_movhi_r_mr, out_movqi_mr_r): Same. +- (out_movhi_mr_r, out_movqi_r_mr): Same. +- (avr_address_cost) [CONSTANT_ADDRESS_P]: Don't depend cost for +- io_address_operand on "optimize > 0". +- +-2017-07-04 Uros Bizjak +- +- PR target/81300 +- * config/i386/i386.md (setcc + movzbl/and to xor + setcc peepholes): +- Require dead FLAGS_REG at the beginning of a peephole. +- +-2017-07-04 Uros Bizjak +- +- PR target/81294 +- * config/i386/adxintrin.h (_subborrow_u32): Swap _X and _Y +- arguments in the call to __builtin_ia32_sbb_u32. +- (_subborrow_u64): Swap _X and _Y arguments in the call to +- __builtin_ia32_sbb_u64. +- +-2017-07-03 Segher Boessenkool +- +- Backport from trunk: +- +- 2017-06-15 Segher Boessenkool +- +- * config/rs6000/rs6000.md (add3): Use reg_or_subregno instead +- of REGNO. +- +-2017-07-03 Tom de Vries +- +- backport from mainline: +- PR tree-optimization/81192 +- 2017-07-03 Tom de Vries +- +- * tree-ssa-tail-merge.c (same_succ_flush_bb): Handle +- BB_SAME_SUCC (bb) =3D=3D NULL. +- +-2017-06-29 Michael Meissner +- +- Backport from mainline +- 2017-06-23 Michael Meissner +- +- PR target/80510 +- * config/rs6000/rs6000.md (ALTIVEC_DFORM): Do not allow DImode in +- 32-bit, since indexed is not valid for DImode. +- (mov_hardfloat32): Reorder ISA 2.07 load/stores before ISA +- 3.0 d-form load/stores to be the same as mov_hardfloat64. +- (define_peephole2 for Altivec d-form load): Add 32-bit support. +- (define_peephole2 for Altivec d-form store): Likewise. +- +- Backport from mainline +- 2017-06-20 Michael Meissner +- +- PR target/79799 +- * config/rs6000/rs6000.c (rs6000_expand_vector_init): Add support +- for doing vector set of SFmode on ISA 3.0. +- * config/rs6000/vsx.md (vsx_set_v4sf_p9): Likewise. +- (vsx_set_v4sf_p9_zero): Special case setting 0.0f to a V4SF +- element. +- (vsx_insert_extract_v4sf_p9): Add an optimization for inserting a +- SFmode value into a V4SF variable that was extracted from another +- V4SF variable without converting the element to double precision +- and back to single precision vector format. +- (vsx_insert_extract_v4sf_p9_2): Likewise. +- +-2017-06-29 Richard Biener +- +- Backport from mainline +- 2017-06-19 Richard Biener +- +- PR ipa/81112 +- * ipa-prop.c (find_constructor_constant_at_offset): Handle +- RANGE_EXPR conservatively. +- +-2017-06-28 Richard Biener +- +- Backport from mainline +- 2017-06-09 Richard Biener +- +- PR middle-end/81007 +- * ipa-polymorphic-call.c +- (ipa_polymorphic_call_context::restrict_to_inner_class): +- Skip FIELD_DECLs with error_mark_node type. +- * passes.def (all_lowering_passes): Run pass_build_cgraph_edges +- last again. +- +- 2017-06-14 Richard Biener +- +- PR tree-optimization/81083 +- * tree-ssa-sccvn.c (vn_reference_lookup_3): Do not use abnormals +- as values. +- +-2017-06-27 Segher Boessenkool +- +- Backports from trunk: +- +- 2017-05-17 Segher Boessenkool +- PR middle-end/80692 +- * real.c (do_compare): Give decimal_do_compare preference over +- comparing just the signs. +- +- 2017-05-31 Segher Boessenkool +- PR target/80618 +- * config/rs6000/vector.md (*vector_uneq): Write the nor in the +- splitter result in the canonical way. +- +- 2017-06-09 Segher Boessenkool +- PR target/80966 +- * config/rs6000/rs6000.c (rs6000_emit_allocate_stack): Assert that +- gen_add3_insn did not fail. +- * config/rs6000/rs6000.md (add3): If asked to add a constant to +- r0, construct that number in a temporary reg and add that reg to r0. +- If asked to put the result in r0 as well, fail. +- +- 2017-06-23 Segher Boessenkool +- PR middle-end/80902 +- * builtins.c (expand_builtin_atomic_fetch_op): If emitting code after +- a call, force the call to not be a tail call. +- +-2017-06-27 Jakub Jelinek +- +- PR sanitizer/81209 +- * ubsan.c (ubsan_encode_value): Initialize DECL_CONTEXT on var. +- +- PR middle-end/81207 +- * gimple-fold.c (replace_call_with_call_and_fold): Handle +- gimple_vuse copying separately from gimple_vdef copying. +- +-2017-06-24 Jim Wilson +- +- * config/aarch64/aarch64-cost-tables.h (qdf24xx_extra_costs): Move to +- here. +- * config/arm/aarch-cost-tables.h (qdf24xx_extra_costs): From here. +- * config/arm/arm-cpu-cdata.h: Regenerate. +- * config/arm/arm-cpu-data.h, config/arm/arm-cpu.h: Likewise. +- * config/arm/arm-tables.opt, config/arm/arm-tune.md: Likewise. +- * config/arm/arm-cpus.in: Delete falkor and qdf24xx entries. +- * config/arm/arm.c (arm_qdf24xx_tune): Delete. +- * config/arm/bpabi.h (BE8_LINK_SPEC): Delete falkor and qdf24xx +- support. +- * config/arm/t-aprofile (MULTILIB_MATCHES): Delete falkor and qdf24xx +- support. +- * config/arm/t-rmprofile: Likewise. +- * doc/invoke.texi (ARM Options): Drop falkor and qdf24xx support. +- +-2017-06-24 Marek Polacek +- +- Backport from mainline +- 2017-05-04 Marek Polacek +- +- PR tree-optimization/80612 +- * calls.c (get_size_range): Check for INTEGRAL_TYPE_P. +- +-2017-06-23 Thomas Preud'homme +- +- Backport from mainline +- 2017-05-04 Prakhar Bahuguna +- +- * config/arm/arm-builtins.c (arm_init_builtins): Rename +- __builtin_arm_ldfscr to __builtin_arm_get_fpscr, and rename +- __builtin_arm_stfscr to __builtin_arm_set_fpscr. +- +-2017-06-23 Jonathan Wakely +- +- PR c++/81187 +- * doc/invoke.texi (-Wnoexcept-type): Fix name of option, from +- -Wnoexcept. +- +-2017-06-22 Martin Liska +- +- Backport from mainline +- 2017-06-19 Martin Liska +- +- PR sanitizer/80879 +- * gimplify.c (gimplify_switch_expr): +- Initialize live_switch_vars for SWITCH_BODY =3D=3D STATEMENT_LIST. +- +-2017-06-22 Martin Liska +- +- Backport from mainline +- 2017-05-31 Martin Liska +- +- PR target/79155 +- * config/i386/cpuid.h: Fix typo in a comment in cpuid.h. +- +-2017-06-22 Martin Liska +- +- Backport from mainline +- 2017-05-30 Martin Liska +- +- PR other/80909 +- * auto-profile.c (get_function_decl_from_block): Fix +- parenthesis. +- +-2017-06-22 Martin Liska +- +- Backport from mainline +- 2017-05-26 Martin Liska +- +- PR ipa/80663 +- * params.def: Bound partial-inlining-entry-probability param. +- +-2017-06-22 Martin Liska +- +- Backport from mainline +- 2017-05-16 Martin Liska +- +- PR ipa/79849. +- PR ipa/79850. +- * ipa-devirt.c (warn_types_mismatch): Fix typo. +- (odr_types_equivalent_p): Likewise. +- +-2017-06-22 Martin Liska +- +- Backport from mainline +- 2017-05-15 Martin Liska +- +- PR driver/31468 +- * gcc.c (process_command): Do not allow empty argument of -o option. +- +-2017-06-22 Martin Liska +- +- Backport from mainline +- 2017-05-02 Martin Liska +- +- * doc/gcov.texi: Add missing preposition. +- * gcov.c (function_info::function_info): Properly fill up +- all member variables. +- +-2017-06-22 Martin Liska +- +- Backport from mainline +- 2017-05-02 Martin Liska +- +- PR other/80589 +- * common.opt: Fix typo. +- * doc/invoke.texi: Likewise. +- +-2017-06-22 Martin Liska +- +- Backport from mainline +- 2017-04-28 Martin Liska +- +- * doc/gcov.texi: Enhance documentation of gcov. +- +-2017-06-22 Martin Liska +- +- Backport from mainline +- 2017-04-28 Martin Liska +- +- * doc/gcov.texi: Sort options in alphabetic order. +- * doc/gcov-dump.texi: Likewise. +- * doc/gcov-tool.texi: Likewise. +- * gcov.c (print_usage): Likewise. +- * gcov-dump.c (print_usage): Likewise. +- * gcov-tool.c (print_merge_usage_message): Likewise. +- (print_rewrite_usage_message): Likewise. +- (print_overlap_usage_message): Likewise. +- +-2017-06-22 Martin Liska +- +- Backport from mainline +- 2017-04-28 Martin Liska +- +- PR gcov-profile/53915 +- * gcov.c (format_gcov): Print 'NAN %' when top > bottom. +- +-2017-06-22 Martin Liska +- +- Backport from mainline +- 2017-04-28 Martin Liska +- +- PR driver/56469 +- * coverage.c (coverage_remove_note_file): New function. +- * coverage.h: Declare the function. +- * toplev.c (finalize): Clean if an error has been seen. +- +-2017-06-21 Jakub Jelinek +- +- PR target/81151 +- * config/i386/sse.md (round2): Renumber match_dup and +- operands indexes to avoid gap between operands and match_dups. +- +- PR c++/81130 +- * gimplify.c (omp_add_variable): Don't force GOVD_SEEN for types +- with ctors/dtors if GOVD_SHARED is set. +- +- Backported from mainline +- 2017-06-20 Jakub Jelinek +- +- PR target/81121 +- * config/i386/i386.md (TARGET_USE_VECTOR_CONVERTS float si->{sf,df} +- splitter): Require TARGET_SSE2 in the condition. +- +- PR sanitizer/81125 +- * ubsan.h (ubsan_encode_value): Workaround buggy clang++ parser +- by removing enum keyword. +- (ubsan_type_descriptor): Likewise. Formatting fix. +- +- 2017-06-19 Jakub Jelinek +- +- PR sanitizer/81125 +- * ubsan.h (enum ubsan_encode_value_phase): New. +- (ubsan_encode_value): Change second argument to +- enum ubsan_encode_value_phase with default value of +- UBSAN_ENCODE_VALUE_GENERIC. +- * ubsan.c (ubsan_encode_value): Change second argument to +- enum ubsan_encode_value_phase PHASE from bool IN_EXPAND_P, +- adjust uses, for UBSAN_ENCODE_VALUE_GENERIC use just +- create_tmp_var_raw instead of create_tmp_var and use a +- TARGET_EXPR. +- (ubsan_expand_bounds_ifn, ubsan_build_overflow_builtin, +- instrument_bool_enum_load, ubsan_instrument_float_cast): Adjust +- ubsan_encode_value callers. +- +- PR sanitizer/81111 +- * ubsan.c (ubsan_encode_value): If current_function_decl is NULL, +- use create_tmp_var_raw instead of create_tmp_var, mark it addressable +- just by setting TREE_ADDRESSABLE on the result and use a TARGET_EXPR. +- +-2017-06-20 James Greenhalgh +- +- Backport from Mainline +- * config/aarch64/aarch64-option-extensions.def (fp16): Fix expected +- feature string. +- +-2017-06-20 Andreas Schwab +- +- PR target/80970 +- * config/m68k/m68k.md (bsetdreg, bchgdreg, bclrdreg): Use "=3Dd" +- instead of "+d". +- +-2017-06-19 James Greenhalgh +- +- Backport from mainline +- 2017-06-19 James Greenhalgh +- +- PR target/71778 +- * config/arm/arm-builtins.c (arm_expand_builtin_args): Return TARGET +- if given a non-constant argument for an intrinsic which requires a +- constant. +- +-2017-06-19 Alexander Monakov +- +- * doc/invoke.texi (mcx16): Rewrite. +- +-2017-06-15 Eric Botcazou +- +- PR rtl-optimization/80474 +- * reorg.c (update_block): Do not ignore instructions in a delay slot. +- +-2017-06-14 Eric Botcazou +- +- * config/sparc/sparc.h (MASK_ISA): Add MASK_LEON and MASK_LEON3. +- (MASK_FEATURES): New macro. +- * config/sparc/sparc.c (sparc_option_override): Remove the special +- handling of -mfpu and generalize it to all MASK_FEATURES switches. +- +-2017-06-14 Eric Botcazou +- +- * config/sparc/driver-sparc.c (cpu_names): Add SPARC-T5 entry. +- +-2017-06-12 David S. Miller +- +- PR target/80968 +- * config/sparc/sparc.md (return expander): Emit frame blockage if +- function uses alloca. +- +-2017-06-08 Uros Bizjak +- +- PR target/81015 +- Revert: +- 2016-12-14 Uros Bizjak +- +- PR target/59874 +- * config/i386/i386.md (*ctzhi2): New insn_and_split pattern. +- (*clzhi2): Ditto. +- +-2017-06-08 David Edelsohn +- +- Backport from mainline +- 2017-06-02 David Edelsohn +- +- * dwarf2out.c (DWARF_INITIAL_LENGTH_SIZE_STR): New. +- (dl_section_ref): New. +- (dwarf2out_finish): Copy debug_line_section_label to dl_section_ref. +- On AIX, append an expression to subtract the size of the +- section length to dl_section_ref. +- +-2017-06-07 Richard Biener +- +- Backport from mainline +- 2017-05-02 Richard Biener +- +- PR tree-optimization/80549 +- * tree-cfgcleanup.c (mfb_keep_latches): New helper. +- (cleanup_tree_cfg_noloop): Create forwarders to known loop +- headers if they do not have a preheader. +- +- 2017-05-26 Richard Biener +- +- PR tree-optimization/80842 +- * tree-ssa-ccp.c (set_lattice_value): Always meet with the old +- value. +- +- 2017-05-31 Richard Biener +- +- PR tree-optimization/80906 +- * graphite-isl-ast-to-gimple.c (copy_loop_close_phi_nodes): Get +- and pass through iv_map. +- (copy_bb_and_scalar_dependences): Adjust. +- (translate_pending_phi_nodes): Likewise. +- (copy_loop_close_phi_args): Handle code-generating IVs instead +- of ICEing. +- +- 2017-05-11 Richard Biener +- +- PR tree-optimization/80705 +- * tree-vect-data-refs.c (vect_analyze_data_refs): DECL_NONALIASED +- bases are not vectorizable. +- +-2017-06-06 Michael Meissner +- +- Back port from mainline +- 2017-05-19 Michael Meissner +- +- PR target/80718 +- * config/rs6000/vsx.md (vsx_splat_, VSX_D iterator): Prefer +- VSX registers over GPRs, particularly on ISA 2.07 which does not +- have the MTVSRDD instruction. +- +-2017-06-06 David S. Miller +- +- PR target/80968 +- * config/sparc/sparc.c (sparc_expand_prologue): Emit frame +- blockage if function uses alloca. +- +-2017-06-05 Volker Reichelt +- +- * doc/invoke.texi (-Wduplicated-branches): Add to warning list. +- +-2017-06-02 Prakhar Bahuguna +- +- Backport from mainline +- 2017-05-05 Andre Vieira +- Prakhar Bahuguna +- +- PR target/71607 +- * config/arm/arm.md (use_literal_pool): Remove. +- (64-bit immediate split): No longer takes cost into consideration +- if arm_disable_literal_pool is enabled. +- * config/arm/arm.c (arm_tls_referenced_p): Add diagnostic if TLS is +- used when arm_disable_literal_pool is enabled. +- (arm_max_const_double_inline_cost): Remove use of +- arm_disable_literal_pool. +- (push_minipool_fix): Add assert. +- (arm_reorg): Add return if arm_disable_literal_pool is enabled. +- * config/arm/vfp.md (no_literal_pool_df_immediate): New. +- (no_literal_pool_sf_immediate): New. +- +-2017-06-02 Jakub Jelinek +- +- PR rtl-optimization/80903 +- * loop-doloop.c (add_test): Unshare sequence. +- +-2017-05-31 Martin Jambor +- +- Backport from mainline +- 2017-04-24 Martin Jambor +- +- PR tree-optimization/80293 +- * tree-sra.c (scalarizable_type_p): New parameter const_decl, make +- char arrays not totally scalarizable if it is false. +- (analyze_all_variable_accesses): Pass correct value in the new +- parameter. Add a statistics counter. +- +-2017-05-30 Max Filippov +- +- Backport from mainline +- 2017-05-29 Max Filippov +- +- * config/xtensa/xtensa.c (xtensa_emit_call): Use +- HOST_WIDE_INT_PRINT_HEX instead of 0x%lx format string. +- (print_operand): Use HOST_WIDE_INT_PRINT_DEC instead of %ld +- format string. +- +-2017-05-29 Eric Botcazou +- +- * doc/install.texi (Options specification): Restore entry of +- --enable-sjlj-exceptions. +- +-2017-05-29 Andreas Krebbel +- +- Backport from mainline +- 2017-05-24 Andreas Krebbel +- +- PR target/80725 +- * config/s390/s390.c (s390_check_qrst_address): Check incoming +- address against address_operand predicate. +- * config/s390/s390.md ("*indirect_jump"): Swap alternatives. +- +-2017-05-28 Uros Bizjak +- +- Backport from mainline +- 2017-05-23 Uros Bizjak +- +- * config/i386/i386.md (*movdi_internal): Remove SSE4 +- alternative 18 (?r, *v). Update insn attributes. +- (*movsi_internal): Remove SSE4 alternative 13 (?r, *v). +- Update insn attributes. +- (*zero_extendsidi2): Remove SSE4 alternative (?r, *x). +- Update insn attributes. +- * config/i386/sse.md (vec_extract_0): Remove SSE4 +- alternative 1 (r, v). Remove isa attribute. +- * config/i386/i386.c (dimode_scalar_chain::make_vector_copies): +- Always move value through stack for !TARGET_INTER_UNIT_MOVES_TO_VEC +- and !TARGET_INTER_UNIT_MOVES_TO_VEC targets. +- +- 2017-05-16 Uros Bizjak +- +- * config/i386/i386.md (*movsi_internal): Split (?rm,*y) alternative +- to (?r,*Yn) and (?m,*y) alternatives, and (?*y,rm) to (?*Ym,r) +- and (?*y,m). Update insn attributes. +- +-2017-05-26 Sheldon Lobo +- +- Backported from mainline +- 2017-05-24 Sheldon Lobo +- +- * config/sparc/sparc.md (length): Return the correct value for -mflat +- sibcalls to match output_sibcall. +- +-2017-05-26 Marek Polacek +- +- Backported from mainline +- 2017-05-26 Marek Polacek +- +- PR sanitizer/80875 +- * fold-const.c (fold_binary_loc) : Check if OP1 +- can be negated. +- +-2017-05-26 Jakub Jelinek +- +- Backported from mainline +- 2017-05-22 Jakub Jelinek +- +- PR middle-end/80809 +- * omp-low.c (finish_taskreg_remap): New function. +- (finish_taskreg_scan): If unit size of ctx->record_type +- is non-constant, unshare the size expression and replace +- decls in it with possible outer var refs. +- +- PR middle-end/80809 +- * gimplify.c (omp_add_variable): For GOVD_DEBUG_PRIVATE use +- GOVD_SHARED rather than GOVD_PRIVATE with it. +- (gimplify_adjust_omp_clauses_1, gimplify_adjust_omp_clauses): Expect +- GOVD_SHARED rather than GOVD_PRIVATE with GOVD_DEBUG_PRIVATE. +- +- PR middle-end/80853 +- * omp-low.c (lower_reduction_clauses): Pass OMP_CLAUSE_PRIVATE +- as last argument to build_outer_var_ref for pointer bases of array +- section reductions. +- +-2017-05-25 Michael Meissner +- +- Backport from trunk +- 2017-05-18 Michael Meissner +- +- PR target/80510 +- * config/rs6000/predicates.md (simple_offsettable_mem_operand): +- New predicate. +- +- * config/rs6000/rs6000.md (ALTIVEC_DFORM): New iterator. +- (define_peephole2 for Altivec d-form load): Add peepholes to catch +- cases where the register allocator uses a move and an offsettable +- memory operation to/from a FPR register on ISA 2.06/2.07. +- (define_peephole2 for Altivec d-form store): Likewise. +- +- Backport from trunk +- 2017-05-09 Michael Meissner +- +- PR target/68163 +- * config/rs6000/rs6000.md (f32_lr): Delete mode attributes that +- are now unused after splitting mov{sf,sd}_hardfloat. +- (f32_lr2): Likewise. +- (f32_lm): Likewise. +- (f32_lm2): Likewise. +- (f32_li): Likewise. +- (f32_li2): Likewise. +- (f32_lv): Likewise. +- (f32_sr): Likewise. +- (f32_sr2): Likewise. +- (f32_sm): Likewise. +- (f32_sm2): Likewise. +- (f32_si): Likewise. +- (f32_si2): Likewise. +- (f32_sv): Likewise. +- (f32_dm): Likewise. +- (f32_vsx): Likewise. +- (f32_av): Likewise. +- (mov_hardfloat): Split into separate movsf and movsd pieces. +- For movsf, order stores so the VSX stores occur before the GPR +- store which encourages the register allocator to use a traditional +- FPR instead of a GPR. For movsd, order the stores so that the GPR +- store comes before the VSX stores to allow the power6 to work. +- This is due to the power6 not having a 32-bit integer store +- instruction from a FPR. +- (movsf_hardfloat): Likewise. +- (movsd_hardfloat): Likewise. +- +-2017-05-25 Wilco Dijkstra +- +- Backport from mainlin +- PR rtl-optimization/80754 +- * lra-remat.c (do_remat): Add overlap checks for dst_regno. +- +-2017-05-25 Wilco Dijkstra +- +- Backport from mainline +- PR target/80671 +- * config/aarch64/cortex-a57-fma-steering.c (merge_forest): +- Move member access before delete. +- +-2017-05-23 Sheldon Lobo +- +- Backport from mainline +- 2017-05-18 Sheldon Lobo +- +- * config/sparc/sparc.c (sparc_option_override): Set function +- alignment for -mcpu=3Dniagara7 to 64 to match the I$ line. +- * config/sparc/sparc.h (BRANCH_COST): Set the SPARC M7 branch +- latency to 1. +- * config/sparc/sparc.h (BRANCH_COST): Set the SPARC T4 branch +- latency to 2. +- * config/sparc/sol2.h: Fix a ASM_CPU32_DEFAULT_SPEC typo. +- +-2017-05-19 Uros Bizjak +- +- Backport from mainline +- 2017-05-18 Uros Bizjak +- +- PR target/80799 +- * config/i386/mmx.md (*mov_internal): Enable +- alternatives 11, 12, 13 and 14 also for 32bit targets. +- Remove alternatives 15, 16, 17 and 18. +- * config/i386/sse.md (vec_concatv2di): Change +- alternative (!x, *y) to (x, ?!*Yn). +- +-2017-05-14 Uros Bizjak +- +- Backport from mainline +- 2017-05-11 Uros Bizjak +- +- PR target/80706 +- * config/i386/sync.md (UNSPEC_LDX_ATOMIC): New unspec. +- (UNSPEC_STX_ATOMIC): Ditto. +- (loaddi_via_sse): New insn. +- (storedi_via_sse): Ditto. +- (atomic_loaddi_fpu): Emit loaddi_via_sse and storedi_via_sse. +- Update corresponding peephole2 patterns. +- (atomic_storedi_fpu): Ditto. +- +-2017-05-13 Bill Schmidt +- +- Backport from mainline +- 2017-05-05 Bill Schmidt +- +- * config/rs6000/rs6000.c (rs6000_vect_nonmem): New static var. +- (rs6000_init_cost): Initialize rs6000_vect_nonmem. +- (rs6000_add_stmt_cost): Update rs6000_vect_nonmem. +- (rs6000_finish_cost): Avoid vectorizing simple copy loops with +- VF=3D2 that require versioning. +- +-2017-05-12 Bill Schmidt +- +- Backport from mainline +- 2017-05-10 Bill Schmidt +- +- * config/rs6000/rs6000.c (altivec_init_builtins): Define POWER8 +- built-ins for vec_xl and vec_xst with short and char pointer +- arguments. +- +-2017-05-10 John David Anglin +- +- PR target/80090 +- * config/pa/pa.c (pa_assemble_integer): When outputting a SYMBOL_REF, +- handle calling assemble_external ourself. +- +- PR target/79027 +- * config/pa/pa.c (pa_cannot_change_mode_class): Reject changes to/from +- modes with zero size. Enhance comment. +- +-2017-05-09 Michael Meissner +- +- Back port from mainline +- 2017-05-05 Michael Meissner +- +- PR target/79038 +- PR target/79202 +- PR target/79203 +- * config/rs6000/rs6000.md (u code attribute): Add FIX and +- UNSIGNED_FIX. +- (extendsi2): Add support for doing sign extension via +- VUPKHSW and XXPERMDI if the value is in Altivec registers and we +- don't have ISA 3.0 instructions. +- (extendsi2 splitter): Likewise. +- (fix_truncsi2): If we are at ISA 2.07 (VSX small integer), +- generate the normal insns since SImode can now go in vector +- registers. Disallow the special UNSPECs needed for previous +- machines to hide SImode being used. Add new insns +- fctiw{,w}__smallint if SImode can go in vector registers. +- (fix_truncsi2_stfiwx): Likewise. +- (fix_truncsi2_internal): Likewise. +- (fixuns_truncsi2): Likewise. +- (fixuns_truncsi2_stfiwx): Likewise. +- (fctiwz__smallint): Likewise. +- (fctiwz__mem): New combiner pattern to prevent conversion +- of floating point to 32-bit integer from doing a direct move to +- the GPR registers to do a store. +- (fctiwz_): Break long line. +- +-2017-05-08 Tamar Christina +- +- PR middle-end/79665 +- * expr.c (expand_expr_real_2): Move TRUNC_MOD_EXPR, FLOOR_MOD_EXPR, +- CEIL_MOD_EXPR, ROUND_MOD_EXPR cases. +- +-2017-05-03 Jan Beulich +- +- Backport from mainline +- 2017-05-01 Jan Beulich +- +- * config/i386/sse.md (xop_vpermil23): Do not allow operand +- swapping, add (x,x,m,x,n) alternative. +- +-2017-05-03 Richard Biener +- +- Backport from mainline +- 2017-04-20 Richard Biener +- +- PR tree-optimization/80453 +- * tree-ssa-sccvn.h (struct vn_phi_s): Add cclhs and ccrhs members. +- * tree-ssa-sccvn.c (cond_stmts_equal_p): Use recorded lhs and rhs +- from the conditions. +- (vn_phi_eq): Pass them down. +- (vn_phi_lookup): Record them. +- (vn_phi_insert): Likewise. +- +- 2017-04-25 Richard Biener +- +- PR tree-optimization/80492 +- * alias.c (compare_base_decls): Handle registers with asm +- specification conservatively. +- +- 2017-04-27 Richard Biener +- +- PR middle-end/80539 +- * tree-chrec.c (chrec_fold_plus_poly_poly): Deal with not +- being in loop-closed SSA form conservatively. +- (chrec_fold_multiply_poly_poly): Likewise. +- +-2017-05-02 Uros Bizjak +- +- Backport from mainline +- 2017-05-01 Uros Bizjak +- +- PR target/68491 +- * config/i386/cpuid.h (__get_cpuid): Always return 0 when +- __get_cpuid_max returns 0. +- (__get_cpuid_count): Ditto. +- +-2017-05-02 Jakub Jelinek +- +- Backported from mainline +- 2017-04-25 Jakub Jelinek +- +- * Makefile.in (s-options): Invoke opt-gather.awk with LC_ALL=3DC in the +- environment. +- +-2017-05-02 Jakub Jelinek +- +- * BASE-VER: Set to 7.1.1. +- +-2017-05-02 Release Manager +- +- * GCC 7.1.0 released. +- +-2017-05-02 Richard Biener +- +- PR tree-optimization/80591 +- Revert +- 2017-04-10 Richard Biener +- +- * tree-ssa-structalias.c (find_func_aliases): Properly handle +- asm inputs. +- +-2017-04-28 Jakub Jelinek +- +- PR bootstrap/80531 +- * cgraph.h (symtab_node::debug_symtab): No longer inline. +- * symtab.c (symtab_node::debug_symtab): Move definition here. +- +-2017-04-27 Richard Earnshaw +- +- PR target/80530 +- * config/aarch64/aarch64.c (aarch64_emit_approx_sqrt): Ensure +- that the logic for permitting reciprocal estimates matches that +- in use_rsqrt_p. +- +-2017-04-27 Jakub Jelinek +- +- PR c++/80534 +- * tree.c (type_cache_hasher::equal): Only compare +- TYPE_TYPELESS_STORAGE flag on non-aggregate element types. +- (build_array_type_1): Only hash TYPE_TYPELESS_STORAGE flag on +- non-aggregate element types. +- * tree.h (TYPE_TYPELESS_STORAGE): Fix comment typo, add more details +- about the flag on ARRAY_TYPEs in the comment, formatting fix. +- +- PR target/79430 +- * reg-stack.c (emit_swap_insn): If i1src mentions the stack pointer, +- punt if tmp contains autoinc of stack pointer. +- +- PR target/77728 +- * config/aarch64/aarch64.c (struct aarch64_fn_arg_alignment): Remove. +- (aarch64_function_arg_alignment): Return unsigned int again, but still +- ignore TYPE_FIELDS chain decls other than FIELD_DECLs. +- (aarch64_layout_arg): Adjust aarch64_function_arg_alignment caller. +- Don't emit -Wpsabi note. +- (aarch64_function_arg_boundary): Likewise. +- (aarch64_gimplify_va_arg_expr): Adjust aarch64_function_arg_alignment +- caller. +- +-2017-04-25 Martin Sebor +- +- PR tree-optimization/80497 +- * gimple-ssa-sprintf.c (get_int_range): Avoid assuming all integer +- constants are representable in HOST_WIDE_INT. +- (parse_directive): Ditto. +- +-2017-04-25 Marek Polacek +- +- 2017-04-25 Marek Polacek +- Backport from mainline +- +- PR sanitizer/80349 +- * fold-const.c (fold_binary_loc) : Convert arg0's +- first argument to type. +- +-2017-04-25 Ramana Radhakrishnan +- Jakub Jelinek +- +- PR target/77728 +- * config/arm/arm.c: Include gimple.h. +- (aapcs_layout_arg): Emit -Wpsabi note if arm_needs_doubleword_align +- returns negative, increment ncrn only if it returned positive. +- (arm_needs_doubleword_align): Return int instead of bool, +- ignore DECL_ALIGN of non-FIELD_DECL TYPE_FIELDS chain +- members, but if there is any such non-FIELD_DECL +- > PARM_BOUNDARY aligned decl, return -1 instead of false. +- (arm_function_arg): Emit -Wpsabi note if arm_needs_doubleword_align +- returns negative, increment nregs only if it returned positive. +- (arm_setup_incoming_varargs): Likewise. +- (arm_function_arg_boundary): Emit -Wpsabi note if +- arm_needs_doubleword_align returns negative, return +- DOUBLEWORD_ALIGNMENT only if it returned positive. +- +-2017-04-25 Bill Seurer +- +- Backport from mainline +- PR target/80482 +- * config/rs6000/rs6000-c.c (altivec_resolve_overloaded_builtin): Change +- type checks to test for compatibility instead of equality. +- +-2017-04-25 Ramana Radhakrishnan +- Jakub Jelinek +- +- PR target/77728 +- * config/aarch64/aarch64.c (struct aarch64_fn_arg_alignment): New +- type. +- (aarch64_function_arg_alignment): Return aarch64_fn_arg_alignment +- struct. Ignore DECL_ALIGN of decls other than FIELD_DECL for +- the alignment computation, but return their maximum in warn_alignment. +- (aarch64_layout_arg): Adjust aarch64_function_arg_alignment caller. +- Emit a -Wpsabi note if warn_alignment is 16 bytes, but alignment +- is smaller. +- (aarch64_function_arg_boundary): Likewise. Simplify using MIN/MAX. +- (aarch64_gimplify_va_arg_expr): Adjust aarch64_function_arg_alignment +- caller. +- +-2017-04-25 Andreas Krebbel +- +- Backport from mainline +- 2017-04-25 Andreas Krebbel +- +- PR target/80464 +- * config/s390/vector.md: Split MEM->GPR vector moves for +- non-s_operand addresses. +- +-2017-04-25 Andreas Krebbel +- +- Backport from mainline +- 2017-04-25 Andreas Krebbel +- +- PR target/79895 +- * config/s390/predicates.md (reload_const_wide_int_operand): New +- predicate. +- * config/s390/s390.md ("movti"): Remove d/P alternative. +- ("movti_bigconst"): New pattern definition. +- +-2017-04-25 Dominik Vogt +- +- Backport from maineline +- 2017-04-25 Dominik Vogt +- +- PR target/80080 +- * s390-protos.h (s390_expand_cs_hqi): Removed. +- (s390_expand_cs, s390_expand_atomic_exchange_tdsi): New prototypes. +- * config/s390/s390.c (s390_emit_compare_and_swap): Handle all integer +- modes as well as CCZ1mode and CCZmode. +- (s390_expand_atomic_exchange_tdsi, s390_expand_atomic): Adapt to new +- signature of s390_emit_compare_and_swap. +- (s390_expand_cs_hqi): Likewise, make static. +- (s390_expand_cs_tdsi): Generate an explicit compare before trying +- compare-and-swap, in some cases. +- (s390_expand_cs): Wrapper function. +- (s390_expand_atomic_exchange_tdsi): New backend specific expander for +- atomic_exchange. +- (s390_match_ccmode_set): Allow CCZmode <-> CCZ1 mode. +- * config/s390/s390.md ("atomic_compare_and_swap"): Merge the +- patterns for small and large integers. Forbid symref memory operands. +- Move expander to s390.c. Require cc register. +- ("atomic_compare_and_swap_internal") +- ("*atomic_compare_and_swap_1") +- ("*atomic_compare_and_swapdi_2") +- ("*atomic_compare_and_swapsi_3"): Use s_operand to forbid +- symref memory operands. Remove CC mode and call s390_match_ccmode +- instead. +- ("atomic_exchange"): Allow and implement all integer modes. +- +-2017-04-25 Dominik Vogt +- +- Backport from mainline +- 2017-04-25 Dominik Vogt +- +- * config/s390/s390.md (define_peephole2): New peephole to help +- combining the load-and-test pattern with volatile memory. +- +- +-2017-04-25 Dominik Vogt +- +- Backport from mainline +- 2017-04-25 Dominik Vogt +- +- * config/s390/s390.md ("cstorecc4"): Use load-on-condition and deal +- with CCZmode for TARGET_Z196. +- +-2017-04-25 Jakub Jelinek +- +- PR rtl-optimization/80501 +- * combine.c (make_compound_operation_int): Set subreg_code to SET +- even for AND with mask of the sign bit of mode. +- +- PR rtl-optimization/80500 +- * loop-unroll.c (combine_var_copies_in_loop_exit): Call copy_rtx on +- sum's initial value. +- +-2017-04-24 Martin Liska +- +- Backport from mainline +- 2017-04-24 Jan Hubicka +- +- PR middle-end/79931 +- * ipa-devirt.c (dump_possible_polymorphic_call_targets): Fix ICE. +- +-2017-04-20 Alexander Monakov +- +- Backport from mainline +- 2017-04-20 Alexander Monakov +- +- * omp-low.c (lower_lastprivate_clauses): Correct handling of linear +- and lastprivate clauses in SIMT case. +- +-2017-04-20 Matthew Fortune +- +- Backport from mainline +- 2017-04-20 Matthew Fortune +- +- * config/mips/mips.c (mips_expand_vec_perm_const): Re-fix +- uninitialized variable warning to avoid buffer overrun. +- +-2017-04-20 Jakub Jelinek +- +- * DEV-PHASE: Set to prerelease. +- +-2017-04-20 Thomas Preud'homme +- +- * config/arm/arm.c (arm_elf_asm_cdtor): Create non-default +- priority .init_array and .fini_array section with SECTION_NOTYPE +- flag. +- +-2017-04-20 Jakub Jelinek +- +- PR middle-end/80423 +- * tree.h (build_array_type): Add typeless_storage default argument. +- * tree.c (type_cache_hasher::equal): Also compare +- TYPE_TYPELESS_STORAGE flag for ARRAY_TYPEs. +- (build_array_type): Add typeless_storage argument, set +- TYPE_TYPELESS_STORAGE to it, if shared also hash it, and pass to +- recursive call. +- (build_nonshared_array_type): Adjust build_array_type_1 caller. +- (build_array_type): Likewise. Add typeless_storage argument. +- +-2017-04-19 Eric Botcazou +- Jakub Jelinek +- +- PR tree-optimization/80426 +- * tree-vrp.c (extract_range_from_binary_expr_1): For an additive +- operation on symbolic operands, also compute the overflow for the +- invariant part when the operation degenerates into a negation. +- +-2017-04-19 Jakub Jelinek +- +- PR debug/80461 +- * dwarf2out.c (modified_type_die, gen_type_die_with_usage): +- Check for t with zero TYPE_QUALS_NO_ADDR_SPACE. +- +- PR debug/80436 +- * tree-ssa-loop-manip.c (find_uses_to_rename_def): Ignore debug uses. +- +-2017-04-19 Georg-Johann Lay +- +- PR target/80462 +- * config/avr/avr.c (tree.h): Include it. +- (cgraph.h): Include it. +- (avr_encode_section_info): Don't warn for uninitialized progmem +- variable if it's just an alias. +- +-2017-04-19 Richard Biener +- +- PR ipa/65972 +- * auto-profile.c (afdo_vpt_for_early_inline): Update SSA +- when needed by AutoPGO. +- +-2017-04-19 Paulo J. Matos +- +- PR lto/50345 +- * doc/lto.texi: Remove an extra 'that'. +- +-2017-04-19 Segher Boessenkool +- +- PR rtl-optimization/80429 +- * ira.c (split_live_ranges_for_shrink_wrap): Don't split regs that +- are only used in debug insns. +- +-2017-04-19 Eric Botcazou +- Vladimir Makarov +- +- * config/sparc/predicates.md (input_operand): Add comment. Return +- true for any memory operand when LRA is in progress. +- * config/sparc/sparc.c (sparc_expand_move): Minor formatting fix. +- +-2017-04-18 Jeff Law +- +- PR target/74563 +- * mips.md ({return,simple_return}_internal): Do not overwrite +- operands[0]. +- +-2017-04-18 Jakub Jelinek +- +- PR tree-optimization/80443 +- * tree-vrp.c (intersect_ranges): For signed 1-bit precision type, +- instead of adding 1, subtract -1 and similarly instead of subtracting +- 1 add -1. +- +-2017-04-18 Richard Sandiford +- +- PR rtl-optimization/80357 +- * haifa-sched.c (tmp_bitmap): New variable. +- (model_recompute): Handle duplicate use records. +- (alloc_global_sched_pressure_data): Initialize tmp_bitmap. +- (free_global_sched_pressure_data): Free it. +- +-2017-04-18 Bernd Edlinger +- +- Revert: +- 2017-02-20 Bernd Edlinger +- * Makefile.in (BUILD_SYSTEM_HEADER_DIR): New make variabe. +- (LIMITS_H_TEST, if_multiarch, stmp-fixinc): Use BUILD_SYSTEM_HEADER_DIR +- instead of SYSTEM_HEADER_DIR. +- +-2017-04-18 Jeff Law +- +- PR middle-end/80422 +- * cfgcleanup.c (try_crossjump_to_edge): Verify SRC1 and SRC2 have +- predecessors after walking up the insn chain. +- +-2017-04-18 Jakub Jelinek +- +- PR debug/80263 +- * dwarf2out.c (modified_type_die): Try harder not to emit internal +- sizetype type into debug info. +- +-2017-04-18 Michael Meissner +- +- PR target/80099 +- * config/rs6000/rs6000.c (rs6000_expand_vector_extract): Eliminate +- unneeded test for TARGET_UPPER_REGS_SF. +- * config/rs6000/vsx.md (vsx_extract_v4sf_var): Likewise. +- +-2017-04-18 Jakub Jelinek +- +- PR sanitizer/80444 +- * sancov.c (sancov_pass): Use gsi_start_nondebug_after_labels_bb +- instead of gsi_after_labels. +- +-2017-04-18 Jeff Law +- +- * regcprop.c (maybe_mode_change): Avoid creating copies of the +- stack pointer. +- +- Revert: +- 2017-04-13 Jeff Law +- * config/mips.mips.md (zero_extendsidi2): Do not allow SP to appear +- in operands[1] if it is a MEM and TARGET_MIPS16 is active. +- +-2017-04-18 Georg-Johann Lay +- +- PR target/79453 +- * config/avr/avr.c (intl.h): Include it. +- (avr_pgm_check_var_decl) [reason]: Wrap diagnostic snippets into _(). +- +-2017-04-18 Martin Liska +- +- PR gcov-profile/78783 +- * gcov-tool.c (gcov_output_files): Validate that destination +- file is either removed by the tool or by a user. +- +-2017-04-14 Andrew Burgess +- Guy Benyei +- +- * config/arc/arc.c (arc_reorg): Move loop_end_id into a more local +- block, and do not negate it, the stored id is already negative. +- +-2017-04-14 Andrew Burgess +- +- * config/arc/arc.md (doloop_begin_i): Use @pcl assembler syntax. +- +-2017-04-14 Michael Meissner +- +- PR target/80098 +- * config/rs6000/rs6000-cpus.def (OTHER_P9_VECTOR_MASKS): Define +- masks of options that should be turned off if the VSX vector +- options are turned off. +- (OTHER_P8_VECTOR_MASKS): Likewise. +- (OTHER_VSX_VECTOR_MASKS): Likewise. +- * config/rs6000/rs6000.c (rs6000_option_override_internal): Call +- rs6000_disable_incompatible_switches to validate no type switches +- like -mvsx. +- (rs6000_incompatible_switch): New function to disallow turning on +- other vector options if -mno-vsx, -mno-power8-vector, or +- -mno-power9-vector are specified. +- +-2017-04-14 Claudiu Zissulescu +- +- * config/arc/arc.h (CRT_CALL_STATIC_FUNCTION): Use long calls. +- +-2017-04-14 Claudiu Zissulescu +- +- * config/arc/arc-protos.h (arc_decl_pretend_args): Remove. +- * config/arc/arc.c (arc_decl_pretend_args): Likewise. +- * config/arc/arc.h (CFA_FRAME_BASE_OFFSET): Likewise. +- (ARG_POINTER_CFA_OFFSET): Likewise. +- +-2017-04-14 Claudiu Zissulescu +- +- * config/arc/arc.c (arc_mode_dependent_address_p): Relax +- conditions to take advantage of various optimizations. +- +-2017-04-13 Jeff Law +- +- * config/mips.mips.md (zero_extendsidi2): Do not allow SP to appear +- in operands[1] if it is a MEM and TARGET_MIPS16 is active. +- (zero_extendsidi2_dext): Likewise. +- +-2017-04-13 Jakub Jelinek +- +- PR sanitizer/80403 +- * fold-const.c (fold_ternary_loc): Revert +- use op0 instead of fold_convert_loc (loc, type, arg0) part of +- 2017-04-12 change. +- +-2017-04-13 Vladimir Makarov +- +- PR rtl-optimization/80343 +- * lra-remat.c (update_scratch_ops): Assign original hard reg to +- new scratch pseudo. +- +-2017-04-13 Denis Khalikov +- +- PR sanitizer/80414 +- * ubsan.c (ubsan_expand_bounds_ifn): Pass original index +- to ubsan_encode_value. +- +-2017-04-13 Jeff Law +- +- * reload1.c (eliminate_regs_1): Call gen_rtx_raw_SUBREG for SUBREGs +- appearing in DEBUG_INSNs. +- +-2017-04-13 Martin Liska +- +- PR gcov-profile/80413 +- * gcov-io.c (gcov_write_string): Copy to buffer just when +- allocated size is greater than zero. +- +-2017-04-13 Jakub Jelinek +- +- PR debug/80321 +- * dwarf2out.c (decls_for_scope): Ignore declarations of +- current_function_decl in BLOCK_NONLOCALIZED_VARS. +- +-2017-04-12 Jan Hubicka +- +- PR lto/69953=20 +- * ipa-visibility.c (non_local_p): Fix typos. +- (localize_node): When localizing symbol in same comdat group, +- dissolve the group only when we know external symbols are going +- to be privatized. +- (function_and_variable_visibility): Do not localize DECL_EXTERNAL. +- +-2017-04-12 Jakub Jelinek +- +- PR tree-optimization/79390 +- * optabs.c (emit_conditional_move): If the preferred op2/op3 operand +- order does not result in usable sequence, retry with reversed operand +- order. +- +- PR sanitizer/80403 +- PR sanitizer/80404 +- PR sanitizer/80405 +- * fold-const.c (fold_ternary_loc): Use op1 instead of arg1 as argument +- to fold_build2_loc. Convert TREE_OPERAND (tem, 0) to type. Use +- op0 instead of fold_convert_loc (loc, type, arg0). +- +-2017-04-12 Jeff Law +- +- * genattrtab.c (write_eligible_delay): Verify DELAY_INSN still +- has a delay slot in the generated code. +- +- * config/cris/cris.md (cris_preferred_reload_class): Return +- GENNONACR_REGS rather than GENERAL_REGS. +- +-2017-04-12 Jakub Jelinek +- +- PR c/80163 +- * expr.c : For EXPAND_INITIALIZER determine SIGN_EXTEND +- vs. ZERO_EXTEND based on signedness of treeop0's type rather than +- signedness of the result type. +- +-2017-04-12 Richard Biener +- Jeff Law +- +- PR tree-optimization/80359 +- * tree-ssa-dse.c (maybe_trim_partially_dead_store): Do not +- trim stores to TARGET_MEM_REFs. +- +-2017-04-12 Richard Biener +- +- PR tree-optimization/79390 +- * gimple-ssa-split-paths.c (is_feasible_trace): Restrict +- threading case even more. +- +-2017-04-12 Segher Boessenkool +- +- PR target/80382 +- * config/rs6000/sync.md (atomic_load, atomic_store +- Bernd Edlinger +- +- PR middle-end/79671 +- * alias.c (component_uses_parent_alias_set_from): Handle +- TYPE_TYPELESS_STORAGE. +- (get_alias_set): Likewise. +- * tree-core.h (tree_type_common): Add typeless_storage flag. +- * tree.h (TYPE_TYPELESS_STORAGE): New macro. +- * stor-layout.c (place_union_field): Set TYPE_TYPELESS_STORAGE +- for types containing members with TYPE_TYPELESS_STORAGE. +- (place_field): Likewise. +- (layout_type): Likewise for ARRAY_TYPE. +- * lto-streamer-out.c (hash_tree): Hash TYPE_TYPELESS_STORAGE. +- * tree-streamer-in.c (unpack_ts_type_common_value_fields): Stream +- TYPE_TYPELESS_STORAGE. +- * tree-streamer-out.c (pack_ts_type_common_value_fields): Likewise. +- +-2017-04-12 Jakub Jelinek +- +- PR sanitizer/80349 +- * fold-const.c (fold_binary_loc) : Convert arg0's +- first argument to type. +- +-2017-04-11 Bill Schmidt +- +- PR target/80376 +- PR target/80315 +- * config/rs6000/rs6000.c (rs6000_expand_unop_builtin): Return +- CONST0_RTX (mode) rather than const0_rtx where appropriate. +- (rs6000_expand_binop_builtin): Likewise. +- (rs6000_expand_ternop_builtin): Likewise; also add missing +- vsx_xxpermdi_* variants; also fix typo (arg1 =3D> arg2) for +- vshasigma built-ins. +- * doc/extend.texi: Document that vec_xxpermdi's third argument +- must be a constant. +- +-2017-04-11 Uros Bizjak +- +- * config/i386/i386.c (dimode_scalar_chain::compute_convert_gain): +- Use shift_const cost parameter when calculating gain of STV shifts. +- +-2017-04-11 Vladimir Makarov +- +- PR rtl-optimization/70478 +- * lra-constraints.c (process_alt_operands): Check memory for +- disfavoring memory insn operand. +- +-2017-04-11 Jakub Jelinek +- +- PR middle-end/80100 +- * simplify-rtx.c (simplify_binary_operation_1) : Perform +- left shift in unsigned HOST_WIDE_INT type. +- +- PR rtl-optimization/80385 +- * simplify-rtx.c (simplify_unary_operation_1): Don't transform +- (not (neg X)) into (plus X -1) for complex or non-integral modes. +- +- PR libgomp/80394 +- * omp-low.c (scan_omp_task): Don't optimize away empty tasks +- if they have any depend clauses. +- +-2017-04-11 Martin Liska +- +- PR ipa/80212 +- * cgraph.c (cgraph_node::dump): Dump calls_comdat_local. +- * ipa-split.c (split_function): Create a local comdat symbol +- if caller is in a comdat group. +- +-2017-04-11 Martin Liska +- +- PR ipa/80212 +- * ipa-cp.c (determine_versionability): Handle calls_comdat_local +- flags. +- +-2017-04-11 Martin Sebor +- +- PR middle-end/80364 +- * gimple-ssa-sprintf.c (get_int_range): Remove second argument and +- always use the int type. Use INTEGRAL_TYPE_P() rather than testing +- for INTEGER_TYPE. +- (directive::set_width, directive::set_precision, format_character): +- Adjust. +- (parse_directive): Use INTEGRAL_TYPE_P() rather than testing for +- INTEGER_TYPE. +- +-2017-04-11 Richard Earnshaw +- +- PR target/80389 +- * config/arm/arm.c (arm_configure_build_target): When -mcpu and -arch +- conflict, set target->arch_name instead of target->cpu_name. +- +-2017-04-11 Richard Biener +- +- PR tree-optimization/80374 +- * tree-ssa-dom.c (derive_equivalences_from_bit_ior): Use +- build_zero_cst, remove fold_convertible_p check again. +- +-2017-04-11 Martin Liska +- +- PR sanitizer/70878 +- * ubsan.c (instrument_object_size): Do not instrument register +- variables. +- +-2017-04-11 Jakub Jelinek +- +- PR target/80381 +- * config/i386/i386-builtin-types.def +- (V16HI_FTYPE_V16HI_INT_V16HI_UHI_COUNT, +- V16HI_FTYPE_V16HI_V8HI_V16HI_UHI_COUNT, +- V16SI_FTYPE_V16SI_INT_V16SI_UHI_COUNT, +- V16SI_FTYPE_V16SI_V4SI_V16SI_UHI_COUNT, +- V2DI_FTYPE_V2DI_INT_V2DI_UQI_COUNT, +- V2DI_FTYPE_V2DI_V2DI_V2DI_UQI_COUNT, +- V32HI_FTYPE_V32HI_INT_V32HI_USI_COUNT, +- V32HI_FTYPE_V32HI_V8HI_V32HI_USI_COUNT, +- V4DI_FTYPE_V4DI_INT_V4DI_UQI_COUNT, +- V4DI_FTYPE_V4DI_V2DI_V4DI_UQI_COUNT, +- V4SI_FTYPE_V4SI_INT_V4SI_UQI_COUNT, +- V4SI_FTYPE_V4SI_V4SI_V4SI_UQI_COUNT, +- V8DI_FTYPE_V8DI_INT_V8DI_UQI_COUNT, +- V8DI_FTYPE_V8DI_V2DI_V8DI_UQI_COUNT, +- V8HI_FTYPE_V8HI_INT_V8HI_UQI_COUNT, +- V8HI_FTYPE_V8HI_V8HI_V8HI_UQI_COUNT, +- V8SI_FTYPE_V8SI_INT_V8SI_UQI_COUNT, +- V8SI_FTYPE_V8SI_V4SI_V8SI_UQI_COUNT): New function type aliases. +- * config/i386/i386-builtin.def (__builtin_ia32_pslld512_mask, +- __builtin_ia32_pslldi512_mask, __builtin_ia32_psllq512_mask, +- __builtin_ia32_psllqi512_mask, __builtin_ia32_psrad512_mask, +- __builtin_ia32_psradi512_mask, __builtin_ia32_psraq512_mask, +- __builtin_ia32_psraqi512_mask, __builtin_ia32_psrld512_mask, +- __builtin_ia32_psrldi512_mask, __builtin_ia32_psrlq512_mask, +- __builtin_ia32_psrlqi512_mask, __builtin_ia32_psllwi128_mask, +- __builtin_ia32_pslldi128_mask, __builtin_ia32_psllqi128_mask, +- __builtin_ia32_psllw128_mask, __builtin_ia32_pslld128_mask, +- __builtin_ia32_psllq128_mask, __builtin_ia32_psllwi256_mask, +- __builtin_ia32_psllw256_mask, __builtin_ia32_pslldi256_mask, +- __builtin_ia32_pslld256_mask, __builtin_ia32_psllqi256_mask, +- __builtin_ia32_psllq256_mask, __builtin_ia32_psradi128_mask, +- __builtin_ia32_psrad128_mask, __builtin_ia32_psradi256_mask, +- __builtin_ia32_psrad256_mask, __builtin_ia32_psraqi128_mask, +- __builtin_ia32_psraq128_mask, __builtin_ia32_psraqi256_mask, +- __builtin_ia32_psraq256_mask, __builtin_ia32_psrldi128_mask, +- __builtin_ia32_psrld128_mask, __builtin_ia32_psrldi256_mask, +- __builtin_ia32_psrld256_mask, __builtin_ia32_psrlqi128_mask, +- __builtin_ia32_psrlq128_mask, __builtin_ia32_psrlqi256_mask, +- __builtin_ia32_psrlq256_mask, __builtin_ia32_psrawi256_mask, +- __builtin_ia32_psraw256_mask, __builtin_ia32_psrawi128_mask, +- __builtin_ia32_psraw128_mask, __builtin_ia32_psrlwi256_mask, +- __builtin_ia32_psrlw256_mask, __builtin_ia32_psrlwi128_mask, +- __builtin_ia32_psrlw128_mask, __builtin_ia32_psllwi512_mask, +- __builtin_ia32_psllw512_mask, __builtin_ia32_psrawi512_mask, +- __builtin_ia32_psraw512_mask, __builtin_ia32_psrlwi512_mask, +- __builtin_ia32_psrlw512_mask): Use _COUNT suffixed function type +- aliases. +- * config/i386/i386.c (ix86_expand_args_builtin): Rename last_arg_count +- flag to second_arg_count, handle 4 argument function type _COUNT +- aliases, handle second_arg_count on second argument rather than last. +- +-2017-04-10 Jeff Law +- +- PR tree-optimization/80374 +- * tree-ssa-dom.c (derive_equivalences_from_bit_ior): Do not try to +- record anything if we can not convert integer_zero_node to the +- desired type. +- +-2017-04-10 Kelvin Nilsen +- +- PR target/80108 +- * config/rs6000/rs6000.c (rs6000_option_override_internal): +- Enhance special handling given to the TARGET_P9_MINMAX option in +- relation to certain other options. +- +-2017-04-10 Bin Cheng +- +- PR tree-optimization/80153 +- * tree-ssa-loop-ivopts.c (add_iv_candidate_for_use): Check and +- remove POINTER_PLUS_EXPR's base part directly, rather than through +- aff_tree. +- +-2017-04-10 Richard Biener +- Bin Cheng +- +- PR tree-optimization/80153 +- * tree-affine.c (aff_combination_to_tree): Get base pointer from +- the first element of pointer type aff_tree. Build result expr in +- aff_tree's type. +- (add_elt_to_tree): Convert to type unconditionally. Remove other +- fold_convert calls. +- * tree-ssa-loop-ivopts.c (alloc_iv): Pass in consistent types. +- (rewrite_use_nonlinear_expr): Check invariant using iv information. +- +-2017-04-10 Richard Biener +- +- * tree-ssa-structalias.c (find_func_aliases): Properly handle +- asm inputs. +- +-2017-04-10 Vladimir Makarov +- +- PR rtl-optimization/70478 +- * lra-constraints.c (curr_small_class_check): New. +- (update_and_check_small_class_inputs): New. +- (process_alt_operands): Update curr_small_class_check. Disfavor +- alternative insn memory operands. Check available regs for small +- class operands. +- +-2017-03-31 Matthew Fortune +- +- PR target/80057 +- * config/mips/mips.opt (-mvirt): Update description. +- * doc/invoke.texi (-mvirt): Likewise. +- +-2017-04-10 Richard Biener +- +- PR middle-end/80362 +- * fold-const.c (fold_binary_loc): Look at unstripped ops when +- looking for NEGATE_EXPR in -A / -B to A / B folding. +- +-2017-04-10 Martin Liska +- +- PR gcov-profile/80224 +- * gcov.c (print_usage): Fix usage string. +- (get_gcov_intermediate_filename): Remove. +- (output_gcov_file): Use both for normal and intermediate format. +- (generate_results): Do not initialize special file for +- intermediate format. +- +-2017-04-10 Richard Biener +- +- PR tree-optimization/80304 +- * tree-ssa-loop-im.c (ref_indep_loop_p_1): Also recurse +- for safelen. +- +-2017-04-10 Nathan Sidwell +- +- PR target/79905 +- * config/rs6000/rs6000.c (rs6000_vector_type): New. +- (rs6000_init_builtins): Use it. +- +-2016-04-10 Kyrylo Tkachov +- +- * config/arm/arm.md (): Add mode to SET source. +- (): Likewise. +- +-2017-04-10 Richard Biener +- +- PR middle-end/80344 +- * gimplify.c (is_gimple_mem_rhs_or_call): Allow CLOBBERs. +- +-2017-04-10 Jakub Jelinek +- +- PR target/80324 +- * config/i386/avx512fintrin.h (_mm512_reduce_add_epi32, +- _mm512_reduce_mul_epi32, _mm512_reduce_and_epi32, +- _mm512_reduce_or_epi32, _mm512_mask_reduce_add_epi32, +- _mm512_mask_reduce_mul_epi32, _mm512_mask_reduce_and_epi32, +- _mm512_mask_reduce_or_epi32, _mm512_reduce_min_epi32, +- _mm512_reduce_max_epi32, _mm512_reduce_min_epu32, +- _mm512_reduce_max_epu32, _mm512_mask_reduce_min_epi32, +- _mm512_mask_reduce_max_epi32, _mm512_mask_reduce_min_epu32, +- _mm512_mask_reduce_max_epu32, _mm512_reduce_add_ps, +- _mm512_reduce_mul_ps, _mm512_mask_reduce_add_ps, +- _mm512_mask_reduce_mul_ps, _mm512_reduce_min_ps, _mm512_reduce_max_ps, +- _mm512_mask_reduce_min_ps, _mm512_mask_reduce_max_ps, +- _mm512_reduce_add_epi64, _mm512_reduce_mul_epi64, +- _mm512_reduce_and_epi64, _mm512_reduce_or_epi64, +- _mm512_mask_reduce_add_epi64, _mm512_mask_reduce_mul_epi64, +- _mm512_mask_reduce_and_epi64, _mm512_mask_reduce_or_epi64, +- _mm512_reduce_min_epi64, _mm512_reduce_max_epi64, +- _mm512_mask_reduce_min_epi64, _mm512_mask_reduce_max_epi64, +- _mm512_reduce_min_epu64, _mm512_reduce_max_epu64, +- _mm512_mask_reduce_min_epu64, _mm512_mask_reduce_max_epu64, +- _mm512_reduce_add_pd, _mm512_reduce_mul_pd, _mm512_mask_reduce_add_pd, +- _mm512_mask_reduce_mul_pd, _mm512_reduce_min_pd, _mm512_reduce_max_pd, +- _mm512_mask_reduce_min_pd, _mm512_mask_reduce_max_pd): New intrinsics. +- +-2017-04-08 Vladimir Makarov +- +- PR rtl-optimization/70478 +- * lra-constraints.c: Reverse the last patch. +- +-2017-04-08 Andreas Tobler +- +- * config/aarch64/aarch64-freebsd.h: Define MCOUNT_NAME. +- Add comment for WCHAR_T. +- +-2017-04-08 Martin Liska +- +- Revert: +- 2017-04-07 Martin Liska +- +- PR ipa/80212 +- * ipa-split.c (split_function): Add function part to a same comdat +- group. +- +-2017-04-08 Aaron Sawdey +- +- PR target/80358 +- * config/rs6000/rs6000.c (expand_block_compare): Fix boundary check. +- +-2017-04-07 Pat Haugen +- +- * rs6000/rs6000.c (vec_load_pendulum): Rename... +- (vec_pairing): ...to this. +- (power9_sched_reorder2): Rewrite code for pairing vector/vecload insns. +- (rs6000_sched_init): Adjust for name change. +- (struct rs6000_sched_context): Likewise. +- (rs6000_init_sched_context): Likewise. +- (rs6000_set_sched_context): Likewise. +- +-2017-04-07 Jakub Jelinek +- +- PR target/80322 +- PR target/80323 +- PR target/80325 +- PR target/80326 +- * config/i386/avxintrin.h (_mm256_cvtsd_f64, _mm256_cvtss_f32): New +- intrinsics. +- * config/i386/avx512fintrin.h (_mm512_int2mask, _mm512_mask2int, +- _mm512_abs_ps, _mm512_mask_abs_ps, _mm512_abs_pd, _mm512_mask_abs_pd, +- _mm512_cvtsd_f64, _mm512_cvtss_f32): Likewise. +- +-2017-04-07 Andreas Tobler +- +- * config/aarch64/aarch64-freebsd.h: Define WCHAR_TYPE. +- +-2017-04-07 Vladimir Makarov +- +- PR rtl-optimization/70703 +- * ira-color.c (update_conflict_hard_regno_costs): Use +- int64_t instead of HOST_WIDE_INT. +- +-2017-04-07 Vladimir Makarov +- +- PR rtl-optimization/70478 +- * lra-constraints.c (process_alt_operands): Disfavor alternative +- insn memory operands. +- +-2017-04-07 Jeff Law +- +- * config/iq2000/iq2000.c (final_prescan_insn): Do not separate a +- CALL and NOTE_INSN_CALL_ARG_LOCATION. +- +-2017-04-07 Martin Liska +- +- PR target/79889 +- * config/aarch64/aarch64.c (aarch64_process_target_attr): +- Show error message instead of an ICE. +- +-2017-04-07 Martin Liska +- +- PR ipa/80212 +- * ipa-split.c (split_function): Add function part to a same comdat +- group. +- +-2017-04-07 Richard Biener +- +- PR middle-end/80341 +- * tree.c (get_unwidened): Also handle ! for_type case for +- INTEGER_CSTs. +- * convert.c (do_narrow): Split out from ... +- (convert_to_integer_1): ... here. Do not pass final truncation +- type to get_unwidened for TRUNC_DIV_EXPR. +- +-2017-04-07 Richard Biener +- +- * tree-affine.c (wide_int_ext_for_comb): Take type rather +- than aff_tree. +- (aff_combination_const): Adjust. +- (aff_combination_scale): Likewise. +- (aff_combination_add_elt): Likewise. +- (aff_combination_add_cst): Likewise. +- (aff_combination_convert): Likewise. +- (add_elt_to_tree): Likewise. Remove unused argument. +- (aff_combination_to_tree): Adjust calls to add_elt_to_tree. +- +-2017-04-07 Sebastian Huber +- +- * config/arm/arm.h (ARM_DEFAULT_SHORT_ENUMS): Provide default +- definition. +- * config/arm/arm.c (arm_default_short_enums): Use +- ARM_DEFAULT_SHORT_ENUMS. +- * config/arm/rtems.h (ARM_DEFAULT_SHORT_ENUMS): Define. +- +-2017-04-06 Jakub Jelinek +- +- PR debug/80234 +- * dwarf2out.c (gen_member_die): Handle C++17 inline static data +- members with redundant out-of-class redeclaration. +- +-2017-04-06 Uros Bizjak +- +- PR target/80286 +- * config/i386/sse.md (*vec_extractv4si_0_zext_sse4): New pattern. +- * config/i386/i386.md (*zero_extendsidi2): +- Add (?*x,*x) and (?*v,*v) alternatives. +- +-2017-04-06 Uros Bizjak +- +- PR target/79733 +- * config/i386/i386.c (ix86_expand_builtin) +- : Determine insn operand +- mode from insn data. Convert operands to insn operand mode. +- Copy operands that don't satisfy insn predicate to a register. +- +-2017-04-06 Sam Thursfield +- +- * config/rs6000/x-aix: Increase memory limit for genautomata on AIX. +- Update comments. +- +-2017-04-06 Richard Biener +- +- PR tree-optimization/80334 +- * tree-ssa-loop-ivopts.c (rewrite_use_address): Properly +- preserve alignment of accesses. +- +-2017-04-06 Richard Biener +- +- PR tree-optimization/80262 +- * tree-sra.c (build_ref_for_offset): Preserve address-space +- information. +- * tree-ssa-sccvn.c (vn_reference_maybe_forwprop_address): +- Drop useless address-space information on MEM_REF offsets. +- +-2017-04-05 Andreas Schwab +- +- * builtins.def (BUILT_IN_UPDATE_SETJMP_BUF): Fix type. +- +-2017-04-05 Vladimir Makarov +- +- PR rtl-optimization/70703 +- * ira-color.c (update_conflict_hard_regno_costs): Use +- HOST_WIDE_INT instead of long. +- +-2017-04-05 Uros Bizjak +- +- PR target/80298 +- * config/i386/mmintrin.h: Add -msse target option when __SSE__ is +- not defined for x86_64 target. Add -mmmx target option when __SSE2__ +- is not defined. +- * config/i386/mm3dnow.h: Add -msse target when __SSE__ is not defined +- for x86_64 target. Handle -m3dnowa option. +- +-2017-04-05 Vladimir Makarov +- +- PR rtl-optimization/70703 +- * ira-color.c (update_costs_from_allocno): Use the smallest mode. +- (update_conflict_hard_regno_costs): Use long instead of unsigned +- arithmetic for cost calculation. +- +-2017-04-05 Jakub Jelinek +- Bernd Edlinger +- +- PR sanitizer/80308 +- * asan.c (asan_store_shadow_bytes): Fix location of last_chunk_value +- for big endian. +- +-2017-04-05 Eric Botcazou +- +- PR target/78002 +- * config/aarch64/aarch64.c (aarch64_emit_probe_stack_range): Replace +- ptr_mode with Pmode throughout. +- * config/aarch64/aarch64.md (probe_stack_range_ +- +- PR target/79890 +- * config/s390/s390.c (s390_register_info_gprtofpr): Return if +- call_eh_return is true. +- +-2017-04-05 Andreas Krebbel +- +- * config/s390/s390-c.c (s390_resolve_overloaded_builtin): +- Initialize last_match_fntype_index. +- +-2017-04-05 Jakub Jelinek +- +- PR target/80310 +- * tree-nvr.c: Include internal-fn.h. +- (pass_return_slot::execute): Ignore internal calls without +- direct optab. +- +-2017-04-04 Jakub Jelinek +- Richard Biener +- +- PR c++/80297 +- * genmatch.c (capture::gen_transform): For GENERIC unshare_expr +- captures used multiple times, except for the last use. +- * generic-match-head.c: Include gimplify.h. +- +-2017-04-04 Jakub Jelinek +- +- PR tree-optimization/79390 +- * target.h (struct noce_if_info): Declare. +- * targhooks.h (default_noce_conversion_profitable_p): Declare. +- * target.def (noce_conversion_profitable_p): New target hook. +- * ifcvt.h (struct noce_if_info): New type, moved from ... +- * ifcvt.c (struct noce_if_info): ... here. +- (noce_conversion_profitable_p): Renamed to ... +- (default_noce_conversion_profitable_p): ... this. No longer +- static nor inline. +- (noce_try_store_flag_constants, noce_try_addcc, +- noce_try_store_flag_mask, noce_try_cmove, noce_try_cmove_arith, +- noce_convert_multiple_sets): Use targetm.noce_conversion_profitable_p +- instead of noce_conversion_profitable_p. +- * config/i386/i386.c: Include ifcvt.h. +- (ix86_option_override_internal): Don't override +- PARAM_MAX_RTL_IF_CONVERSION_INSNS default. +- (ix86_noce_conversion_profitable_p): New function. +- (TARGET_NOCE_CONVERSION_PROFITABLE_P): Redefine. +- * config/i386/x86-tune.def (X86_TUNE_ONE_IF_CONV_INSN): Adjust comment. +- * doc/tm.texi.in (TARGET_NOCE_CONVERSION_PROFITABLE_P): Add. +- * doc/tm.texi: Regenerated. +- +-2017-04-04 Bill Schmidt +- +- * doc/extend.texi (PowerPC AltiVec Built-in Functions): Grammar +- correction. +- +-2017-04-04 Thomas Preud'homme +- +- PR target/80307 +- * config/arm/arm.c (thumb1_rtx_costs): Give a cost of 32 +- instructions for small multiply cores. +- +-2017-04-04 Jeff Law +- +- * config/mips/mips.c (mips_multi_add): Zero initialize the newly +- added member. +- (mips_expand_vec_perm_const): Initialize elements in orig_perm +- that are not set by the loop over the elements. +- +-2017-04-04 Jakub Jelinek +- +- PR target/80286 +- * config/i386/i386.c (ix86_expand_args_builtin): If op has scalar +- int mode, convert_modes it to mode as unsigned, otherwise use +- lowpart_subreg to mode rather than SImode. +- * config/i386/sse.md (ashr3, +- ashr3, ashr3, 3): +- Use DImode instead of SImode for the shift count operand. +- * config/i386/mmx.md (mmx_ashr3, mmx_3): +- Likewise. +- +-2017-04-04 Richard Biener +- +- PR middle-end/80281 +- * match.pd (A + (-B) -> A - B): Make sure to preserve unsigned +- arithmetic done for the negate or the plus. Simplify. +- (A - (-B) -> A + B): Likewise. +- * fold-const.c (split_tree): Make sure to not negate pointers. +- +-2017-04-04 Segher Boessenkool +- +- PR rtl-optimization/60818 +- * simplify-rtx.c (simplify_binary_operation_1): Do not replace +- a compare of comparisons with the thing compared if this results +- in a different machine mode. +- +-2017-04-03 Jonathan Wakely +- +- * alias.c (base_alias_check): Fix typo in comment. +- * cgraph.h (class ipa_polymorphic_call_context): Likewise. +- * cgraphunit.c (symbol_table::compile): Likewise. +- * collect2.c (maybe_run_lto_and_relink): Likewise. +- * config/arm/arm.c (arm_thumb1_mi_thunk): Likewise. +- * config/avr/avr-arch.h (avr_arch_info_t): Likewise. +- * config/avr/avr.c (avr_map_op_t): Likewise. +- * config/cr16/cr16.h (DATA_ALIGNMENT): Likewise. +- * config/epiphany/epiphany.c (TARGET_ARG_PARTIAL_BYTES): Likewise. +- * config/epiphany/epiphany.md (movcc): Likewise. +- * config/i386/i386.c (legitimize_pe_coff_extern_decl): Likewise. +- * config/m68k/m68k.c (struct _sched_ib, m68k_sched_variable_issue): +- Likewise. +- * config/mips/mips.c (mips_save_restore_reg): Likewise. +- * config/rx/rx.c (rx_is_restricted_memory_address): Likewise. +- * config/s390/s390.c (Z10_EARLYLOAD_DISTANCE): Likewise. +- * config/sh/sh.c (sh_rtx_costs): Likewise. +- * fold-const.c (fold_truth_andor): Likewise. +- * genautomata.c (collapse_flag): Likewise. +- * gengtype.h (struct type::u::s): Likewise. +- * gensupport.c (has_subst_attribute, add_mnemonic_string): Likewise. +- * input.c (FORMAT_AMOUNT): Likewise. +- * ipa-cp.c (class ipcp_lattice, agg_replacements_to_vector) +- (known_aggs_to_agg_replacement_list): Likewise. +- * ipa-inline-analysis.c: Likewise. +- * ipa-inline.h (estimate_edge_time, estimate_edge_hints): Likewise. +- * ipa-polymorphic-call.c +- (ipa_polymorphic_call_context::restrict_to_inner_class): Likewise. +- * loop-unroll.c (analyze_insn_to_expand_var): Likewise. +- * lra.c (lra_optional_reload_pseudos, lra_subreg_reload_pseudos): +- Likewise. +- * modulo-sched.c (apply_reg_moves): Likewise. +- * omp-expand.c (build_omp_regions_1): Likewise. +- * trans-mem.c (struct tm_wrapper_hasher): Likewise. +- * tree-ssa-loop-ivopts.c (may_eliminate_iv): Likewise. +- * tree-ssa-loop-niter.c (maybe_lower_iteration_bound): Likewise. +- * tree-vect-data-refs.c (vect_enhance_data_refs_alignment): Likewise. +- * value-prof.c: Likewise. +- * var-tracking.c (val_reset): Likewise. +- +-2017-04-03 Richard Biener +- +- PR tree-optimization/80275 +- * fold-const.c (split_address_to_core_and_offset): Handle +- POINTER_PLUS_EXPR. +- +-2017-04-03 Eric Botcazou +- +- * tree-nested.c (get_descriptor_type): Make sure that the alignment of +- descriptors is at least equal to that of functions. +- +-2017-04-02 Uros Bizjak +- +- * config/i386/sse.md (movdi_to_sse): Add missing DONE. +- +-2017-04-02 Uros Bizjak +- +- PR target/80250 +- * config/i386/sse.md (mov): Remove insn pattern. +- (mov): New expander. +- (*mov_internal): New insn and split pattern. +- +-2017-03-31 Segher Boessenkool +- +- PR rtl-optimization/79405 +- * fwprop.c (propagations_left): New variable. +- (forward_propagate_into): Decrement it. +- (fwprop_init): Initialize it. +- (fw_prop): If the variable has reached zero, stop propagating. +- (fwprop_addr): Ditto. +- +-2017-03-31 Jakub Jelinek +- +- PR debug/79255 +- * dwarf2out.c (decls_for_scope): If BLOCK_NONLOCALIZED_VAR is +- a FUNCTION_DECL, pass it as decl instead of origin to +- process_scope_var. +- +-2017-03-31 Alexander Monakov +- +- * config/nvptx/nvptx.c (nvptx_output_softstack_switch): Correct format +- string. +- +-2017-03-31 Pat Haugen +- +- PR target/80107 +- * config/rs6000/rs6000.md (extendhi2): Add test for +- TARGET_VSX_SMALL_INTEGER. +- +-2017-03-31 Bill Schmidt +- +- * doc/extend.texi (PowerPC AltiVec Built-in Functions): Add +- reference to the OpenPOWER 64-Bit ELF V2 ABI Specification. +- +-2017-03-31 Matthew Fortune +- +- * config/mips/mips-msa.md (msa_vec_extract_): Update +- extraction from odd-numbered MSA register. +- +-2017-03-31 Jakub Jelinek +- +- PR middle-end/80173 +- * expmed.c (store_bit_field_1): Don't attempt to create +- a word subreg out of hard registers wider than word if they +- have HARD_REGNO_NREGS of 1 for their mode. +- +- PR middle-end/80163 +- * varasm.c (initializer_constant_valid_p_1): Disallow sign-extending +- conversions to integer types wider than word and pointer. +- +- PR debug/80025 +- * cselib.h (rtx_equal_for_cselib_1): Add depth argument. +- (rtx_equal_for_cselib_p): Pass 0 to it. +- * cselib.c (cselib_hasher::equal): Likewise. +- (rtx_equal_for_cselib_1): Add depth argument. If depth +- is 128, don't look up VALUE locs and punt. Increment +- depth in recursive calls when walking VALUE locs. +- +-2017-03-31 Bernd Edlinger +- +- * gcov.c (md5sum_to_hex): Fix output of MD5 hex bytes. +- (make_gcov_file_name): Use the canonical path name for generating +- the MD5 value. +- (read_line): Fix handling of files with ascii null bytes. +- +-2017-03-30 Matthew Fortune +- +- * config/mips/mips.c (mips_expand_vector_init): Create a const_vector +- to initialise a vector register instead +- of using a const_int. +- +-2017-03-30 Jakub Jelinek +- +- PR translation/80189 +- * gimplify.c (omp_default_clause): Use %qs instead of %s in +- diagnostic messages. +- +-2017-03-30 Peter Bergner +- +- PR target/80246 +- * config/rs6000/dfp.md (dfp_dxex_): Update mode of operand 0. +- (dfp_diex_): Update mode of operand 1. +- * doc/extend.texi (dxex, dxexq): Document change to return type. +- (diex, diexq): Document change to argument type. +- +-2017-03-30 Martin Jambor +- +- PR ipa/77333 +- * cgraph.h (cgraph_build_function_type_skip_args): Declare. +- * cgraph.c (redirect_call_stmt_to_callee): Set gimple fntype so that +- it reflects the signature changes performed at the callee side. +- * cgraphclones.c (build_function_type_skip_args): Make public, renamed +- to cgraph_build_function_type_skip_args. +- (build_function_decl_skip_args): Adjust call to the above function. +- +-2017-03-30 Jakub Jelinek +- +- PR target/80206 +- * config/i386/sse.md +- (_vextract_mask): Use +- register as dest whenever it is a MEM not rtx_equal_p to the +- corresponding dup operand, and when forcing into reg move the +- reg into the memory afterwards. +- (_vextract_mask): +- Likewise. Use instead of +- for the force_reg mode. +- (avx512vl_vextractf128): Use register as dest either +- always when a MEM, or when it is a MEM not rtx_equal_p to the +- corresponding dup operand, or even not when it is a CONST_VECTOR +- depending on the mode and lo vs. hi. +- (avx512dq_vextract64x2_1_maskm): Remove extraneous +- parens. +- (avx512f_vextract32x4_1_maskm): Likewise. +- (avx512dq_vextract64x2_1): +- Likewise. Require that operands[2] is even. +- (avx512f_vextract32x4_1): +- Remove extraneous parens. Require that operands[2] is a multiple +- of 4. +- (vec_extract_lo_): Don't bother testing if +- operands[0] is a MEM if , the predicates/constraints +- disallow memory then. +- +-2017-03-30 Richard Biener +- +- PR tree-optimization/77498 +- * tree-ssa-pre.c (phi_translate_1): Do not allow simplifications +- to non-constants over backedges. +- +-2017-03-29 Segher Boessenkool +- +- PR rtl-optimization/80233 +- * combine.c (combine_instructions): Only take NONDEBUG_INSN_P insns +- as last_combined_insn. Do not test for BARRIER_P separately. +- +-2017-03-29 Andreas Schwab +- +- PR ada/80146 +- * calls.c (prepare_call_address): Convert funexp to Pmode before +- copying to temp reg. +- +-2017-03-29 Bill Schmidt +- +- PR tree-optimization/80158 +- * gimple-ssa-strength-reduction.c (replace_mult_candidate): +- Handle possible future case of more than one alternate +- interpretation. +- (replace_rhs_if_not_dup): Likewise. +- (replace_one_candidate): Likewise. +- +-2017-03-28 Vladimir Makarov +- +- PR rtl-optimization/80193 +- * ira.c (ira): Do not check allocation for LRA. +- +-2017-03-28 Alexander Monakov +- +- * config/nvptx/nvptx-protos.h (nvptx_output_simt_enter): Declare. +- (nvptx_output_simt_exit): Declare. +- * config/nvptx/nvptx.c (nvptx_init_unisimt_predicate): Use +- cfun->machine->unisimt_location. Handle NULL unisimt_predicate. +- (init_softstack_frame): Move initialization of crtl->is_leaf to... +- (nvptx_declare_function_name): ...here. Emit declaration of local +- memory space buffer for omp_simt_enter insn. +- (nvptx_output_unisimt_switch): New. +- (nvptx_output_softstack_switch): New. +- (nvptx_output_simt_enter): New. +- (nvptx_output_simt_exit): New. +- * config/nvptx/nvptx.h (struct machine_function): New fields +- has_simtreg, unisimt_location, simt_stack_size, simt_stack_align. +- * config/nvptx/nvptx.md (UNSPECV_SIMT_ENTER): New unspec. +- (UNSPECV_SIMT_EXIT): Ditto. +- (omp_simt_enter_insn): New insn. +- (omp_simt_enter): New expansion. +- (omp_simt_exit): New insn. +- * config/nvptx/nvptx.opt (msoft-stack-reserve-local): New option. +- +- * internal-fn.c (expand_GOMP_SIMT_ENTER): New. +- (expand_GOMP_SIMT_ENTER_ALLOC): New. +- (expand_GOMP_SIMT_EXIT): New. +- * internal-fn.def (GOMP_SIMT_ENTER): New internal function. +- (GOMP_SIMT_ENTER_ALLOC): Ditto. +- (GOMP_SIMT_EXIT): Ditto. +- * target-insns.def (omp_simt_enter): New insn. +- (omp_simt_exit): Ditto. +- * omp-low.c (struct omplow_simd_context): New fields simt_eargs, +- simt_dlist. +- (lower_rec_simd_input_clauses): Implement SIMT privatization. +- (lower_rec_input_clauses): Likewise. +- (lower_lastprivate_clauses): Handle SIMT privatization. +- +- * omp-offload.c: Include langhooks.h, tree-nested.h, stor-layout.h. +- (ompdevlow_adjust_simt_enter): New. +- (find_simtpriv_var_op): New. +- (execute_omp_device_lower): Handle IFN_GOMP_SIMT_ENTER, +- IFN_GOMP_SIMT_ENTER_ALLOC, IFN_GOMP_SIMT_EXIT. +- +- * tree-inline.h (struct copy_body_data): New field dst_simt_vars. +- * tree-inline.c (expand_call_inline): Handle SIMT privatization. +- (copy_decl_for_dup_finish): Ditto. +- +- * tree-ssa.c (execute_update_addresses_taken): Handle GOMP_SIMT_ENTER. +- +-2017-03-28 Uros Bizjak +- +- PR target/53383 +- * config/i386/i386.c (ix86_option_override_internal): Always +- allow -mpreferred-stack-boundary=3D3 for 64-bit targets. +- +-2017-03-28 Bin Cheng +- +- * tree-vect-loop.c (optimize_mask_stores): Add bb to the right loop. +- +-2017-03-28 Bin Cheng +- +- * tree-vect-loop-manip.c (slpeel_add_loop_guard): New param and +- mark new edge's irreducible flag accordign to it. +- (vect_do_peeling): Check loop preheader edge's irreducible flag +- and pass it to function slpeel_add_loop_guard. +- +-2017-03-28 Richard Sandiford +- +- PR tree-optimization/80218 +- * tree-call-cdce.c (shrink_wrap_one_built_in_call_with_conds): +- Update block frequencies and counts. +- +-2017-03-28 Richard Biener +- +- PR tree-optimization/78644 +- * tree-ssa-ccp.c (evaluate_stmt): When we may not use the value +- of a simplification result we may not use it at all. +- +-2017-03-28 Richard Biener +- +- PR ipa/80205 +- * tree-inline.c (copy_phis_for_bb): Do not create PHI node +- without arguments, generate default definition of a SSA name. +- +-2017-03-28 Richard Biener +- +- PR middle-end/80222 +- * gimple-fold.c (gimple_fold_indirect_ref): Do not touch +- TYPE_REF_CAN_ALIAS_ALL references. +- * fold-const.c (fold_indirect_ref_1): Likewise. +- +-2017-03-28 Martin Liska +- +- PR ipa/80104 +- * cgraphunit.c (cgraph_node::expand_thunk): Mark argument of a +- thunk call as DECL_GIMPLE_REG_P when vector or complex type. +- +-2017-03-28 Claudiu Zissulescu +- Thomas Petazzoni +- +- * config/arc/arc.h (CPP_SPEC): Add subtarget_cpp_spec. +- (EXTRA_SPECS): Define. +- (SUBTARGET_EXTRA_SPECS): Likewise. +- (SUBTARGET_CPP_SPEC): Likewise. +- * config/arc/elf.h (EXTRA_SPECS): Renamed to +- SUBTARGET_EXTRA_SPECS. +- * config/arc/linux.h (SUBTARGET_CPP_SPEC): Define. +- +-2017-03-28 Claudiu Zissulescu +- +- * config/arc/simdext.md (vst64_insn): Update pattern. +- (vld32wh_insn): Likewise. +- (vld32wl_insn): Likewise. +- (vld64_insn): Likewise. +- (vld32_insn): Likewise. +- +-2017-03-28 Marek Polacek +- +- PR sanitizer/80067 +- * fold-const.c (fold_comparison): Use protected_set_expr_location +- instead of SET_EXPR_LOCATION. +- +-2017-03-28 Markus Trippelsdorf +- +- * tree.c (add_expr): Avoid name lookup warning. +- +-2017-03-27 Jeff Law +- +- PR tree-optimization/80216 +- * tree-ssa-dom.c (derive_equivalences_from_bit_ior): Fix typo in +- function name. Limit recursion depth. +- (record_temporary_equivalences): Corresponding changes. +- +-2017-03-27 Jonathan Wakely +- +- * doc/invoke.texi (-Wno-narrowing): Reorder so default behavior is +- covered first. +- +-2017-03-27 Jakub Jelinek +- +- PR target/80102 +- * reg-notes.def (REG_CFA_NOTE): Define. Use it for CFA related +- notes. +- * cfgcleanup.c (reg_note_cfa_p): New array. +- (insns_have_identical_cfa_notes): New function. +- (old_insns_match_p): Don't cross-jump in between /f +- and non-/f instructions. If both i1 and i2 are frame related, +- verify all CFA notes, their order and content. +- +-2017-03-27 Michael Meissner +- +- PR target/78543 +- * config/rs6000/rs6000.md (bswaphi2_extenddi): Combine bswap +- HImode and SImode with zero extend to DImode to one insn. +- (bswap2_extenddi): Likewise. +- (bswapsi2_extenddi): Likewise. +- (bswaphi2_extendsi): Likewise. +- (bswaphi2): Combine bswap HImode and SImode into one insn. +- Separate memory insns from swapping register. +- (bswapsi2): Likewise. +- (bswap2): Likewise. +- (bswaphi2_internal): Delete, no longer used. +- (bswapsi2_internal): Likewise. +- (bswap2_load): Split bswap HImode/SImode into separate load, +- store, and gpr<-gpr swap insns. +- (bswap2_store): Likewise. +- (bswaphi2_reg): Register only splitter, combine with the splitter. +- (bswaphi2 splitter): Likewise. +- (bswapsi2_reg): Likewise. +- (bswapsi2 splitter): Likewise. +- (bswapdi2): If we have the LDBRX and STDBRX instructions, split +- the insns into load, store, and register/register insns. +- (bswapdi2_ldbrx): Likewise. +- (bswapdi2_load): Likewise. +- (bswapdi2_store): Likewise. +- (bswapdi2_reg): Likewise. +- +-2017-03-27 Gunther Nikl +- +- * system.h (HAVE_DESIGNATED_INITIALIZERS): Fix non C++ case. +- (HAVE_DESIGNATED_UNION_INITIALIZERS): Likewise. +- +-2017-03-27 Kelvin Nilsen +- +- PR target/80103 +- * config/rs6000/rs6000-c.c (rs6000_target_modify_macros): Edit and +- add comments. +- * config/rs6000/rs6000.c (rs6000_option_override_internal): Add +- special handling for target option conflicts between dform +- options (-mpower9-dform, -mpower9-dform-vector, +- -mpower9-dform-scalar) and -mno-direct-move. +- +-2017-03-27 Richard Biener +- +- PR tree-optimization/80181 +- * tree-ssa-ccp.c (likely_value): UNDEFINED ^ X is UNDEFINED. +- +-2017-03-27 Claudiu Zissulescu +- +- * config/arc/predicates.md (move_double_src_operand): Replace the +- call to move_double_src_operand with a call to address_operand. +- +-2017-03-27 Claudiu Zissulescu +- +- * config/arc/elf.h (ARGET_ARC_TP_REGNO_DEFAULT): Define. +- * config/arc/linux.h (ARGET_ARC_TP_REGNO_DEFAULT): Likewise. +- * config/arc/arc.opt (mtp-regno): Use ARGET_ARC_TP_REGNO_DEFAULT. +- +-2017-03-27 Claudiu Zissulescu +- +- * config/arc/predicates.md (long_immediate_loadstore_operand): +- Consider scaled addresses cases. +- +-2017-03-27 Claudiu Zissulescu +- +- * config/arc/arc.c (arc_epilogue_uses): BLINK should be also +- restored when in interrupt. +- * config/arc/arc.md (simple_return): ARCv2 rtie instruction +- doesn't have delay slot. +- +-2017-03-27 Richard Biener +- +- PR ipa/79776 +- * tree-ssa-structalias.c (associate_varinfo_to_alias): Skip +- inlined thunk clones. +- +-2017-03-27 Jakub Jelinek +- +- PR sanitizer/80168 +- * asan.c (instrument_derefs): Copy over last operand from +- original COMPONENT_REF to the new COMPONENT_REF with +- DECL_BIT_FIELD_REPRESENTATIVE. +- * ubsan.c (instrument_object_size): Likewise. +- +-2017-03-27 Richard Biener +- +- PR tree-optimization/80170 +- * tree-vect-data-refs.c (vect_compute_data_ref_alignment): Make +- sure DR/SCEV didnt fold in constants we do not see when looking +- at the reference base alignment. +- +-2017-03-27 Richard Biener +- +- PR middle-end/80171 +- * gimple-fold.c (fold_ctor_reference): Properly guard against +- NULL return value from canonicalize_constructor_val. +- +-2017-03-25 Uros Bizjak +- +- PR target/80180 +- * config/i386/i386.c (ix86_expand_builtin) +- : Do not expand arg0 between +- flags reg setting and flags reg using instructions. +- : Ditto. Use non-flags reg +- clobbering instructions to zero extend op2. +- +-2017-03-25 Gerald Pfeifer +- +- * doc/install.texi (Configuration) <--with-aix-soname>: +- Update link to AIX ld. +- +-2017-03-25 Bernd Schmidt +- +- PR rtl-optimization/80160 +- PR rtl-optimization/80159 +- * lra-assigns.c (must_not_spill_p): Tighten new test to also take +- reg_alternate_class into account. +- +-2017-03-24 Vladimir Makarov +- +- PR target/80148 +- * lra-assigns.c (assign_by_spills): Add spilled non-reload pseudos +- to consider in curr_insn_transform. +- +-2017-03-24 Jakub Jelinek +- +- * genrecog.c (validate_pattern): Add VEC_SELECT validation. +- * genmodes.c (emit_min_insn_modes_c): Call emit_mode_nunits +- and emit_mode_inner. +- +-2017-03-24 Andreas Krebbel +- +- * config/s390/s390-builtins.def: Add VXE builtins. Add a flags +- argument to the overloaded builtin variants. Use the new flag to +- deprecate certain builtin variants. +- * config/s390/s390-builtin-types.def: Add new builtin types. +- * config/s390/s390-builtins.h: Support new flags field for +- overloaded builtins. +- * config/s390/s390-c.c (OB_DEF_VAR): New flags field. +- (s390_macro_to_expand): Enable vector float data type. +- (s390_cpu_cpp_builtins_internal): Indicate support of the new +- builtins by incrementing the __VEC__ version number. +- (s390_expand_overloaded_builtin): Support expansion of vec_xl and +- vec_xst. +- (s390_resolve_overloaded_builtin): Emit error messages depending +- on the builtin flags. +- * config/s390/s390.c (s390_expand_builtin): Support additional +- flags argument. Change error message to match the messages +- emitted in s390-c.c. +- * config/s390/s390.md: New UNSPEC_* constants. +- (op_type): Add new instruction types. +- * config/s390/vecintrin.h: Add new builtins and test data class +- constants. +- * config/s390/vx-builtins.md (V_HW_32_64): Add V4SF. +- (V_HW_4, VEC_HW, VECF_HW): New mode iterators. +- (VEC_INEXACT, VEC_NOINEXACT): New constants. +- ("vec_splats", "vec_insert", "vec_promote") +- ("vec_insert_and_zero", "vec_mergeh") +- ("vec_mergel"): V_HW -> VEC_HW. +- +- ("vlrlrv16qi", "vstrlrv16qi", "vbpermv16qi", "vec_msumv2di") +- ("vmslg", "*vftci_cconly", "vftci_intcconly") +- ("*vftci", "vftci_intcc", "vec_double_s64") +- ("vec_double_u64", "vfmin", "vfmax"): New definition. +- +- ("and_av2df3", "and_cv2df3", "vec_andc_av2df3") +- ("vec_andc_cv2df3", "xor_av2df3", "xor_cv2df3", "vec_nor_av2df3") +- ("vec_nor_cv2df3", "ior_av2df3", "ior_cv2df3", "vec_nabs") +- ("*vftcidb", "*vftcidb_cconly", "vftcidb"): Remove definition. +- +- ("vec_all_v2df", "vec_any_v2df") +- ("vec_scatter_elementv4si_DI", "vec_cmpv2df") +- ("vec_di_to_df_s64", "vec_di_to_df_u64", "vec_df_to_di_u64") +- ("vfidb", "*vldeb", "*vledb", "*vec_cmpv2df_cconly") +- ("vec_cmpeqv2df_cc", "vec_cmpeqv2df_cc", "vec_cmphv2df_cc") +- ("vec_cmphev2df_cc", "*vec_cmpeqv2df_cc") +- ("*vec_cmphv2df_cc", "*vec_cmphev2df_cc"): Enable new modes as ... +- +- ("vec_all_", "vec_any_") +- ("vec_scatter_element_DI") +- ("vec_cmp", "vcdgb", "vcdlgb", "vclgdb") +- ("vec_fpint", "vflls") +- ("vflrd", "*vec_cmp_cconly", "vec_cmpeq_cc") +- ("vec_cmpeq_cc", "vec_cmph_cc", "vec_cmphe_cc") +- ("*vec_cmpeq_cc", "*vec_cmph_cc") +- ("*vec_cmphe_cc"): ... these. +- +- ("vec_ctd_s64", "vec_ctsl", "vec_ctul", "vec_st2f"): Use rounding +- mode constant instead of magic value. +- +-2017-03-24 Andreas Krebbel +- +- * config/s390/s390.c (s390_expand_vec_compare): Support other +- vector floating point modes than just V2DF. +- (s390_expand_vcond): Likewise. +- (s390_hard_regno_mode_ok): Allow SFmode values in VRs. +- (s390_cannot_change_mode_class): Prevent mode changes between TF +- and V1TF in vector registers. +- * config/s390/s390.md (DF, SF): New mode attributes. +- ("*cmp_ccs", "add3", "sub3", "mul3") +- ("fma4", "fms4", "div3", "*neg2"): Add +- SFmode support for VRs. +- * config/s390/vector.md (V_HW, V_HW2, VT_HW, ti*, nonvec): Add new +- vector fp modes. +- (VFT, VF_HW): New mode iterators. +- (vw, sdx): New mode attributes. +- ("addv2df3", "subv2df3", "mulv2df3", "divv2df3", "sqrtv2df2") +- ("fmav2df4","fmsv2df4", "negv2df2", "absv2df2", "*negabsv2df2") +- ("smaxv2df3", "sminv2df3", "*vec_cmpv2df_nocc") +- ("vec_cmpuneqv2df", "vec_cmpltgtv2df", "vec_orderedv2df") +- ("vec_unorderedv2df"): Adjust the v2df only patterns to support +- also the new vector floating point modes. Renaming to ... +- +- ("add3", "sub3", "mul3", "div3") +- ("sqrt2", "fma4", "fms4", "neg2") +- ("abs2", "negabs2", "smax3") +- ("smin3", "*vec_cmp_nocc") +- ("vec_cmpuneq", "vec_cmpltgt", "vec_ordered") +- ("vec_unordered"): ... these. +- +- ("neg_fma4", "neg_fms4", "*smax3_vxe") +- ("*smin3_vxe", "*sminv2df3_vx", "*vec_extendv4sf") +- ("*vec_extendv2df"): New insn definitions. +- +-2017-03-24 Andreas Krebbel +- +- * config/s390/s390.md ("*adddi3_sign", "*subdi3_sign", "mulditi3") +- ("mulditi3_2", "*muldi3_sign"): New patterns. +- ("muldi3", "*muldi3", "mulsi3", "*mulsi3"): Add an expander and +- rename the pattern definition. +- +-2017-03-24 Andreas Krebbel +- +- * config/s390/s390.md ("indirect_jump"): Turn insn definition into +- expander. +- ("*indirect_jump", "*indirect2_jump"): New pattern definitions. +- +-2017-03-24 Andreas Krebbel +- +- * config/s390/s390.c (s390_expand_vec_init): Use vllezl +- instruction if possible. +- * config/s390/vector.md (vec_halfnumelts): New mode +- attribute. +- ("*vec_vllezlf"): New pattern. +- +-2017-03-24 Andreas Krebbel +- +- * config/s390/vector.md ("popcountv16qi2", "popcountv8hi2") +- ("popcountv4si2", "popcountv2di2"): Rename to ... +- ("popcount2", "popcountv8hi2_vx", "popcountv4si2_vx") +- ("popcountv2di2_vx"): ... these and add !TARGET_VXE to the +- condition. +- ("popcount2_vxe"): New pattern. +- +-2017-03-24 Andreas Krebbel +- +- * common/config/s390/s390-common.c (processor_flags_table): Add +- arch12. +- * config.gcc: Add arch12. +- * config/s390/driver-native.c (s390_host_detect_local_cpu): +- Default to arch12 for unknown CPU model numbers. +- * config/s390/s390-builtins.def: Add B_VXE builtin flag. +- * config/s390/s390-c.c (s390_cpu_cpp_builtins_internal): Adjust +- PROCESSOR_max sanity check. +- * config/s390/s390-opts.h (enum processor_type): Add +- PROCESSOR_ARCH12. +- * config/s390/s390.c (processor_table): Add arch12. +- (s390_expand_builtin): Add check for B_VXE flag. +- (s390_issue_rate): Add PROCESSOR_ARCH12. +- (s390_get_sched_attrmask): Likewise. +- (s390_get_unit_mask): Likewise. +- (s390_sched_score): Enable z13 scheduling for arch12. +- (s390_sched_reorder): Likewise. +- (s390_sched_variable_issue): Likewise. +- * config/s390/s390.h (enum processor_flags): Add PF_ARCH12 and +- PF_VXE. +- (s390_tune_attr): Use z13 scheduling also for arch12. +- (TARGET_CPU_ARCH12, TARGET_CPU_ARCH12_P, TARGET_CPU_VXE) +- (TARGET_CPU_VXE_P, TARGET_ARCH12, TARGET_ARCH12_P, TARGET_VXE) +- (TARGET_VXE_P): New macros. +- * config/s390/s390.md: Add arch12 to cpu attribute. Add arch12 +- and vxe to cpu_facility. Add arch12 and vxe to enabled attribute. +- * config/s390/s390.opt: Add arch12 as processor_type. +- +-2017-03-24 Andreas Krebbel +- +- * config/s390/s390.md +- ("fixuns_truncdddi2", "fixuns_trunctddi2") +- ("fixuns_trunc2"): Merge into ... +- ("fixuns_trunc2"): New expander. +- +- ("fixuns_trunc2", "fixuns_truncsi2"): +- Rename expanders to ... +- +- ("fixuns_trunc2_emu") +- ("fixuns_truncdddi2_emu"): ... these. +- +- ("fixuns_truncsi2_emu"): New expander. +- +- ("*fixuns_truncdfdi2_z13"): Rename to ... +- ("*fixuns_truncdfdi2_vx"): ... this. +- +-2017-03-24 Andreas Krebbel +- +- * config/s390/2964.md: Remove the single element vector compare +- instructions which are no longer used. +- * config/s390/s390.c (s390_select_ccmode): Remove handling of +- vector CCmodes. +- (s390_canonicalize_comparison): Remove handling of DFmode +- compares. +- (s390_expand_vec_compare_scalar): Remove function. +- (s390_emit_compare): Don't call s390_expand_vec_compare_scalar. +- * config/s390/s390.md ("*vec_cmpdf_cconly"): Remove +- pattern. +- ("*cmp_ccs"): Add wfcdb instruction. +- +-2017-03-24 Andreas Krebbel +- +- * config/s390/s390.md ("mov_64dfp" DD_DF): Use vleig for loading a +- FP zero. +- ("*mov_64" DD_DF): Remove the vector instructions. These +- will anyway by matched by mov_64dfp. +- +-2017-03-24 Andreas Krebbel +- +- * config/s390/s390.md ("mov" SD_SF): Change vleg/vsteg to +- vlef/vstef. Add missing operand to vleif. +- +-2017-03-24 Andreas Krebbel +- +- * config/s390/s390.c (s390_expand_vec_init): Enable vector load +- pair for all vector types with 64 bit elements. +- * config/s390/vx-builtins.md (V_HW_64): Move mode iterator to ... +- * config/s390/vector.md (V_HW_64): ... here. +- (V_128_NOSINGLE): New mode iterator. +- ("vec_init"): Use V_128 as mode iterator. +- ("*vec_splat"): Use V_128_NOSINGLE mode iterator. +- ("*vec_tf_to_v1tf", "*vec_ti_to_v1ti"): New pattern definitions. +- ("*vec_load_pairv2di"): Change to ... +- ("*vec_load_pair"): ... this one. +- +-2017-03-24 Andreas Krebbel +- +- * config/s390/constraints.md: Add comments. +- (jKK): Reject element sizes > 8 bytes. +- * config/s390/s390.c (s390_split_ok_p): Enable splitting also for +- s_operands. +- * config/s390/s390.md: Add the s_operand checks formerly in +- s390_split_ok_p to various splitters where they are still +- required. +- * config/s390/vector.md ("mov" V_128): Add GPR alternatives +- for 128 bit vectors. Plus two splitters. +- +-2017-03-24 Andreas Krebbel +- +- * config/s390/s390.md: Rename the cpu facilty vec to vx throughout +- the file. +- +-2017-03-24 Andreas Krebbel +- +- PR target/79893 +- * config/s390/s390-c.c (s390_adjust_builtin_arglist): Issue an +- error if the boundary argument is not constant. +- +-2017-03-24 Jakub Jelinek +- +- PR rtl-optimization/80112 +- * loop-doloop.c (doloop_condition_get): Don't check condition +- if cmp isn't SET with IF_THEN_ELSE src. +- +-2017-03-24 Bill Schmidt +- +- PR tree-optimization/80158 +- * gimple-ssa-strength-reduction.c (replace_mult_candidate): When +- replacing a candidate statement, also replace it for the +- candidate's alternate interpretation. +- (replace_rhs_if_not_dup): Likewise. +- (replace_one_candidate): Likewise. +- +-2017-03-24 Richard Biener +- +- PR tree-optimization/80167 +- * graphite-isl-ast-to-gimple.c +- (translate_isl_ast_to_gimple::is_valid_rename): Handle default-defs +- properly. +- (translate_isl_ast_to_gimple::get_rename): Likewise. +- +-2017-03-23 Kelvin Nilsen +- +- * config/rs6000/rs6000.c (rs6000_option_override_internal): Change +- handling of certain combinations of target options, including the +- combinations -mpower8-vector vs. -mno-vsx, -mpower9-vector vs. +- -mno-power8-vector, and -mpower9_dform vs. -mno-power9-vector. +- +-2017-03-23 Kyrylo Tkachov +- +- PR target/71436 +- * config/arm/arm.md (*load_multiple): Add reload_completed to +- matching condition. +- +-2017-03-23 Bill Schmidt +- Richard Biener +- +- PR tree-optimization/79908 +- PR tree-optimization/80136 +- * tree-stdarg.c (expand_ifn_va_arg_1): For a VA_ARG whose LHS has +- been cast away, gimplify_and_add suffices. +- +-2017-03-23 Markus Trippelsdorf +- +- * tree-vrp.c (identify_jump_threads): Delete avail_exprs. +- +-2017-03-23 Richard Biener +- +- PR tree-optimization/80032 +- * gimplify.c (gimple_push_cleanup): Forced unconditional +- cleanups still have to go to the conditional_cleanups +- sequence. +- +-2017-03-22 Jakub Jelinek +- +- PR tree-optimization/80072 +- * tree-ssa-reassoc.c (struct operand_entry): Change id field type +- to unsigned int. +- (next_operand_entry_id): Change type to unsigned int. +- (sort_by_operand_rank): Make sure to return the right return value +- even if unsigned fields are bigger than INT_MAX. +- (struct oecount): Change cnt and id type to unsigned int. +- (oecount_hasher::equal): Formatting fix. +- (oecount_cmp): Make sure to return the right return value +- even if unsigned fields are bigger than INT_MAX. +- (undistribute_ops_list): Change next_oecount_id type to unsigned int. +- +- PR c++/80129 +- * gimplify.c (gimplify_modify_expr_rhs) : Clear +- TREE_READONLY on result if writing it more than once. +- +- PR sanitizer/80110 +- * doc/invoke.texi (-fsanitize=3Dthread): Document that with +- -fnon-call-exceptions atomics are not able to throw +- exceptions. +- +- PR sanitizer/80110 +- * tsan.c: Include tree-eh.h. +- (instrument_builtin_call): Call maybe_clean_eh_stmt or +- maybe_clean_or_replace_eh_stmt where needed. +- (instrument_memory_accesses): Add cfg_changed argument. +- Call gimple_purge_dead_eh_edges on each block and set *cfg_changed +- if it returned true. +- (tsan_pass): Adjust caller. Return TODO_cleanup_cfg if cfg_changed. +- +- PR rtl-optimization/63191 +- * config/i386/i386.c (ix86_delegitimize_address): Turn into small +- wrapper function, moved the whole old content into ... +- (ix86_delegitimize_address_1): ... this. New inline function. +- (ix86_find_base_term): Use ix86_delegitimize_address_1 with +- true as last argument instead of ix86_delegitimize_address. +- +-2017-03-22 Wilco Dijkstra +- +- * config/aarch64/aarch64.c (generic_branch_cost): Copy +- cortexa57_branch_cost. +- +-2017-03-22 Wilco Dijkstra +- +- * config/aarch64/aarch64.c (generic_tunings): Add AES fusion. +- +-2017-03-21 Aaron Sawdey +- +- PR target/80123 +- * doc/md.texi (Constraints): Document wA constraint. +- * config/rs6000/constraints.md (wA): New. +- * config/rs6000/rs6000.c (rs6000_debug_reg_global): Add wA reg_class. +- (rs6000_init_hard_regno_mode_ok): Init wA constraint. +- * config/rs6000/rs6000.h (RS6000_CONSTRAINT_wA): New. +- * config/rs6000/vsx.md (vsx_splat_): Use wA constraint. +- +-2017-03-22 Cesar Philippidis +- +- PR c++/80029 +- * gimplify.c (is_oacc_declared): New function. +- (oacc_default_clause): Use it to set default flags for acc declared +- variables inside parallel regions. +- (gimplify_scan_omp_clauses): Strip firstprivate pointers for acc +- declared variables. +- (gimplify_oacc_declare): Gimplify the declare clauses. Add the +- declare attribute to any decl as necessary. +- +-2017-03-22 Thomas Preud'homme +- +- PR target/80082 +- * config/arm/arm-isa.h (isa_bit_lpae): New feature bit. +- (ISA_ARMv7ve): Add isa_bit_lpae to the definition. +- * config/arm/arm-protos.h (arm_arch7ve): Rename into ... +- (arm_arch_lpae): This. +- * config/arm/arm.c (arm_arch7ve): Rename into ... +- (arm_arch_lpae): This. Define it in term of isa_bit_lpae. +- * config/arm/arm.h (TARGET_HAVE_LPAE): Redefine in term of +- arm_arch_lpae. +- +-2017-03-22 Martin Liska +- +- PR target/79906 +- * config/rs6000/rs6000.c (rs6000_inner_target_options): Show +- error message instead of an ICE. +- +-2017-03-21 Bill Schmidt +- +- * doc/extend.texi (6.11 Additional Floating Types): Revise. +- +-2017-03-21 Kelvin Nilsen +- +- * config/rs6000/rs6000-c.c (rs6000_target_modify_macros): Add +- comments. +- * config/rs6000/rs6000.c (rs6000_option_override_internal): Add +- comments. +- +-2017-03-21 Martin Sebor +- +- * doc/extend.texi: Use "cannot" instead of "can't." +- * doc/hostconfig.texi: Same. +- * doc/install.texi: Same. +- * doc/invoke.texi: Same. +- * doc/loop.texi: Same. +- * doc/md.texi: Same. +- * doc/objc.texi: Same. +- * doc/rtl.texi: Same. +- * doc/tm.texi: Same. +- * doc/tm.texi.in: Same. +- * doc/trouble.texi: Same. +- +-2017-03-21 Alexandre Oliva +- +- PR debug/63238 +- * dwarf2out.c (struct checksum_attributes): Add at_alignment. +- (collect_checksum_attributes): Set it. +- (die_checksum_ordered): Use it. +- +-2017-03-21 Bill Schmidt +- +- PR tree-optimization/79908 +- * tree-stdarg.c (expand_ifn_va_arg_1): Revert the following +- change: For a VA_ARG whose LHS has been cast away, use +- force_gimple_operand to construct the side effects. +- +-2017-03-21 David Malcolm +- +- PR translation/80001 +- * omp-offload.c (oacc_loop_fixed_partitions): Make diagnostics +- more amenable to translation. +- (oacc_loop_auto_partitions): Likewise. +- +-2017-03-21 Marek Polacek +- Martin Sebor +- +- PR tree-optimization/80109 +- * gimple-ssa-warn-alloca.c (alloca_call_type): Only call get_range_info +- on INTEGRAL_TYPE_P. +- +-2017-03-21 Jakub Jelinek +- Segher Boessenkool +- +- PR target/80125 +- * combine.c (can_combine_p): Revert the 2017-03-20 change, only +- check reg_used_between_p between insn and one of succ or succ2 +- depending on if succ is artificial insn not inserted into insn +- stream. +- +-2017-03-21 Martin Liska +- +- PR gcov-profile/80081 +- * Makefile.in: Add gcov-dump and fix installation of gcov-tool. +- * doc/gcc.texi: Include gcov-dump stuff. +- * doc/gcov-dump.texi: New file. +- +-2017-03-21 Toma Tabacu +- +- PR rtl-optimization/79150 +- * config/mips/mips.c (mips_block_move_loop): Emit a NOP after the +- conditional jump, if the jump is the last insn of the loop. +- +-2017-03-21 Bill Schmidt +- Richard Biener +- +- PR tree-optimization/79908 +- * tree-stdarg.c (expand_ifn_va_arg_1): For a VA_ARG whose LHS has +- been cast away, use force_gimple_operand to construct the side +- effects. +- +-2017-03-21 Martin Liska +- +- PR libfortran/79956 +- * simplify-rtx.c (simplify_immed_subreg): Initialize a variable +- to NULL. +- +-2017-03-21 Brad Spengler +- +- PR plugins/80094 +- * plugin.c (htab_hash_plugin): New function. +- (add_new_plugin): Use it and adjust. +- (parse_plugin_arg_opt): Adjust. +- (init_one_plugin): Likewise. +- +-2017-03-21 Richard Biener +- +- PR tree-optimization/80032 +- * gimplify.c (gimple_push_cleanup): Add force_uncond parameter, +- if set force the cleanup to happen unconditionally. +- (gimplify_target_expr): Push inserted clobbers with force_uncond +- to avoid them being removed by control-dependent DCE. +- +-2017-03-21 Richard Biener +- +- PR tree-optimization/80122 +- * tree-inline.c (copy_bb): Do not expans va-arg packs or +- va_arg_pack_len when the inlined call stmt requires pack +- expansion itself. +- * tree-inline.h (struct copy_body_data): Make call_stmt a gcall *. +- +-2017-03-21 Jakub Jelinek +- +- PR sanitizer/78158 +- * tsan.c (instrument_builtin_call): If the memory model argument +- is not a constant, assume it is valid. +- +- PR c/67338 +- * fold-const.c (round_up_loc): Negate divisor in unsigned type to +- avoid UB. +- +-2017-03-20 Segher Boessenkool +- +- PR rtl-optimization/79910 +- * combine.c (can_combine_p): Do not allow combining an I0 or I1 +- if its dest is used by an insn before I2 (other than the combined +- insns themselves, which are properly handled already). +- +-2017-03-20 Segher Boessenkool +- +- Revert: +- 2017-03-17 Bernd Schmidt +- +- * combine.c (record_used_regs): New static function. +- (try_combine): Handle situations where there is an additional +- instruction between I2 and I3 which needs to have a LOG_LINK +- updated. +- +- Revert: +- 2017-03-17 Jim Wilson +- +- * combine.c (try_combine): Delete redundant i1 test. Call +- prev_nonnote_nondebug_insn instead of prev_nonnote_insn. +- +-2017-03-20 Aaron Sawdey +- +- PR target/80083 +- * config/rs6000/rs6000.md (*movsi_internal1): Fix constraints for +- alternatives 13/14. +- +-2017-03-20 Bill Schmidt +- +- PR tree-optimization/80054 +- * gimple-ssa-strength-reduction.c (all_phi_incrs_profitable): Fail +- the optimization if a PHI or any of its arguments is not dominated +- by the candidate's basis. Use gphi* rather than gimple* as +- appropriate. +- (replace_profitable_candidates): Clean up a gimple* variable that +- should be a gphi* variable. +- +-2017-03-20 Martin Sebor +- +- PR c++/52477 +- * doc/extend.texi (attribute constructor): Document present limitation. +- +-2017-03-20 Kelvin Nilsen +- +- PR target/79963 +- * config/rs6000/altivec.h (vec_all_ne): Under __cplusplus__ and +- __POWER9_VECTOR__ #ifdef control, change template definition to +- use Power9-specific built-in function. +- (vec_any_eq): Likewise. +- * config/rs6000/vector.md (vector_ae_v2di_p): Change the flag used +- to control outcomes from this test. +- (vector_ae_p): For VEC_F modes, likewise. +- +-2017-03-20 Ian Lance Taylor +- +- * config/i386/i386.c (ix86_function_regparm): Save an extra +- register for -fsplit-stack with DECL_STATIC_CHAIN. +- +-2017-03-17 Palmer Dabbelt +- +- PR target/79912 +- * config/riscv/riscv.c (riscv_preferred_reload_class): Remove. +- (TARGET_PREFERRED_RELOAD_CLASS): Likewise. +- +-2017-03-17 Palmer Dabbelt +- +- * config/riscv/riscv.c (riscv_print_operand): Use "fence +- iorw,ow". +- * config/riscv/sync.mc (mem_thread_fence_1): Use "fence +- iorw,iorw". +- +-2017-03-20 Marek Polacek +- +- PR sanitizer/80063 +- * asan.c (DEF_SANITIZER_BUILTIN): Use do { } while (0). +- +-2017-03-20 Richard Biener +- +- PR tree-optimization/80113 +- * graphite-isl-ast-to-gimple.c (copy_loop_phi_nodes): Do not +- allocate extra SSA name for PHI def. +- (add_close_phis_to_outer_loops): Likewise. +- (add_close_phis_to_merge_points): Likewise. +- (copy_loop_close_phi_args): Likewise. +- (copy_cond_phi_nodes): Likewise. +- +-2017-03-20 Martin Liska +- +- PR middle-end/79753 +- * tree-chkp.c (chkp_build_returned_bound): Do not build +- returned bounds for a LHS that's not a BOUNDED_P type. +- +-2017-03-20 Martin Liska +- +- PR target/79769 +- PR target/79770 +- * tree-chkp.c (chkp_find_bounds_1): Handle REAL_CST, +- COMPLEX_CST and VECTOR_CST. +- +-2017-03-20 Andreas Krebbel +- +- PR target/78857 +- * config/s390/s390.md ("cmp_ccs_0"): Add a clobber of the +- target operand. A new splitter adds the clobber statement in case +- the target operand is dead anyway. +- +-2017-03-19 Gerald Pfeifer +- +- * doc/install.texi (Specific) : No longer refer +- to age-old versions of binutils and glibc. +- +-2017-03-18 Segher Boessenkool +- +- * doc/contrib.texi (Contributors): Remove duplicate entry for myself. +- +-2017-03-18 Gerald Pfeifer +- +- * doc/contrib.texi (Contributors): Add Segher Boessenkool. +- +-2017-03-18 Gerald Pfeifer +- +- * doc/install.texi (Specific) : Remove old +- requirement for binutils 2.13. +- +-2017-03-17 Jim Wilson +- +- * combine.c (try_combine): Delete redundant i1 test. Call +- prev_nonnote_nondebug_insn instead of prev_nonnote_insn. +- +-2017-03-17 Palmer Dabbelt : Add riscv32-*-elf, +- riscv32-*-linux, riscv64-*-elf, riscv64-*-linux to the table of +- contents. +- : Re-arrange section +- : Add a note about requiring binutils 2.28. +- : Likewise. +- : Likewise +- : Likewise. +- +-2017-03-17 Richard Earnshaw +- +- PR target/80052 +- * aarch64.opt(verbose-cost-dump): Fix typo. +- +-2017-03-17 Pat Haugen +- +- PR target/79951 +- * config/rs6000/rs6000.md (copysign3_fcpsgn): Test +- for VECTOR_UNIT_VSX_P (mode) too. +- +-2017-03-17 Bernd Schmidt +- +- * reload.c (find_reloads): When reloading a nonoffsettable address, +- use RELOAD_OTHER for it and its address reloads. +- +- PR rtl-optimization/79910 +- * combine.c (record_used_regs): New static function. +- (try_combine): Handle situations where there is an additional +- instruction between I2 and I3 which needs to have a LOG_LINK +- updated. +- +-2017-03-17 Jeff Law +- +- PR tree-optimization/71437 +- * tree-vrp.c (simplify_stmt_for_jump_threading): Lookup the +- conditional in the hash table first. +- (vrp_dom_walker::before_dom_children): Extract condition from +- ASSERT_EXPR. Record condition, its inverion and any implied +- conditions as well. +- +-2017-03-17 Marek Polacek +- Markus Trippelsdorf +- +- PR tree-optimization/80079 +- * gimple-ssa-store-merging.c (class pass_store_merging): Initialize +- m_stores_head. +- +-2017-03-17 Richard Biener +- +- PR middle-end/80075 +- * tree-eh.c (stmt_could_throw_1_p): Only handle gimple assigns. +- Properly verify the LHS before the RHS possibly claims to be +- handled. +- (stmt_could_throw_p): Hande gimple conds fully here. Clobbers +- do not throw. +- +-2017-03-17 Martin Jambor +- +- * doc/invoke.texi (Option Options): Include -fipa-vrp in the list. +- (List of -O2 options): Likewise. +- (-fipa-bit-cp): Replace "ipa" with "interprocedural." +- (-fipa-vrp) New. +- +-2017-03-17 Tom de Vries +- +- * gcov-dump.c (print_usage): Print bug_report_url. +- +-2017-03-17 Richard Biener +- +- PR middle-end/80050 +- * genmatch.c (parser::next): Remove pointless check for CPP_EOF. +- (parser::peek): Likewise. +- +-2017-03-17 Richard Biener +- +- PR tree-optimization/80048 +- * sese.c (free_sese_info): Properly release rename_map and +- copied_bb_map elements. +- +-2017-03-16 Alexandre Oliva +- +- * gimple-ssa-store-merging.c (struct imm_store_chain_info): +- Add linked-list forward and backlinks. Insert on +- construction, remove on destruction. +- (class pass_store_merging): Add m_stores_head field. +- (pass_store_merging::terminate_and_process_all_chains): +- Iterate over m_stores_head list. +- (pass_store_merging::terminate_all_aliasing_chains): +- Likewise. +- (pass_store_merging::execute): Check for debug stmts first. +- Push new chains onto the m_stores_head stack. +- +-2017-03-16 Michael Meissner +- +- PR target/71294 +- * config/rs6000/vsx.md (vsx_splat_, VSX_D iterator): Allow a +- SPLAT operation on ISA 2.07 64-bit systems that have direct move, +- but no MTVSRDD support, by doing MTVSRD and XXPERMDI. +- +-2017-03-16 Jeff Law +- +- PR tree-optimization/71437 +- * tree-ssa-dom.c (dom_opt_dom_walker): Remove thread_across_edge +- member function. Implementation moved into after_dom_children +- member function and into the threader's thread_outgoing_edges +- function. +- (dom_opt_dom_walker::after_dom_children): Simplify by moving +- some code into new thread_outgoing_edges. +- * tree-ssa-threadedge.c (thread_across_edge): Make static and simplify +- definition. Simplify marker handling (do it here). Assume we always +- have the available expression and the const/copies tables. +- (thread_outgoing_edges): New function extracted from tree-ssa-dom.c +- and tree-vrp.c +- * tree-ssa-threadedge.h (thread_outgoing_edges): Declare. +- * tree-vrp.c (equiv_stack): No longer file scoped. +- (vrp_dom_walker): New class. +- (vrp_dom_walker::before_dom_children): New member function. +- (vrp_dom_walker::after_dom_children): Likewise. +- (identify_jump_threads): Setup domwalker. Use it rather than +- walking edges in a random order by hand. Simplify setup/finalization. +- (finalize_jump_threads): Remove. +- (vrp_finalize): Do not call identify_jump_threads here. +- (execute_vrp): Do it here instead and call thread_through_all_blocks +- here too. +- +- PR tree-optimization/71437 +- * tree-ssa-dom.c (pfn_simplify): Add basic_block argument. All +- callers changed. +- (simplify_stmt_for_jump_threading): Add basic_block argument. All +- callers changed. +- (lhs_of_dominating_assert): Moved from here into tree-vrp.c. +- (dom_opt_dom_walker::thread_across_edge): Remove +- handle_dominating_asserts argument. All callers changed. +- (record_temporary_equivalences_from_stmts_at_dest): Corresponding +- changes. Remove calls to lhs_of_dominating_assert. Other +- uses of handle_dominating_asserts turn into unconditional code +- (simplify_control_stmt_condition_1): Likewise. +- (simplify_control_stmt_condition): Likewise. +- (thread_through_normal_block, thread_across_edge): Likewise. +- * tree-ssa-threadedge.h (thread_across_edge): Corresponding changes. +- * tree-vrp.c (lhs_of_dominating_assert): Move here. Return original +- object if it is not an SSA_NAME. +- (simplify_stmt_for_jump_threading): Call lhs_of_dominating_assert +- before calling into the VRP specific simplifiers. +- (identify_jump_threads): Remove handle_dominating_asserts +- argument. +- +-2017-03-16 Jakub Jelinek +- +- PR fortran/79886 +- * tree-diagnostic.c (default_tree_printer): No longer static. +- * tree-diagnostic.h (default_tree_printer): New prototype. +- +-2017-03-16 Tamar Christina +- +- * config/aarch64/aarch64-simd.md (*aarch64_simd_mov) +- Change ins into fmov. +- +-2017-03-16 Kyrylo Tkachov +- +- * config/aarch64/iterators.md (h_con): Return "x" for V4HF and V8HF. +- * config/aarch64/aarch64-simd.md (*aarch64_fma4_elt_from_dup): +- Use h_con constraint for operand 1. +- (*aarch64_fnma4_elt_from_dup): Likewise. +- (*aarch64_mulx_elt_from_dup): Likewise for operand 2. +- +-2017-03-15 Jeff Law +- +- PR tree-optimization/71437 +- * tree-ssa-dom.c (derive_equivalences_from_bit_ior): New function. +- (record_temporary_equivalences): Use it. +- +- PR tree-optimization/71437 +- * tree-ssa-dom.c (struct cond_equivalence): Moved from here into +- tree-ssa-scopedtables. +- (lookup_avail_expr, build_and_record_new_cond): Likewise. +- (record_conditions, record_cond, vuse_eq): Likewise. +- (record_edge_info): Adjust to API tweak of record_conditions. +- (simplify_stmt_for_jump_threading): Similarly for lookup_avail_expr. +- (record_temporary_equivalences, optimize_stmt): Likewise. +- (eliminate_redundant_computations): Likewise. +- (record_equivalences_from_stmt): Likewise. +- * tree-ssa-scopedtables.c: Include options.h and params.h. +- (vuse_eq): New function, moved from tree-ssa-dom.c +- (build_and_record_new_cond): Likewise. +- (record_conditions): Likewise. Accept vector of conditions rather +- than edge_equivalence structure for first argument. +- for the first argument. +- (avail_exprs_stack::lookup_avail_expr): New member function, moved +- from tree-ssa-dom.c. +- (avail_exprs_stack::record_cond): Likewise. +- * tree-ssa-scopedtables.h (struct cond_equivalence): Moved here +- from tree-ssa-dom.c. +- (avail_exprs_stack): Add new member functions lookup_avail_expr +- and record_cond. +- (record_conditions): Declare. +- +-2017-03-15 Vladimir Makarov +- +- PR target/80017 +- * lra-constraints.c (process_alt_operands): Increase reject for +- reloading an input/output operand. +- +-2017-03-15 Michael Meissner +- +- PR target/79038 +- * config/rs6000/rs6000.md (float2): Define +- insns to convert from signed/unsigned char/short to IEEE 128-bit +- floating point. +- (floatuns2): Likewise. +- +-2017-03-15 Uros Bizjak +- +- PR target/80019 +- * config/i386/i386.c (ix86_vector_duplicate_value): Create +- subreg of inner mode for values already in registers. +- +-2017-03-15 Bernd Schmidt +- +- * config/c6x/c6x.c (hwloop_optimize): Handle case where the old +- iteration reg is used after the loop. +- +-2017-03-14 Martin Sebor +- +- PR tree-optimization/79800 +- * gimple-ssa-sprintf.c (format_floating: Add argument. Handle +- precision in negative-positive range. +- (format_floating): Call non-const overload with adjusted precision. +- +-2017-03-14 Michael Meissner +- +- PR target/79947 +- * config/rs6000/rs6000.h (TARGET_FRSQRTES): Add check for +- -mpowerpc-gfxopt. +- +-2017-03-14 Martin Sebor +- +- PR middle-end/80020 +- * builtin-attrs.def (ATTR_ALLOC_SIZE_2_NOTHROW_LIST): New macro. +- * builtins.def (aligned_alloc): Use it. +- +- PR c/79936 +- * Makefile.in (GTFILES): Add calls.c. +- * calls.c: Include "gt-calls.h". +- +-2017-03-14 Bernd Schmidt +- +- PR rtl-optimization/79728 +- * regs.h (struct target_regs): New field +- x_contains_allocatable_regs_of_mode. +- (contains_allocatable_regs_of_mode): New macro. +- * reginfo.c (init_reg_sets_1): Initialize it, and change +- contains_reg_of_mode so it includes global regs as well. +- * reload.c (push_reload): Use contains_allocatable_regs_of_mode +- rather than contains_regs_of_mode. +- +-2017-03-14 Martin Liska +- +- * doc/invoke.texi: Document options that can't be combined with +- -fcheck-pointer-bounds. +- +-2017-03-14 Martin Liska +- +- PR middle-end/79831 +- * doc/invoke.texi (-Wchkp): Document the option. +- +-2017-03-14 Martin Liska +- +- * Makefile.in: Install gcov-dump. +- +-2017-03-14 Martin Liska +- +- * multiple_target.c (expand_target_clones): Bail out for +- an invalid attribute. +- +-2017-03-14 Richard Biener +- +- * alias.c (struct alias_set_entry): Pack properly. +- * cfgloop.h (struct loop): Likewise. +- * cse.c (struct set): Likewise. +- * ipa-utils.c (struct searchc_env): Likewise. +- * loop-invariant.c (struct invariant): Likewise. +- * lra-remat.c (struct cand): Likewise. +- * recog.c (struct change_t): Likewise. +- * rtl.h (struct address_info): Likewise. +- * symbol-summary.h (function_summary): Likewise. +- * tree-loop-distribution.c (struct partition): Likewise. +- * tree-object-size.c (struct object_size_info): Likewise. +- * tree-ssa-loop-ivopts.c (struct cost_pair): Likewise. +- * tree-ssa-threadupdate.c (struct ssa_local_info_t): Likewise. +- * tree-vect-data-refs.c (struct _vect_peel_info): Likewise. +- * tree-vect-slp.c (struct _slp_oprnd_info): Likewise. +- * tree-vect-stmts.c (struct simd_call_arg_info): Likewise. +- * tree-vectorizer.h (struct _loop_vec_info): Likewise. +- (struct _stmt_vec_info): Likewise. +- +-2017-03-14 Martin Liska +- +- PR target/79892 +- * multiple_target.c (create_dispatcher_calls): Check that +- a target can create a function dispatcher. +- +-2017-03-14 Martin Liska +- +- PR lto/66295 +- * multiple_target.c (expand_target_clones): Drop local.local +- flag for default implementation. +- +-2017-03-14 Richard Biener +- +- PR tree-optimization/80030 +- * tree-vect-stmts.c (vectorizable_store): Plug memleak. +- +-2017-03-13 Kito Cheng +- +- * config/riscv/riscv.c (riscv_emit_float_compare>: Use +- gcc_fallthrough() instead of __attribute__((fallthrough)); +- +-2017-03-13 Gerald Pfeifer +- +- * doc/gcc.texi: Remove "up" link to (DIR). +- * doc/gccint.texi: Ditto. +- +-2017-03-13 Gerald Pfeifer +- +- * doc/install.texi (Specific) : Remove reference to +- binutils 2.13. +- +-2017-03-13 Jeff Law +- +- * config/riscv/riscv.c (riscv_emit_float_compare): Use fallthru +- attribute rather than comments. +- +- * config/pdp11/pdp11.md (movmemhi): Adjust operand numbers to +- match_scratch operand is highest. +- +-2017-03-13 Martin Liska +- +- PR middle-end/78339 +- * ipa-pure-const.c (warn_function_noreturn): If the declarations +- is a CHKP clone, use original declaration. +- +-2017-03-13 Claudiu Zissulescu +- +- * config/arc/arc.c (arc_init): Use multiplier whenever we have it. +- (arc_conditional_register_usage): Use a different allocation order +- when optimizing for size. +- * common/config/arc/arc-common.c (arc_option_optimization_table): +- Section anchors default on when optimizing for size. +- +-2017-03-13 Claudiu Zissulescu +- +- * config/arc/arc.md (*tst_bitfield_tst): Fix pattern. +- +-2017-03-13 Claudiu Zissulescu +- +- * config/arc/arc.c (arc_output_addsi): Emit code density adds. +- * config/arc/arc.md (cpu_facility): Add cd variant. +- (*movqi_insn): Add code density variant. +- (*movhi_insn): Likewise. +- (*movqi_insn): Likewise. +- (*addsi3_mixed): Likewise. +- (subsi3_insn): Likewise. +- +-2017-03-13 Claudiu Zissulescu +- +- * config/arc/arc.md (movsi_cond_exec): Update constraint. +- +-2017-03-13 Claudiu Zissulescu +- +- * config/arc/arc.c (arc_legitimize_pic_address): Handle PIC +- expressions with MINUS and UNARY ops. +- +-2017-03-13 Kyrylo Tkachov +- +- PR target/79911 +- * config/arm/neon.md (vec_sel_widen_ssum_lo3): +- Rename to... +- (vec_sel_widen_ssum_lo3): ... This. Avoid mismatch +- between vec_select and vector argument. +- (vec_sel_widen_ssum_hi3): Rename to... +- (vec_sel_widen_ssum_hi3): ... This. Likewise. +- (vec_sel_widen_usum_lo3): Rename to... +- (vec_sel_widen_usum_lo3): ... This. +- (vec_sel_widen_usum_hi3): Rename to... +- (vec_sel_widen_usum_hi3): ... This. +- +-2017-03-13 Richard Biener +- +- PR other/79991 +- * params.def (vect-max-peeling-for-alignment): Fix typo. +- +-2017-03-12 Gerald Pfeifer +- +- * doc/install.texi (Specific) : Remove description of +- issue that only occurred with binutils below 2.18. +- +-2017-03-12 Gerald Pfeifer +- +- * doc/install.texi (Specific) : No longer +- refer to binutils 2.11/2.12 minimum. +- +-2017-03-12 Gerald Pfeifer +- +- * doc/install.texi (Specific) : Remove link to +- ftp.kernel.org and simplify binutils requirement. +- +-2017-03-11 Gerald Pfeifer +- +- * doc/invoke.texi (Warning Options): Fix spelling of link-time +- optimization. +- (Optimize Options): Ditto. Also remove redundancy. +- +-2017-03-10 David Malcolm +- +- PR translation/79848 +- * ipa-devirt.c (warn_types_mismatch): Simplify uses of "%<%s%>" to +- "%qs". +- * ipa-pure-const.c (suggest_attribute): Likewise. Convert _ +- to G_ to avoid double translation. +- +-2017-03-10 David Malcolm +- +- PR translation/79923 +- * auto-profile.c (get_combined_location): Convert leading +- character of diagnostics to lower case and remove trailing period. +- (read_profile): Likewise for various diagnostics. +- * config/arm/arm.c (arm_option_override): Remove trailing period +- from various diagnostics. +- * config/msp430/msp430.c (msp430_expand_delay_cycles): Likewise. +- (msp430_expand_delay_cycles): Likewise. +- +-2017-03-10 David Malcolm +- +- PR target/79925 +- * config/aarch64/aarch64.c (aarch64_validate_mcpu): Quote the +- full command-line argument, rather than just "str". +- (aarch64_validate_march): Likewise. +- (aarch64_validate_mtune): Likewise. +- +-2017-03-10 Bernd Schmidt +- +- PR rtl-optimization/78911 +- * lra-assigns.c (must_not_spill_p): New function. +- (spill_for): Use it. +- +-2017-03-10 Jakub Jelinek +- +- PR tree-optimization/79981 +- * tree-vrp.c (extract_range_basic): Handle IMAGPART_EXPR of +- ATOMIC_COMPARE_EXCHANGE ifn result. +- (stmt_interesting_for_vrp, vrp_visit_stmt): Handle +- IFN_ATOMIC_COMPARE_EXCHANGE. +- +-2017-03-10 David Malcolm +- +- PR driver/79875 +- * opts.c (parse_sanitizer_options): Add missing question mark to +- "did you mean" message. +- +-2017-03-10 Bill Schmidt +- +- * config/rs6000/rs6000-builtin.def (VMULEUB_UNS): Remove orphaned +- built-in. +- (VMULEUH_UNS): Likewise. +- (VMULOUB_UNS): Likewise. +- (VMULOUH_UNS): Likewise. +- * config/rs6000/rs6000.c (builtin_function_type): Remove +- references to ALTIVEC_BUILTIN_VMUL[EO]U[BH]_UNS. +- +-2017-03-10 David Malcolm +- +- PR bootstrap/79952 +- * read-rtl-function.c (function_reader::read_rtx_operand): Update +- x with result of extra_parsing_for_operand_code_0. +- (function_reader::extra_parsing_for_operand_code_0): Convert +- return type from void to rtx, returning x. When reading +- SYMBOL_REF with SYMBOL_FLAG_HAS_BLOCK_INFO, reallocate x to the +- larger size containing struct block_symbol. +- +-2017-03-10 Segher Boessenkool +- +- * config/rs6000/rs6000.c (rs6000_option_override_internal): Disallow +- -mfloat128-hardware without -m64. +- +-2017-03-10 Will Schmidt +- +- PR target/79941 +- * config/rs6000/rs6000.c (builtin_function_type): Add VMUL*U[HB] +- entries to the case statement that marks unsigned arguments to +- overloaded functions. +- +-2017-03-10 Kelvin Nilsen +- +- * config/rs6000/rs6000.c (rs6000_option_override_internal): Fix +- two typographic errors in the handling of TARGET_UPPER_REGS_DI. +- +-2017-03-10 Pat Haugen +- +- PR target/79907 +- * config/rs6000/rs6000.c (rs6000_init_hard_regno_mode_ok): Test +- TARGET_UPPER_REGS_DI when setting 'wi' constraint regclass. +- +-2017-03-10 Martin Liska +- +- PR target/65705 +- PR target/69804 +- * toplev.c (process_options): Enable MPX with LSAN and UBSAN. +- * tree-chkp.c (chkp_walk_pointer_assignments): Verify that +- FIELD !=3D NULL. +- +-2017-03-10 Olivier Hainque +- +- * tree-switch-conversion (array_value_type): Start by resetting +- candidate type to it's main variant. +- +-2017-03-10 Jakub Jelinek +- +- PR rtl-optimization/79909 +- * combine.c (try_combine): Use simplify_replace_rtx on individual +- CALL_INSN_FUNCTION_USAGE elements instead of replace_rtx on copy_rtx +- of the whole CALL_INSN_FUNCTION_USAGE. +- +- PR tree-optimization/79972 +- * gimple-ssa-warn-alloca.c (alloca_call_type): Only call +- get_range_info on SSA_NAMEs. Formatting fixes. +- +-2017-03-10 Richard Biener +- Jakub Jelinek +- +- PR tree-optimization/77975 +- * tree-ssa-loop-niter.c (get_base_for): Allow phi argument from latch +- edge to be constant. +- (get_val_for): For constant x return it. Formatting fix. +- (loop_niter_by_eval): Avoid pointless looping if the next iteration +- would use the same bases as the current one. +- +-2017-03-09 Bill Schmidt +- +- * config/rs6000/rs6000.c (rs6000_gen_le_vsx_permute): Use rotate +- instead of vec_select for V1TImode. +- * conifg/rs6000/vsx.md (VSX_LE): Remove mode iterator that is no +- longer needed. +- (VSX_LE_128): Add V1TI to this mode iterator. +- (*vsx_le_perm_load_): Change to use VSX_D mode iterator. +- (*vsx_le_perm_store_): Likewise. +- (pre-reload splitter for VSX stores): Likewise. +- (post-reload splitter for VSX stores): Likewise. +- (*vsx_xxpermdi2_le_): Likewise. +- (*vsx_lxvd2x2_le_): Likewise. +- (*vsx_stxvd2x2_le_): Likewise. +- +-2017-03-09 Michael Eager +- +- Correct failures with --enable-checking=3Dyes,rtl. +- +- * config/microblaze/microblaze.c (microblaze_expand_shift): +- Replace GET_CODE test with CONST_INT_P and INTVAL test with +- test for const0_rtx. +- * config/microblaze/microblaze.md (ashlsi3_byone, ashrsi3_byone, +- lshrsi3_byone): Replace INTVAL with test for const1_rtx. +- +-2017-03-09 Richard Biener +- +- PR tree-optimization/79977 +- * graphite-scop-detection.c (scop_detection::merge_sese): +- Handle the case of extra exits to blocks dominating the entry. +- +-2017-03-09 Toma Tabacu +- +- * doc/sourcebuild.texi (Effective-Target Keywords, Other attributes): +- Document rdynamic. +- +-2017-03-09 Vladimir Makarov +- +- PR rtl-optimization/79949 +- * lra-constraints.c (process_alt_operands): Check memory when +- trying to predict a cycle. Print about the overall increase. +- +-2017-03-09 Richard Biener +- +- PR middle-end/79971 +- * gimple-expr.c (useless_type_conversion_p): Preserve +- TYPE_SATURATING for fixed-point types. +- +-2017-03-09 Richard Biener +- +- PR ipa/79970 +- * ipa-prop.c (ipa_modify_formal_parameters): Avoid changing +- alignment of BLKmode params. +- +-2017-03-09 Kyrylo Tkachov +- +- PR target/79913 +- * config/aarch64/iterators.md (VALL_F16_NO_V2Q): New mode iterator. +- (VALL_NO_V2Q): Likewise. +- (VDQF_DF): Delete. +- * config/aarch64/aarch64-simd.md +- (aarch64_dup_lane_): Use VALL_F16_NO_V2Q +- iterator. +- (*aarch64_simd_vec_copy_lane_): Use +- VALL_NO_V2Q mode iterator. +- (*aarch64_vgetfmulx): Use VDQF iterator. +- +-2017-03-09 Martin Liska +- +- PR tree-optimization/79631 +- * tree-chkp-opt.c (chkp_is_constant_addr): Call +- tree_int_cst_sign_bit just for INTEGER constants. +- +-2017-03-09 Martin Liska +- +- PR target/65705 +- PR target/69804 +- * toplev.c (process_options): Disable -fcheck-pointer-bounds with +- sanitizers. +- +-2017-03-09 Marek Polacek +- +- PR c++/79672 +- * tree.c (inchash::add_expr): Handle TREE_VEC. +- +-2017-03-09 Martin Liska +- +- PR ipa/79764 +- (chkp_narrow_size_and_offset): New function. +- (chkp_parse_array_and_component_ref): Support BIT_FIELD_REF. +- (void chkp_parse_bit_field_ref): New function. +- (chkp_make_addressed_object_bounds): Add case for BIT_FIELD_REF. +- (chkp_process_stmt): Use chkp_parse_bit_field_ref. +- +-2017-03-09 Martin Liska +- +- PR ipa/79761 +- * tree-chkp.c (chkp_get_bound_for_parm): Get bounds for a param. +- (chkp_find_bounds_1): Remove gcc_unreachable. +- +-2017-03-09 Jakub Jelinek +- +- PR sanitizer/79944 +- * asan.c (get_mem_refs_of_builtin_call): For BUILT_IN_ATOMIC* and +- BUILT_IN_SYNC*, determine the access type from the size suffix and +- always build a MEM_REF with that type. Handle forgotten +- BUILT_IN_SYNC_FETCH_AND_NAND_16 and BUILT_IN_SYNC_NAND_AND_FETCH_16. +- +- PR target/79932 +- * config/i386/avx512vlintrin.h (_mm256_cmpge_epi32_mask, +- _mm256_cmpge_epi64_mask, _mm256_cmpge_epu32_mask, +- _mm256_cmpge_epu64_mask, _mm256_cmple_epi32_mask, +- _mm256_cmple_epi64_mask, _mm256_cmple_epu32_mask, +- _mm256_cmple_epu64_mask, _mm256_cmplt_epi32_mask, +- _mm256_cmplt_epi64_mask, _mm256_cmplt_epu32_mask, +- _mm256_cmplt_epu64_mask, _mm256_cmpneq_epi32_mask, +- _mm256_cmpneq_epi64_mask, _mm256_cmpneq_epu32_mask, +- _mm256_cmpneq_epu64_mask, _mm256_mask_cmpge_epi32_mask, +- _mm256_mask_cmpge_epi64_mask, _mm256_mask_cmpge_epu32_mask, +- _mm256_mask_cmpge_epu64_mask, _mm256_mask_cmple_epi32_mask, +- _mm256_mask_cmple_epi64_mask, _mm256_mask_cmple_epu32_mask, +- _mm256_mask_cmple_epu64_mask, _mm256_mask_cmplt_epi32_mask, +- _mm256_mask_cmplt_epi64_mask, _mm256_mask_cmplt_epu32_mask, +- _mm256_mask_cmplt_epu64_mask, _mm256_mask_cmpneq_epi32_mask, +- _mm256_mask_cmpneq_epi64_mask, _mm256_mask_cmpneq_epu32_mask, +- _mm256_mask_cmpneq_epu64_mask, _mm_cmpge_epi32_mask, +- _mm_cmpge_epi64_mask, _mm_cmpge_epu32_mask, _mm_cmpge_epu64_mask, +- _mm_cmple_epi32_mask, _mm_cmple_epi64_mask, _mm_cmple_epu32_mask, +- _mm_cmple_epu64_mask, _mm_cmplt_epi32_mask, _mm_cmplt_epi64_mask, +- _mm_cmplt_epu32_mask, _mm_cmplt_epu64_mask, _mm_cmpneq_epi32_mask, +- _mm_cmpneq_epi64_mask, _mm_cmpneq_epu32_mask, _mm_cmpneq_epu64_mask, +- _mm_mask_cmpge_epi32_mask, _mm_mask_cmpge_epi64_mask, +- _mm_mask_cmpge_epu32_mask, _mm_mask_cmpge_epu64_mask, +- _mm_mask_cmple_epi32_mask, _mm_mask_cmple_epi64_mask, +- _mm_mask_cmple_epu32_mask, _mm_mask_cmple_epu64_mask, +- _mm_mask_cmplt_epi32_mask, _mm_mask_cmplt_epi64_mask, +- _mm_mask_cmplt_epu32_mask, _mm_mask_cmplt_epu64_mask, +- _mm_mask_cmpneq_epi32_mask, _mm_mask_cmpneq_epi64_mask, +- _mm_mask_cmpneq_epu32_mask, _mm_mask_cmpneq_epu64_mask): Move +- definitions outside of __OPTIMIZE__ guarded section. +- +- PR target/79932 +- * config/i386/avx512bwintrin.h (_mm512_packs_epi32, +- _mm512_maskz_packs_epi32, _mm512_mask_packs_epi32, +- _mm512_packus_epi32, _mm512_maskz_packus_epi32, +- _mm512_mask_packus_epi32): Move definitions outside of __OPTIMIZE__ +- guarded section. +- +-2017-03-09 Andreas Krebbel +- +- * config/s390/vx-builtins.md ("vfee", "vfeez") +- ("vfenez"): Add missing constraints. +- +-2017-03-08 Martin Sebor +- +- PR target/79928 +- * config/nds32/nds32.c (nds32_option_override): +- Fix misspelled diagnostic. +- +-2017-03-08 Jakub Jelinek +- +- PR c/79940 +- * gimplify.c (gimplify_omp_for): Replace index var in outer +- taskloop statement with an artificial variable and add +- OMP_CLAUSE_PRIVATE clause for it. +- +-2017-03-08 Richard Biener +- +- PR tree-optimization/79955 +- * tree-ssa-uninit.c (warn_uninitialized_vars): Do not warn +- for accesses that are completely outside of the variable. +- +-2017-03-08 Andrew Haley +- +- PR tree-optimization/79943 +- * tree-ssa-loop-split.c (compute_new_first_bound): When +- calculating the new upper bound, (END-BEG) should be added, not +- subtracted. +- +-2017-03-08 Jakub Jelinek +- +- * config/avr/avr.md (setmemhi): Make sure match_dup +- operand number comes before match_scratch. +- +-2017-03-08 Richard Biener +- +- PR tree-optimization/79920 +- * tree-vect-slp.c (vect_create_mask_and_perm): Remove and inline +- with ncopies =3D=3D 1 to ... +- (vect_transform_slp_perm_load): ... here. Properly compute +- all element loads by iterating VF times over the group. Do +- not handle ncopies (computed in a broken way) in +- vect_create_mask_and_perm. +- +-2017-03-08 Jakub Jelinek +- +- PR sanitizer/79904 +- * internal-fn.c (expand_vector_ubsan_overflow): If arg0 or arg1 +- is a uniform vector, use uniform_vector_p return value instead of +- building ARRAY_REF on folded VIEW_CONVERT_EXPR to array type. +- +-2017-03-07 Marek Polacek +- +- PR middle-end/79809 +- * gimple-ssa-warn-alloca.c (pass_walloca::gate): Use HOST_WIDE_INT. +- (alloca_call_type): Likewise. +- +-2017-03-07 Martin Liska +- +- * gcov.c (process_args): Put comment to correct location. +- +-2017-03-07 Martin Liska +- +- PR middle-end/68270 +- * tree-chkp.c (chkp_may_narrow_to_field): Add new argument ref. +- Use array_at_struct_end_p instead of DECL_CHAIN (field). +- (chkp_narrow_bounds_for_field): Likewise. +- (chkp_parse_array_and_component_ref): Pass one more argument to +- call. +- +-2017-03-07 Richard Biener +- +- * tree-vect-loop-manip.c (slpeel_add_loop_guard): Preserve +- preheaders. +- +-2017-03-07 Segher Boessenkool +- +- * config/i386/i386.c (ix86_local_alignment): Align most aggregates +- of 16 bytes and more to 16 bytes, not those of 16 bits and more. +- +-2017-03-07 Kyrylo Tkachov +- +- PR c/79855 +- * params.def (PARAM_STORE_MERGING_ALLOW_UNALIGNED): Add full stop +- to end of description. +- (PARAM_MAX_STORES_TO_MERGE): Likewise. +- +-2017-03-07 Jakub Jelinek +- +- PR rtl-optimization/79901 +- * config/i386/sse.md (*avx512bw_3): Renamed to +- ... +- (*avx512f_3): ... this. +- (3 with maxmin code iterator): Use VI8_AVX2_AVX512F +- iterator instead of VI8_AVX2_AVX512BW. +- +- PR rtl-optimization/79901 +- * expr.c (expand_expr_real_2): For vector MIN/MAX, if there is no +- min/max expander, expand it using expand_vec_cond_expr. +- +- PR sanitizer/79897 +- * ubsan.c (ubsan_encode_value): Call mark_addressable on the +- temporary. +- +-2017-03-06 Jakub Jelinek +- +- PR c++/79821 +- * dwarf2out.h (dw_vec_const): Change array type from unsigned char * +- to void * for PCH reasons. +- * dwarf2out.c (output_loc_operands, output_die): Cast +- v.val_vec.array to unsigned char *. +- +-2017-03-06 John David Anglin +- +- PR target/77850 +- * config/pa/pa-64.h (PAD_VARARGS_DOWN): Don't pad down complex and +- vector types. +- +-2017-03-06 Vladimir Makarov +- +- PR rtl-optimization/79571 +- * lra-constraints.c (process_alt_operands): Calculate static +- reject and subtract it from overall when only addresses will be +- reloaded. +- +-2017-03-06 Julia Koval +- +- PR target/79793 +- * config/i386/i386.c (ix86_minimum_incoming_stack_boundary): Set +- incoming stack boundary to 128 for 64-bit targets. +- +-2017-03-06 Richard Biener +- +- PR tree-optimization/79894 +- * tree-vectorizer.c (vectorize_loops): Set loop_vectorized_call +- to NULL after folding it. +- +-2017-03-06 Richard Biener +- +- PR tree-optimization/79824 +- * tree-vect-stmts.c (get_group_load_store_type): Fix alignment +- check disabling peeling for gaps. +- +-2017-03-06 Toma Tabacu +- +- * doc/sourcebuild.texi (Effective-Target Keywords, Environment +- attributes): Document gettimeofday. +- +-2017-03-06 Robin Dapp +- +- * config/s390/s390.c (s390_option_override_internal): Set +- PARAM_MIN_VECT_LOOP_BOUND +- +-2017-03-06 Robin Dapp +- +- * config/s390/s390.c (s390_asm_output_function_label): Use nopr %r0. +- * config/s390/s390.md: Likewise. +- +-2017-03-06 Jakub Jelinek +- +- PR target/79812 +- * config/i386/sse.md (VI8F_256_512): Remove mode iterator. +- (_perm): Rename to ... +- (avx2_perm): ... this. Use VI8F_256 iterator instead +- of VI8F_256_512. +- (_perm_mask): Rename to ... +- (avx512vl_perm_mask): ... this. Use VI8F_256 iterator instead +- of VI8F_256_512. +- (_perm_1): Rename to ... +- (avx2_perm_1): New define_expand. +- (avx512f_perm_mask): Likewise. +- (avx512f_perm_1): New define_insn. +- (_vec_dup_1): Fix up vec_select mode. +- +-2017-03-06 Prachi Godbole +- +- * config/mips/mips-msa.md (msa_fmax_a_, msa_fmin_a_, +- msa_max_a_, msa_min_a_): Introduce mode interator for +- if_then_else. +- (smin3, smax3): Change operand print code from 'B' to 'E'. +- +-2017-03-06 Martin Liska +- +- PR sanitize/79783 +- * asan.c (asan_expand_poison_ifn): Do not expand ASAN_POISON +- when having a SSA NAME w/o VAR_DECL assigned to it. +- +-2017-03-06 Prachi Godbole +- +- * config/mips/mips-msa.md (msa_dotp__d, msa_dpadd__d, +- msa_dpsub__d): Fix MODE for vec_select. +- +-2017-03-06 Prachi Godbole +- +- * config/mips/mips.c (mips_gen_const_int_vector): Change type of last +- argument. +- * config/mips/mips-protos.h (mips_gen_const_int_vector): Likewise. +- +-2017-03-06 Richard Biener +- +- * lto-streamer.c (lto_check_version): Use %qs in diagnostics. +- * plugin.c (register_plugin_info): Likewise. +- * tree-chkp.c (chkp_make_static_const_bounds): Likewise. +- +-2017-03-05 Jakub Jelinek +- +- * config/i386/sse.md (sse_storehps, sse_storelps, +- avx__, +- avx512f__, +- avx512f__256): Require +- in condition that at least one operand is not a MEM. +- +-2017-03-03 Jakub Jelinek +- +- PR middle-end/79805 +- * internal-fn.def (ATOMIC_BIT_TEST_AND_SET, ATOMIC_BIT_TEST_AND_RESET, +- ATOMIC_BIT_TEST_AND_COMPLEMENT, ATOMIC_COMPARE_EXCHANGE): Remove +- ECF_NOTHROW. +- * gimple-fold.c (fold_builtin_atomic_compare_exchange): Set +- gimple_call_nothrow_p flag based on whether original builtin can throw. +- If it can, emit following stmts on the fallthrough edge. +- * tree-ssa-ccp.c (optimize_atomic_bit_test_and): Similarly, except +- don't create new bb if inserting just debug stmts on the edge, try to +- insert them on the fallthru bb or just reset debug stmts. +- +-2017-03-03 Segher Boesssenkool +- +- PR target/43763 +- * config/rs6000/rs6000.c (rs6000_final_prescan_insn): Save and +- restore recog_data (including the operand rtxes inside it) around +- the call to get_insn_template. +- +-2017-03-03 Martin Sebor +- +- PR tree-optimization/79699 +- * context.c (context::~context): Free MPFR caches to avoid +- a memory leak on program exit. +- +-2017-03-03 Kyrylo Tkachov +- +- * config/aarch64/aarch64.c (aarch64_float_const_representable_p): +- Use wide_int::ulow () instead of .elt (0). +- +-2017-03-03 Uros Bizjak +- +- * config/i386/i386.md (*pushtf): Change *roF constraint to *roC. +- (*pushxf): Limit oF constraint to 32bit targets and add oC +- constraint for 64bit targets. +- (pushxf splitter): Use PUSH_ROUNDING to calculate stack adjustment. +- (*pushdf): Change rmF constraint to rmC. +- +-2017-03-03 Martin Liska +- +- * tree-ssa-loop-prefetch.c (pass_loop_prefetch::execute): +- Remove unused variable. +- +-2017-03-03 Jakub Jelinek +- +- PR target/79807 +- * config/i386/i386.c (ix86_expand_multi_arg_builtin): If target +- is a memory operand, increase num_memory. +- (ix86_expand_args_builtin): Likewise. +- +-2017-03-03 Jan Hubicka +- +- PR lto/79760 +- * ipa-devirt.c (maybe_record_node): Properly handle +- __cxa_pure_virtual visibility. +- +-2017-03-03 Martin Liska +- +- PR tree-optimization/79803 +- * tree-ssa-loop-prefetch.c (tree_ssa_prefetch_arrays): Remove +- assert. +- (pass_loop_prefetch::execute): Disabled optimization if an +- assumption about L1 cache size is not met. +- +-2017-03-03 Martin Liska +- +- PR rtl-optimization/79574 +- * gcse.c (struct gcse_expr): Use HOST_WIDE_INT instead of int. +- (hash_scan_set): Likewise. +- (dump_hash_table): Likewise. +- (hoist_code): Likewise. +- +-2017-03-03 Richard Biener +- +- * fixed-value.c (fixed_from_string): Restore use of elt (1) +- in place of uhigh (). +- (fixed_convert_from_real): Likewise. +- +-2017-03-03 Uros Bizjak +- +- PR target/79514 +- * config/i386/i386.md (*pushxf_rounded): Use Pmode instead of DImode. +- +-2017-03-03 Richard Biener +- +- PR middle-end/79818 +- * match.pd ( X +- C1 CMP C2 -> X CMP C2 -+ C1): Add missing +- TYPE_OVERFLOW_UNDEFINED check. +- +-2017-03-02 Bill Schmidt +- +- * config/rs6000/vector.md (vector_ne__p): Correct operand +- numbers. +- (vector_ae__p): Likewise. +- (vector_nez__p): Likewise. +- (vector_ne_v2di_p): Likewise. +- (vector_ae_v2di_p): Likewise. +- (vector_ne__p): Likewise. +- * config/rs6000/vsx.md (vsx_tsqrt2_fg): Correct operand +- numbers. +- (vsx_tsqrt2_fe): Likewise. +- +-2017-03-02 Uros Bizjak +- +- PR target/79514 +- * config/i386/i386.md (*pushxf_rounded): New insn_and_split pattern. +- +-2017-03-02 Jakub Jelinek +- +- PR rtl-optimization/79780 +- * cprop.c (one_cprop_pass): When second and further conditional trap +- in a single basic block is turned into an unconditional trap, turn it +- into a deleted note to avoid RTL verification failures. +- +-2017-03-02 Richard Biener +- +- * fold-const.c (const_binop): Use ulow () instead of elt (0). +- +-2017-03-02 Richard Biener +- +- PR tree-optimization/79345 +- PR c++/42000 +- * tree-ssa-alias.c (walk_aliased_vdefs_1): Take a limit +- param and abort the walk, returning -1 if it is hit. +- (walk_aliased_vdefs): Take a limit param and pass it on. +- * tree-ssa-alias.h (walk_aliased_vdefs): Add a limit param, +- defaulting to 0 and return a signed int. +- * tree-ssa-uninit.c (struct check_defs_data): New struct. +- (check_defs): New helper. +- (warn_uninitialized_vars): Use walk_aliased_vdefs to warn +- about uninitialized memory. +- * fixed-value.c (fixed_from_string): Use ulow/uhigh to avoid +- bogus uninitialized warning. +- (fixed_convert_from_real): Likewise. +- +-2017-03-02 Bin Cheng +- +- PR tree-optimization/66768 +- * tree-ssa-loop-ivopts.c (find_interesting_uses_address): Skip addr +- iv_use if base object can't be determined. +- +-2017-03-02 Jakub Jelinek +- +- PR tree-optimization/79345 +- * gensupport.h (struct pattern_stats): Add min_scratch_opno field. +- * gensupport.c (get_pattern_stats_1) : Update it. +- (get_pattern_stats): Initialize it. +- * genemit.c (gen_expand): Verify match_scratch numbers come after +- match_operand/match_dup numbers. +- * config/i386/i386.md (mul3_highpart): Swap match_dup and +- match_scratch numbers. +- * config/i386/sse.md (avx2_gathersi, avx2_gatherdi): +- Likewise. +- * config/s390/s390.md (trunctdsd2): Likewise. +- +-2017-03-02 Richard Biener +- +- * wide-int.h (wide_int_storage::operator=3D): Implement in terms +- of wi::copy. +- +-2017-03-02 Richard Biener +- +- PR tree-optimization/79777 +- * tree-ssa-pre.c (eliminate_insert): Give up if we simplify +- the to insert expression to sth existing. +- +-2017-03-01 Martin Sebor +- +- PR middle-end/79692 +- * gimple-ssa-sprintf.c +- (directive::known_width_and_precision): New function. +- (format_integer): Use it. +- (get_mpfr_format_length): Consider the full range of precision +- when computing %g output with the # flag. Set the likely byte +- count to 3 rather than 1 when precision is indeterminate. +- (format_floating): Correct the lower bound of precision. +- +-2017-03-01 Bill Schmidt +- +- * doc/invoke.texi: Document default code model for 64-bit Linux. +- +-2017-03-01 Aaron Sawdey +- +- PR target/79752 +- * config/rs6000/rs6000.md (peephole2 for udiv/umod): Should emit +- udiv rather than div since input pattern is unsigned. +- +-2017-03-01 Uros Bizjak +- +- * config/i386/i386.c (print_reg): Warn for values of +- unsupported size in integer register. +- +-2017-03-01 Michael Meissner +- +- PR target/79439 +- * config/rs6000/predicates.md (current_file_function_operand): Do +- not allow self calls to be local if the function is replaceable. +- +-2017-03-01 Kelvin Nilsen +- +- PR target/79395 +- * config/rs6000/altivec.h (vec_ctz and others): Change the +- preprocessor macro that controls conditional compilation from +- _ARCH_PWR9 to __POWER9_VECTOR__. +- (vec_all_ne): Change parameterization of __altivec_scalar_pred +- macro expansion under preprocessor #ifdef __POWER9_VECTOR__ +- control (instead of _ARCH_PWR9 control) so that template +- definition uses power9-specific function. +- (vec_any_eq): Likewise. +- (vec_all_ne): Change macro definition to use a power9-specific +- expansion under #ifdef __POWER9_VECTOR__ control (instead of +- _ARCH_PWR9 control). +- (vec_any_eq) Likewise. +- * config/rs6000/rs6000-builtin.def (CMPNEF): Remove BU_P9V_AV_2 +- expansion for CMPNEF to remove support for xvcmpnesp instruction. +- (CMPNED): Remove BU_P9V_AV2 expansion for CMPNED to remove +- support for xvcmpnedp instruction. +- (VCMPNEB_P): Replace BU_P9V_AV_P macro expansion with BU_P9V_AV_2 +- macro expansion so that Power9 implementation of vec_all_ne does +- not use the AltiVec predicate framework. +- (VCMPNEH_P): Likewise. +- (VCMPNEW_P): Likewise. +- (VCMPNED_P): Likewise. +- (VCMPNEFP_P): Likewise. +- (VCMPNEDP_P): Likewise. +- (VCMPAEB_P): Add BU_P9V_AV_2 macro expansion to change +- implementation of vec_any_eq to not use AltiVec predicate +- framework. +- (VCMPAEH_P): Likewise. +- (VCMPAEW_P): Likewise. +- (VCMPAED_P): Likewise. +- (VCMPAEFP_P): Likewise. +- (VCMPAEDP_P): Likewise. +- (VCMPNE_P): Replace BU_P9V_OVERLOAD_P macro expansion with +- BU_P9V_OVERLOAD_2 so that Power9 implementation of vec_all_ne does +- not use the AltiVec predicate framework. +- (VCMPAE_P): Add BU_P9V_OVERLOAD_2 macro to change implementation +- of vec_any_eq to not use AltiVec predicate framework. +- * config/rs6000/rs6000-c.c (rs6000_target_modify_macros): Add +- support for predefined __POWER9_VECTOR__ macro to indicate that +- Power9 instruction selection is enabled. +- (altivec_overloaded_builtins): Remove extraneous +- ALTIVEC_BUILTIN_VEC_CMPNE entry for overloaded +- function argument types RS6000_BTI_bool_V16QI and +- RS6000_BTI_bool_V16QI. Remove erroneous ALTIVEC_BUILTIN_VEC_CMPNE +- entry for overloaded function argument types RS6000_BTI_bool_V4SI +- andRS6000_BTI_bool_V4SI, mapping to P9V_BUILTIN_CMPNEB. Remove +- two entries mapping to P9V_BUITIN_CMPNED and one entry mapping to +- P9V_BUILTIN_CMPNEF to force use of instructions not specific to +- Power9 for implementations of vec_cmpne. Change the signature for +- all definitions of the overloaded P9V_BUILTIN_VEC_CMPNE_P function +- (representing vec_all_ne) to remove the previously described first +- argument of type RS6000_BTI_INTSI, as this was an artifact of +- reliance on the AltiVec predicate framework, which is no longer +- used in the implementation of these functions. Add +- P9V_BUILTIN_VEC_VCMPAE_P entries (representing the vec_anyeq +- function) to match all of the P9V_BUILTIN_VEC_VCMNE_P entries +- since, unlike the AltiVec predicate framework implementation, we +- do not share function descriptors between vec_alle and vec_anyeq. +- (altivec_resolve_overloaded_builtin): Add SFmode and DFmode to the +- set of modes that receive special treatment even when +- TARGET_P9_VECTOR is true. The special treatment emits code that +- does not depend on Power9 instructions. +- * config/rs6000/vector.md (vector_ne__p): Change this +- define_expand to not rely on AltiVec predicate framework. +- (vector_ae_p): New define_expand to represent vec_any_eq +- function. +- (vector_ne_v2di_p): Change this define_expand to not rely on +- AltiVec predicate framework. +- (vector_ae_v2di_p): New define_expand to represent vec_any_eq +- function. +- (vector_ne__p): Change this define_expand to not rely on +- AltiVec predicate framework. +- (vector_ae_p): New define_expand to represent vec_any_eq +- function. +- * config/rs6000/vsx.md (*vsx_ne__p): For modes VSX_EXTRACT_I +- (V16QI, V8HI, V4SI), correct a typo in the code emitted for this +- define_insn pattern. +- (*vsx_ne__p): For modes VSX_F (V4SF and V2DF), remove this +- define_insn pattern because the xvcmpne. instruction is not +- supported. +- (vcmpne): Remove this define_insn because xvcmpne +- instruction is not supported. +- +-2017-03-01 Jakub Jelinek +- +- * config/nvptx/nvptx.c: Include intl.h. +- +-2017-03-01 Martin Jambor +- +- PR lto/78140 +- * ipa-prop.h (ipa_bits): Removed field known. +- (ipa_jump_func): Removed field vr_known. Changed fields bits and m_vr +- to pointers. Adjusted their comments to warn about their sharing. +- (ipcp_transformation_summary): Change bits to a vector of pointers. +- (ipa_check_create_edge_args): Moved to ipa-prop.c, declare. +- (ipa_get_ipa_bits_for_value): Declare. +- * tree-vrp.h (value_range): Mark as GTY((for_user)). +- * ipa-prop.c (ipa_bit_ggc_hash_traits): New. +- (ipa_bits_hash_table): Likewise. +- (ipa_vr_ggc_hash_traits): Likewise. +- (ipa_vr_hash_table): Likewise. +- (ipa_print_node_jump_functions_for_edge): Adjust for bits and m_vr +- being pointers and vr_known being removed. +- (ipa_set_jf_unknown): Likewise. +- (ipa_get_ipa_bits_for_value): New function. +- (ipa_set_jfunc_bits): Likewise. +- (ipa_get_value_range): New overloaded functions. +- (ipa_set_jfunc_vr): Likewise. +- (ipa_compute_jump_functions_for_edge): Use the above functions to +- construct bits and vr parts of jump functions. +- (ipa_check_create_edge_args): Move here from ipa-prop.h, also allocate +- ipa_bits_hash_table and ipa_vr_hash_table if they do not already +- exist. +- (ipcp_grow_transformations_if_necessary): Also allocate +- ipa_bits_hash_table and ipa_vr_hash_table if they do not already +- exist. +- (ipa_node_params_t::duplicate): Do not copy bits, just pointers to +- them. Fix too long lines. +- (ipa_write_jump_function): Adjust for bits and m_vr being pointers and +- vr_known being removed. +- (ipa_read_jump_function): Use new setter functions to construct bits +- and vr parts of jump functions or set them to NULL. +- (write_ipcp_transformation_info): Adjust for bits being pointers. +- (read_ipcp_transformation_info): Likewise. +- (ipcp_update_bits): Likewise. Fix excessively long lines a trailing +- space. +- Include gt-ipa-prop.h. +- * ipa-cp.c (propagate_bits_across_jump_function): Adjust for bits +- being pointers. +- (ipcp_store_bits_results): Likewise. +- (propagate_vr_across_jump_function): Adjust for m_vr being a pointer. +- Do not write to existing jump functions but use a temporary instead. +- +-2017-03-01 Jakub Jelinek +- +- PR c++/79681 +- * fold-const.c (make_bit_field_ref): If orig_inner is COMPONENT_REF, +- attempt to use its first operand as BIT_FIELD_REF base. +- +-2017-03-01 Richard Biener +- +- PR middle-end/79721 +- * tree-chrec.c (chrec_evaluate): Perform computation of Newtons +- interpolating formula in wrapping arithmetic. +- (chrec_apply): Convert chrec_evaluate return value to wanted type. +- +-2017-03-01 Jakub Jelinek +- +- PR tree-optimization/79734 +- * tree-vect-generic.c (expand_vector_condition): Optimize +- AVX512 vector boolean VEC_COND_EXPRs into bitwise operations. +- Handle VEC_COND_EXPR where comparison has different inner width from +- type's inner width. +- +-2017-02-28 Sandra Loosemore +- +- * doc/invoke.texi (ARC Options): Copy-edit to fix punctuation, +- markup, and similar issues. Remove @opindex entries for things +- that aren't options. Add missing -mmpy-option entries. +- +-2017-02-28 Jakub Jelinek +- +- PR tree-optimization/79737 +- * gimple-ssa-store-merging.c (encode_tree_to_bitpos): If bitlen is +- a multiple of BITS_PER_UNIT and !BYTES_BIG_ENDIAN, clear +- tmpbuf[byte_size - 1]. Call natice_encode_expr with byte_size - 1 +- instead of byte_size. Formatting fix. +- (shift_bytes_in_array_right): Formatting fix. +- +-2017-02-28 Eric Botcazou +- +- PR target/79749 +- * config/sparc/sparc.c (sparc_frame_pointer_required): Add missing +- condition on optimize for the leaf function test. +- +-2017-02-28 Martin Liska +- +- PR lto/79625 +- * read-rtl-function.c (function_reader::handle_unknown_directive): +- Bail out when one uses -flto. +- +-2017-02-28 Martin Liska +- +- * common.opt: Replace space with tabular for options of +- type. +- * config/i386/i386.opt: Show value for +- -mlarge-data-threshold. +- * opts.c (print_filtered_help): Do not display number in hexadecimal +- format. +- +-2017-02-28 Martin Liska +- +- * common.opt: Fix --help=3Doption -Q for options which are of +- an enum type. +- +-2017-02-28 Uros Bizjak +- +- * config/i386/i386.c (print_reg): Error out for values +- of 8-bit size in invalid integer register. +- +-2017-02-28 Martin Sebor +- +- PR tree-optimization/79691 +- * passes.def (pass_all_optimizations_g): Enable pass_sprintf_length. +- +-2017-02-28 Jakub Jelinek +- +- PR target/79729 +- * config/i386/i386.c (ix86_print_operand) : Replace +- gcc_unreachable with output_operand_lossage. +- +-2017-02-28 Richard Biener +- +- PR tree-optimization/79740 +- * tree-ssa-sccvn.c (vn_nary_op_insert_into): Allow redundant +- inserts. +- (visit_nary_op): Insert the nary into the hashtable if we +- pattern-matched sth. +- * tree-ssa-pre.c (eliminate_insert): Robustify. +- +-2017-02-28 Richard Biener +- +- PR middle-end/79731 +- * fold-const.c (decode_field_reference): Reject out-of-bound +- accesses. +- +-2017-02-28 Jakub Jelinek +- +- * config/i386/i386.c: Include intl.h. +- (ix86_option_override_internal): Use cond ? G_("...") : G_("...") +- instead of just cond ? "..." : "...". +- * config/nvptx/nvptx.c (nvptx_goacc_validate_dims): Likewise. +- * coverage.c (read_counts_file): Likewise. +- * omp-offload.c: Include intl.h. +- (oacc_loop_fixed_partitions): Use cond ? G_("...") : G_("...") instead +- of just cond ? "..." : "...". +- * gcov.c (read_count_file): Use cond ? N_("...") : N_("...") instead +- of just cond ? "..." : "...". +- +-2017-02-28 Richard Earnshaw +- +- PR target/79742 +- * config/arm/parsecpu.awk (gen_data): Set tuning target to 'tune for' +- entry, if present. +- * config/arm/arm-cpus.in (cortex-m0plus.small-multiply): Correct +- 'tune for' CPU name. +- * config/arm/arm-cpu-data.h: Regenerated. +- +-2017-02-28 Richard Biener +- +- PR tree-optimization/79732 +- * tree-inline.c (expand_call_inline): Do not shadow var. +- +-2017-02-28 Richard Biener +- +- PR tree-optimization/79723 +- * tree-vect-stmts.c (get_vectype_for_scalar_type_and_size): Preserve +- address-space properly. +- +-2017-02-28 Thomas Schwinge +- +- * doc/optinfo.texi (Optimization groups): Fix option used for +- OPTGROUP_ALL. +- * doc/invoke.texi (-fopt-info): Document "omp". +- * dumpfile.h: Sort OPTGROUP_OMP before OPTGROUP_VEC. +- (OPTGROUP_ALL): Add OPTGROUP_OMP. +- * hsa-gen.c (pass_data_gen_hsail): Use OPTGROUP_OMP. +- * ipa-hsa.c (pass_data_ipa_hsa): Likewise. +- * omp-simd-clone.c (pass_data_omp_simd_clone): Likewise. +- +- * dumpfile.h (OPTGROUP_OPENMP): Rename to OPTGROUP_OMP. Adjust +- all users. +- * dumpfile.c (optgroup_options): Instead of "openmp", associate +- OPTGROUP_OMP with "omp". +- +-2017-02-27 Pat Haugen +- +- PR target/79544 +- * config/rs6000/rs6000-c.c (struct altivec_builtin_types): Use VSRAD +- for arithmetic shift of unsigned V2DI. +- +-2017-02-27 Claudiu Zissulescu +- +- * config.gcc (arc*-): Clean up, use arc/big.h, arc/elf.h, and +- arc/linux.h headers. +- * config/arc/arc.h (TARGET_OS_CPP_BUILTINS): Remove. +- (LINK_SPEC): Likewise. +- (ARC_TLS_EXTRA_START_SPEC): Likewise. +- (EXTRA_SPECS): Likewise. +- (STARTFILE_SPEC): Likewise. +- (ENDFILE_SPEC): Likewise. +- (LIB_SPEC): Likewise. +- (TARGET_SDATA_DEFAULT): Likewise. +- (TARGET_MMEDIUM_CALLS_DEFAULT): Likewise. +- (MULTILIB_DEFAULTS): Likewise. +- (DWARF2_UNWIND_INFO): Likewise. +- * config/arc/big.h: New file. +- * config/arc/elf.h: Likewise. +- * config/arc/linux.h: Likewise. +- * config/arc/t-uClibc: Remove. +- +-2017-02-27 Bin Cheng +- +- PR tree-optimization/77536 +- * tree-ssa-loop-manip.c (niter_for_unrolled_loop): New function. +- (tree_transform_and_unroll_loop): Use above function to compute the +- estimated niter of unrolled loop and use it when scaling profile. +- Also use count info rather than frequency if it's non-zero. +- * tree-ssa-loop-manip.h niter_for_unrolled_loop(): New declaration. +- * tree-vect-loop.c (scale_profile_for_vect_loop): New function. +- (vect_transform_loop): Call above function. +- +-2017-02-27 Richard Biener +- +- PR tree-optimization/45397 +- * tree-ssa-pre.c (eliminate_insert): Handle BIT_AND_EXPR. +- * tree-ssa-sccvn.c (valueized_wider_op): New helper. +- (visit_nary_op): Add pattern matching for CSEing sign-changed +- or truncated operations with wider ones. +- +-2017-02-27 Richard Biener +- +- PR tree-optimization/79690 +- * tree-vect-stmts.c (vectorizable_store): Use vector type +- built from the DR with address-space. +- +-2017-02-26 Gerald Pfeifer +- +- * doc/invoke.texi (Optimize Options): Refine the description +- of asan-use-after-return. +- +-2017-02-25 Alan Modra +- +- PR rtl-optimization/79584 +- * lra-constraints.c (base_to_reg): Reload ad->base, the entire +- base, not ad->base_term, the reg within base. Remove assertion +- that ad->base =3D=3D ad->base_term. Replace gen_int_mode using +- bogus mode with const0_rtx. +- +-2017-02-25 Jakub Jelinek +- +- PR middle-end/79396 +- * tree-eh.c (operation_could_trap_p, stmt_could_throw_1_p): Handle +- FMA_EXPR like tcc_binary or tcc_unary. +- +- * tree-ssa-loop-niter.c (number_of_iterations_exit): Simplify warning. +- +- PR debug/77589 +- * dwarf2out.c (struct dw_loc_list_struct): Add noted_variable_value +- bitfield. +- (size_of_loc_descr): Handle DW_OP_GNU_variable_value. +- (output_loc_operands): Handle DW_OP_call_ref and +- DW_OP_GNU_variable_value. +- (struct variable_value_struct): New type. +- (struct variable_value_hasher): Likewise. +- (variable_value_hash): New variable. +- (string_types): Remove. +- (copy_loc_descr): New function. +- (add_loc_descr_to_each): Clarify comment. Use copy_loc_descr. +- (prepend_loc_descr_to_each): New function. +- (add_loc_list): Fix comment typo. Use prepend_loc_descr_to_each +- instead of add_loc_descr_to_each if the first argument is single +- location list and the second has multiple. +- (resolve_args_picking_1): Handle DW_OP_GNU_variable_value. +- (loc_list_from_tree_1): For early_dwarf, emit DW_OP_GNU_variable_value +- when looking for variable value which doesn't have other location info. +- (loc_list_from_tree): Formatting fix. +- (gen_array_type_die): Simplify DW_AT_string_length handling. +- (adjust_string_types): Remove. +- (gen_subprogram_die): Don't call adjust_string_types nor test/set +- string_types. Call resolve_variable_values. +- (prune_unused_types_walk_loc_descr): Handle DW_OP_GNU_variable_value. +- (resolve_addr_in_expr): Likewise. Add A argument. +- (copy_deref_exprloc): Remove deref argument. Adjust for the +- original expression being DW_OP_GNU_variable_value with optionally +- DW_OP_stack_value after it instead of DW_OP_call4 with DW_OP_deref +- optionally after it. +- (optimize_string_length): Rework for DW_OP_GNU_variable_value. +- (resolve_addr): Adjust optimize_string_length and resolve_addr_in_expr +- callers. Set remove_AT_byte_size if removing DW_AT_string_length. +- (variable_value_hasher::hash, variable_value_hasher::equal): New +- methods. +- (resolve_variable_value_in_expr, resolve_variable_value, +- resolve_variable_values, note_variable_value_in_expr, +- note_variable_value): New functions. +- (dwarf2out_early_finish): Call note_variable_value on all toplevel +- DIEs. +- +-2017-02-24 Jakub Jelinek +- +- PR c/79677 +- * opts.h (handle_generated_option): Add GENERATED_P argument. +- * opts-common.c (handle_option): Adjust function comment. +- (handle_generated_option): Add GENERATED_P argument, pass it to +- handle_option. +- (control_warning_option): Pass false to handle_generated_option +- GENERATED_P. +- * opts.c (maybe_default_option): Pass true to handle_generated_option +- GENERATED_P. +- * optc-gen.awk: Likewise. +- +-2017-02-24 Segher Boessenkool +- +- * config/sh/sh.md (tstsi_t): If operands[0] is a SUBREG instead of +- a REG, look at the REG it is a SUBREG of. +- (splitter for cmpeqsi_t): Ditto. +- +-2017-02-24 Segher Boessenkool +- +- * config/pa/pa.c (pa_combine_instructions): Do not share RTL. Make +- the special USEs with the pattern of the insn, not the insn itself. +- +-2017-02-24 Matthew Fortune +- +- PR target/79473 +- * doc/invoke.texi: Document -mload-store-pairs. +- +-2017-02-24 Segher Boessenkool +- Sandra Loosemore +- +- * config/nios2/nios2.c (nios2_simple_const_p): Returns false if the +- argument isn't a CONST_INT. +- (nios2_alternate_compare_const): Assert op is a CONST_INT. +- (nios2_valid_compare_const_p): Assert op is a CONST_INT. +- (nios2_validate_compare): Bypass alternate compare logic if *op2 +- is not a CONST_INT. +- (ldstwm_operation_p): Return false if first_base is not a REG or +- if first_offset is not a CONST_INT. +- +-2017-02-24 Segher Boessenkool +- +- * config/cris/cris.md: Use correct operand in a define_peephole2. +- +-2017-02-24 Segher Boessenkool +- +- * config/c6x/c6x.c (predicate_insn): Do not incorrectly share RTL. +- +-2017-02-24 Segher Boessenkool +- +- * config/arc/arc.c (arc_ccfsm_advance): Only take the PATTERN of +- this_insn if it is an INSN or JUMP_INSN. +- (force_offsettable): Look at base, not at addr. +- * config/arc/predicates.md (brcc_nolimm_operator): Don't call INTVAL +- on things that aren't necessarily CONST_INTs. +- +-2017-02-24 Uros Bizjak +- +- * doc/invoke.texi (x86 Options, -mfpmath=3Dsse): Mention that +- -mfpmath=3Dsse is the default also for x86-32 targets with SSE2 +- instruction set when @option{-ffast-math} is enabled +- +-2017-02-24 Jeff Law +- +- PR rtl-optimizatoin/79286 +- * ira.c (update_equiv_regs): Drop may_trap_p exception to +- dominance test. +- +-2017-02-24 Richard Biener +- +- PR tree-optimization/79389 +- * gimple-ssa-split-paths.c (is_feasible_trace): Properly skip +- debug insns. +- +-2017-02-24 Aldy Hernandez +- +- * tree-ssa-loop-niter.c (number_of_iterations_exit): Update +- function comment to reflect reality. +- (loop_exits_before_overflow): Fix typo in function description. +- +-2017-02-24 Richard Biener +- +- PR tree-optimization/79389 +- * gimple-ssa-split-paths.c (is_feasible_trace): Verify more +- properly that a threading opportunity exists. Detect conditional +- copy/constant propagation opportunities. +- +-2017-02-23 Eric Botcazou +- +- * config/visium/visium.md (type): Add trap. +- (b): New mode attribute. +- (*btst): Rename into... +- (*btst): ...this and adjust. +- (*cbranchsi4_btst_insn): Rename into... +- (*cbranch4_btst_insn): ...this and adjust. +- (trap): New define_insn. +- +-2017-02-23 Jakub Jelinek +- +- PR tree-optimization/79389 +- * ifcvt.c (struct noce_if_info): Add rev_cond field. +- (noce_reversed_cond_code): New function. +- (noce_emit_store_flag): Use rev_cond if non-NULL instead of +- reversed_comparison_code. Formatting fix. +- (noce_try_store_flag): Test rev_cond !=3D NULL in addition to +- reversed_comparison_code. +- (noce_try_store_flag_constants): Likewise. +- (noce_try_store_flag_mask): Likewise. +- (noce_try_addcc): Use rev_cond if non-NULL instead of +- reversed_comparison_code. +- (noce_try_cmove_arith): Likewise. Formatting fixes. +- (noce_try_minmax, noce_try_abs): Clear rev_cond. +- (noce_find_if_block): Initialize rev_cond. +- (find_cond_trap): Call noce_get_condition with then_bb =3D=3D trap_bb +- instead of false as last argument never attempt to reverse it +- afterwards. +- +-2017-02-23 Bin Cheng +- +- PR tree-optimization/79663 +- * tree-predcom.c (combine_chains): Process refs in reverse order +- only for ZERO length chains, and add explaining comment. +- +-2017-02-23 Jeff Law +- +- PR tree-optimization/79578 +- * tree-ssa-dse.c (clear_bytes_written_by): Use OEP_ADDRESS_OF +- in call to operand_equal_p. +- +-2017-01-23 Dominique d'Humieres +- +- PR target/71017 +- * config/i386/cpuid.h: Fix another undefined behavior. +- +-2017-02-23 Richard Biener +- +- PR tree-optimization/79683 +- * tree-vect-stmts.c (vect_analyze_stmt): Do not overwrite +- vector types for data-refs. +- +-2017-02-23 Martin Liska +- +- * params.def (PARAM_MIN_NONDEBUG_INSN_UID): Change default to 0. +- +-2017-02-23 Jakub Jelinek +- +- PR middle-end/79665 +- * internal-fn.c (get_range_pos_neg): Moved to ... +- * tree.c (get_range_pos_neg): ... here. No longer static. +- * tree.h (get_range_pos_neg): New prototype. +- * expr.c (expand_expr_real_2) : If both arguments +- are known to be in between 0 and signed maximum inclusive, try to +- expand both unsigned and signed divmod and use the cheaper one from +- those. +- +-2017-02-22 Jeff Law +- +- PR tree-optimization/79578 +- * tree-ssa-dse.c (clear_bytes_written_by): Use operand_equal_p +- to compare base operands. +- +-2017-02-22 Segher Boessenkool +- +- PR target/79211 +- * config/rs6000/rs6000.md (*fsel4): Use +- gpc_reg_operand instead of fpr_reg_operand. +- +-2017-02-22 Sameera Deshpande +- +- * config/mips/mips.c (mips_return_in_memory): Force FP +- vector types to be returned in memory for o32 ABI. +- +-2017-02-22 Jakub Jelinek +- +- * dwarf2out.c (gen_variable_die): For -gdwarf-5, use DW_TAG_variable +- instead of DW_TAG_member for static data member declarations and don't +- set no_linkage_name for static inline data members. +- (gen_member_die): For -gdwarf-5 don't change DW_TAG_variable +- to DW_TAG_member. +- +-2017-02-22 Martin Liska +- +- * doc/invoke.texi: Replace inequality signs with square brackets +- for -Wnormalized. +- +-2017-02-22 Matthew Fortune +- +- PR target/78660 +- * lra-constraints.c (simplify_operand_subreg): Handle +- WORD_REGISTER_OPERATIONS targets. +- +-2017-02-22 Jakub Jelinek +- +- PR target/70465 +- * reg-stack.c (emit_swap_insn): Treat (float_extend:?F (mem:?F)) +- and (const_double:?F) like (mem:?F) for the purpose of fxch %st(1) +- elimination by swapping fld*. +- +-2017-02-22 Richard Biener +- +- PR tree-optimization/79673 +- * tree-ssa-pre.c (compute_avail): Use wide_int_to_tree to +- convert the [TARGET_]MEM_REF offset INTEGER_CST, scrapping off +- irrelevant address-space qualifiers and avoiding a +- ADDR_SPACE_CONVERT_EXPR from fold_convert. +- +-2017-02-22 Richard Biener +- +- PR tree-optimization/79666 +- * tree-vrp.c (extract_range_from_binary_expr_1): Make sure +- to not symbolically negate if that may introduce undefined +- overflow. +- +-2017-02-22 Martin Liska +- +- PR lto/79587 +- * data-streamer-in.c (streamer_read_gcov_count): Remove assert. +- * data-streamer-out.c (streamer_write_gcov_count_stream): +- Likewise. +- * value-prof.c (stream_out_histogram_value): Make assert more +- precise based on type of counter. +- +-2017-02-21 Uros Bizjak +- +- PR target/79593 +- * config/i386/i386.md (standard_x87sse_constant_load splitter): +- Use nonimmediate_operand instead of memory_operand for operand 1. +- (float-extend standard_x87sse_constant_load splitter): Ditto. +- +-2017-02-21 Jeff Law +- +- PR tree-optimization/79621 +- * gimple-ssa-isolate-paths.c (find_implicit_erroneous_behavior): Ignore +- blocks with edges to themselves. +- +-2017-02-21 Jakub Jelinek +- +- PR target/79633 +- * tree-chkp-opt.c (chkp_optimize_string_function_calls): Use +- is_gimple_call instead of comparing gimple_code with GIMPLE_CALL. +- Use gimple_call_builtin_p. +- +- PR target/79570 +- * sel-sched.c (moveup_expr_cached): Don't call sel_bb_head +- on temporarily removed DEBUG_INSNs. +- +- PR tree-optimization/79649 +- * tree-loop-distribution.c (classify_partition): Give up on +- non-generic address space loads/stores. +- +-2017-02-21 Aldy Hernandez +- +- * doc/loop.texi (Loop manipulation): Remove nonexistent +- tree_ssa_loop_version from the documentation. +- * cfgloopmanip.c (loop_version): Document CONDITION_BB argument. +- +-2017-02-21 Jakub Jelinek +- +- PR target/79494 +- * config/i386/i386.c (ix86_expand_split_stack_prologue): Call +- make_reg_eh_region_note_nothrow_nononlocal on call_insn. +- * config/rs6000/rs6000.c: Include except.h. +- (rs6000_expand_split_stack_prologue): Call +- make_reg_eh_region_note_nothrow_nononlocal on the call insn. +- +-2017-02-21 Martin Jambor +- +- PR lto/79579 +- * ipa-prop.c (ipa_prop_write_jump_functions): Bail out if no edges +- have been analyzed. +- +-2017-02-21 Martin Jambor +- +- * common.opt (-fipa-cp-alignment): Mark as ignored and preserved +- for backward compatibility only. +- * doc/invoke.texi (Option Summary): Remove all references to +- -fipa-cp-alignment. +- +-2017-02-21 Matthew Fortune +- +- PR target/78660 +- Revert: +- 2017-02-20 Matthew Fortune +- +- * lra-constraints.c (curr_insn_transform): Handle +- WORD_REGISTER_OPERATIONS requirements when reloading SUBREGs. +- +-2017-02-21 Martin Liska +- +- * config/i386/i386.opt: Replace -masm-dialect with -masm. +- +-2017-02-21 Thomas Schwinge +- +- PR translation/79638 +- * config/nvptx/nvptx.c (ENTRY_TEMPLATE): Single out "%ntid.y". +- +-2017-02-21 Eric Botcazou +- +- PR ada/67205 +- * config/arm/arm.c (TARGET_CUSTOM_FUNCTION_DESCRIPTORS): Define. +- (arm_function_ok_for_sibcall): Return false for an indirect call by +- descriptor if all the argument registers are used. +- (arm_relayout_function): Use FUNCTION_ALIGNMENT macro to adjust the +- alignment of the function. +- +-2017-02-21 Jakub Jelinek +- +- PR tree-optimization/61441 +- * simplify-rtx.c (simplify_const_unary_operation): For +- -fsignaling-nans and sNaN operand, return NULL_RTX rather than +- the sNaN unmodified. +- +-2017-02-20 Bernd Edlinger +- +- * Makefile.in (BUILD_SYSTEM_HEADER_DIR): New make variabe. +- (LIMITS_H_TEST, if_multiarch, stmp-fixinc): Use BUILD_SYSTEM_HEADER_DIR +- instead of SYSTEM_HEADER_DIR. +- +-2017-02-20 Gerald Pfeifer +- Martin Li=C5=A1ka +- +- * doc/invoke.texi (use-after-scope-direct-emission-threshold): +- Fix typos and grammar, use active voice, and clarify. +- +-2017-02-20 Marek Polacek +- +- PR middle-end/79537 +- * gimplify.c (gimplify_expr): Handle unused *&&L;. +- +- PR sanitizer/79558 +- * ubsan.c (ubsan_type_descriptor): Check if TYPE_MAX_VALUE is null. +- +-2017-02-20 Jakub Jelinek +- +- PR target/79568 +- * config/i386/i386.c (ix86_expand_builtin): Handle +- OPTION_MASK_ISA_AVX512VL and OPTION_MASK_ISA_64BIT in +- ix86_builtins_isa[fcode].isa as a requirement of those +- flags and any other flag in the bitmask. +- (ix86_init_mmx_sse_builtins): Use 0 instead of +- ~OPTION_MASK_ISA_64BIT as mask. +- * config/i386/i386-builtin.def (__builtin_ia32_rdtsc, +- __builtin_ia32_rdtscp, __builtin_ia32_pause, __builtin_ia32_bsrsi, +- __builtin_ia32_rdpmc, __builtin_ia32_rolqi, __builtin_ia32_rolhi, +- __builtin_ia32_rorqi, __builtin_ia32_rorhi): Likewise. +- +-2017-02-20 Matthew Fortune +- +- PR target/78012 +- * lra-constraints.c (split_reg): Check requested split mode +- is supported by the register. +- +-2017-02-20 Matthew Fortune +- +- * lra-constraints.c (simplify_operand_subreg): Remove early +- return false. +- +-2017-02-20 Matthew Fortune +- +- PR target/78660 +- * lra-constraints.c (curr_insn_transform): Tighten condition +- for converting SUBREG reloads from OP_OUT to OP_INOUT. +- +-2017-02-20 Matthew Fortune +- +- PR target/78660 +- * lra-constraints.c (curr_insn_transform): Handle +- WORD_REGISTER_OPERATIONS requirements when reloading SUBREGs. +- +-2017-02-19 Uros Bizjak +- +- Revert: +- 2016-05-30 Uros Bizjak +- +- * config/i386/sync.md (mfence_nosse): Use "lock orl $0, -4(%esp)". +- +-2017-02-19 Jonathan Wakely +- +- PR c++/69523 +- * doc/invoke.texi (C++ Dialect Options) [-Wliteral-suffix]: Update +- description. +- +-2017-02-19 Prathamesh Kulkarni +- +- * gimple-pretty-print.c (dump_ternary_rhs): Adjust gimple dump format +- for FMA_EXPR. +- +-2017-02-18 Jakub Jelinek +- +- * final.c (last_columnnum, override_columnnum): New variables. +- (final_start_function): Set last_columnnum, pass it to begin_prologue +- hook and pass 0 to dwarf2out_begin_prologue. +- (final_scan_insn): Update override_columnnum. Pass last_columnnum +- to source_line debug hook. +- (notice_source_line): Compute last_columnnum and for debug_column_info +- return true on column changes. +- * debug.h (struct gcc_debug_hooks): Add column argument to +- source_line and begin_prologue hooks. +- (debug_nothing_int_charstar_int_bool): Remove prototype. +- (debug_nothing_int_int_charstar, +- debug_nothing_int_int_charstar_int_bool): New prototypes. +- (dwarf2out_begin_prologue): Add column argument. +- * debug.c (do_nothing_debug_hooks): Adjust source_line and +- begin_prologue hooks. +- (debug_nothing_int_charstar_int_bool): Remove. +- (debug_nothing_int_int_charstar, +- debug_nothing_int_int_charstar_int_bool): New functions. +- * dwarf2out.c (dwarf2out_begin_prologue): Add column argument, pass it +- through to dwarf2out_source_line. +- (dwarf2_lineno_debug_hooks): Adjust begin_prologue hook. +- (dwarf2out_source_line): Add column argument, emit it if requested. +- * sdbout.c (sdbout_source_line, sdbout_begin_prologue): Add column +- arguments. +- * xcoffout.h (xcoffout_begin_prologue, xcoffout_source_line): Likewise. +- * xcoffout.c (xcoffout_begin_prologue, xcoffout_source_line): Likewise. +- * vmsdbgout.c (vmsdbgout_begin_prologue): Add column argument, pass it +- through to dwarf2out_begin_prologue. +- (vmsdbgout_source_line): Add column argument, pass it through to +- dwarf2out_source_line. +- * dbxout.c (dbxout_begin_prologue): Add column argument, adjust +- dbxout_source_line caller. +- (dbxout_source_line): Add column argument. +- +- * common.opt (gno-column-info, gcolumn-info): New options. +- * dwarf2out.c (dwarf2_lineno_debug_hooks): Formatting fix. +- (check_die): Also test for multiple DW_AT_decl_column attributes. +- (add_src_coords_attributes, dwarf2out_imported_module_or_decl_1): Add +- DW_AT_decl_column if requested. +- (gen_subprogram_die): Compare and/or add also DW_AT_decl_column +- if requested. +- (gen_variable_die): Likewise. +- (add_call_src_coords_attributes): Add DW_AT_call_column if requested. +- * doc/invoke.texi (-gcolumn-info, -gno-column-info): Document. +- +- PR target/79569 +- * config/i386/i386.opt (m3dnowa): Replace Undocumented with Report. +- * common/config/i386/i386-common.c (OPTION_MASK_ISA_3DNOW_A_SET): Define. +- (ix86_handle_option): Handle OPT_m3dnowa. +- * doc/invoke.texi (-m3dnowa): Document. +- * doc/extend.texi (__builtin_ia32_pmulhuw, __builtin_ia32_pf2iw): Use +- -m3dnowa instead of -m3dnow -march=3Dathlon. +- +- PR target/79559 +- * config/i386/i386.c (ix86_print_operand): Use output_operand_lossage +- instead of gcc_assert for K, r and R code checks. Formatting fixes. +- +-2017-02-17 Bill Schmidt +- +- PR target/79261 +- * config/rs6000/rs6000.c (rs6000_expand_ternop_builtin): Add +- support for CODE_FOR_vsx_xxpermdi_v2d[fi]_be. +- * config/rs6000/rs6000.md (reload_gpr_from_vsx): Call +- generator for vsx_xxpermdi__be. +- * config/rs6000/vsx.md (vsx_xxpermdi_): Remove logic to +- force big-endian semantics. +- (vsx_xxpermdi__be): New define_expand with same +- implementation as previous version of vsx_xxpermdi_. +- +-2017-02-17 Jakub Jelinek +- +- PR tree-optimization/79327 +- * gimple-ssa-sprintf.c (format_integer): Remove likely_adjust +- variable, its initialization and use. +- +-2017-02-17 Julia Koval +- +- * common/config/i386/i386-common.c (OPTION_MASK_ISA_RDPID_SET): New. +- (OPTION_MASK_ISA_PKU_UNSET): New. +- (ix86_handle_option): Handle -mrdpid. +- * config/i386/cpuid.h (bit_RDPID): New. +- * config/i386/driver-i386.c (host_detect_local_cpu): +- Detect RDPID feature. +- * config/i386/i386-builtin.def (__builtin_ia32_rdpid): New. +- * config/i386/i386-c.c (ix86_target_macros_internal): +- Handle RDPID flag. +- * config/i386/i386.c (ix86_target_string): Add -mrdpid to isa2_opts. +- (ix86_valid_target_attribute_inner_p): Add "rdpid". +- (ix86_expand_builtin): Handle IX86_BUILTIN_RDPID. +- * config/i386/i386.h (TARGET_RDPID, TARGET_RDPID_P): New. +- * config/i386/i386.md (define_insn "rdpid"): New. +- * config/i386/i386.opt Add -mrdpid. +- * config/i386/immintrin.h (_rdpid_u32): New. +- +-2017-02-17 Vladimir Makarov +- +- PR rtl-optimization/79541 +- * lra-constraints.c (curr_insn_transform): Remove wrong asm insn +- instead of transforming it into USE. +- +-2017-02-17 Segher Boessenkool +- +- * config/rs6000/rs6000.md (extendsfdf2): Remove default arguments. +- If HONOR_SNANS (SFmode) force the input to a register. +- (*extendsfdf2_fpr): Add !HONOR_SNANS (SFmode) condition. +- (*extendsfdf2_snan): New pattern, used when using SNaNs; it generates +- an frsp or similar insn. +- +-2017-02-17 Martin Liska +- +- PR rtl-optimization/79577 +- * params.def (selsched-max-sched-times): Increase minimum to 1. +- +-2017-02-17 Martin Liska +- +- PR rtl-optimization/79574 +- * gcse.c (want_to_gcse_p): Prevent integer overflow. +- +-2017-02-17 Martin Liska +- +- PR tree-optimization/79529 +- * tree-ssa-loop-unswitch.c (is_maybe_undefined): Use +- ssa_defined_default_def_p to handle cases which are implicitly +- defined. +- * tree-ssa.c (ssa_defined_default_def_p): New function. +- (ssa_undefined_value_p): Use ssa_defined_default_def_p to handle cases +- which are implicitly defined. +- * tree-ssa.h (ssa_defined_default_def_p): Declare. +- +-2017-02-17 Richard Biener +- +- PR middle-end/79576 +- * params.def (max-ssa-name-query-depth): Limit to 10. +- +-2017-02-17 Richard Biener +- +- PR tree-optimization/79552 +- * tree-ssa-structalias.c (visit_loadstore): Properly verify +- default defs. +- +-2017-02-17 Richard Biener +- +- PR bootstrap/79567 +- * genmatch.c (output_line_directive): Handle DIR_SEPARATOR_2. +- +-2017-02-17 Marek Polacek +- +- PR middle-end/79536 +- * fold-const.c (fold_negate_expr_1): Renamed from fold_negate_expr. +- (fold_negate_expr): New wrapper. +- +-2017-02-16 Sandra Loosemore +- +- * doc/invoke.texi (C++ Dialect Options) [-Wno-non-template-friend]:=20 +- Correct terminology and de-emphasize pre-standard behavior. +- +-2017-02-16 Alan Modra +- +- PR rtl-optimization/79286 +- * ira.c (def_dominates_uses): New function. +- (update_equiv_regs): Don't create an equivalence for insns that +- may trap where the register def does not dominate the use. +- +-2017-02-16 Vladimir Makarov +- +- PR rtl-optimization/78127 +- * lra.c (lra): Call lra_eliminate before finish the loop after +- lra_constraint. +- +-2017-02-16 Richard Biener +- +- * graphite.h: Do not include isl/isl_val_gmp.h, instead include +- isl/isl_val.h. +- * graphite-isl-ast-to-gimple.c (gmp_cst_to_tree): Remove. +- (gcc_expression_from_isl_expr_int): Use generic isl_val interface. +- * graphite-sese-to-poly.c: Do not include isl/isl_val_gmp.h. +- (isl_val_int_from_wi): New function. +- (extract_affine_gmp): Rename to ... +- (extract_affine_wi): ... this, take a widest_int. +- (extract_affine_int): Just wrap extract_affine_wi. +- (add_param_constraints): Use isl_val_int_from_wi. +- (add_loop_constraints): Likewise, and extract_affine_wi. +- +-2017-02-15 Jeff Law +- +- PR middle-end/79521 +- * ira-costs.c (scan_one_insn): Check have_regs_of_mode before calling +- ira_init_register_move_cost_if_necessary. +- +-2017-02-15 Martin Sebor +- +- PR middle-end/32003 +- * doc/invoke.texi (-fdump-final-insns): Replace option accidentally +- removed in a prior commit. +- +-2017-02-15 Bin Cheng +- +- PR tree-optimization/79347 +- * tree-vect-loop-manip.c (vect_do_peeling): Maintain profile +- counters during peeling. +- +-2017-02-15 Thomas Schwinge +- +- * Makefile.in (site.exp): Remove "set ISLVER". +- +-2017-02-15 Jakub Jelinek +- +- PR target/79487 +- * real.c (real_from_integer): Call real_convert even for decimal. +- +-2017-02-15 Dominik Vogt +- +- PR target/79421 +- * config/s390/s390.c: define TARGET_CUSTOM_FUNCTION_DESCRIPTORS. +- +-2017-02-14 Andrew Pinski +- +- * config/aarch64/aarch64-cores.def (thunderx2t99): Move to under 'C" +- cores and change the partno/implementer to be correct. +- (thunderx2t99p1): New core which replaces thunderx2t99 and still has +- the 'B" as the implementer. +- * config/aarch64/aarch64-tune.md: Regenerate. +- +-2017-02-14 Carl Love +- +- * config/rs6000/rs6000.c: Add case statement entry to make the +- xvcvuxdsp built-in argument unsigned. +- * config/rs6000/vsx.md: Fix the source and return operand types so they +- match the instruction definitions from the ISA document. Fix typo +- in the instruction generation for the (define_insn "vsx_xvcvuxdsp" +- statement. +- +-2017-02-14 Vladimir Makarov +- +- PR target/79282 +- * lra-int.h (struct lra_operand_data, struct lra_insn_reg): Add +- member early_clobber_alts. +- * lra-lives.c (reg_early_clobber_p): New. +- (process_bb_lives): Use it. +- * lra.c (new_insn_reg): New arg early_clobber_alts. Use it. +- (debug_operand_data): Initialize early_clobber_alts. +- (setup_operand_alternative): Set up early_clobber_alts. +- (collect_non_operand_hard_regs): Ditto. Pass early clobber +- alternatives to new_insn_reg. +- (add_regs_to_insn_regno_info): Add arg early_clobber_alts. Use +- it. +- (lra_update_insn_regno_info): Pass the new arg. +- +-2017-02-14 Jakub Jelinek +- +- PR middle-end/79505 +- * omp-offload.c (free_oacc_loop): Release loop->ifns vector. +- (new_oacc_loop_raw): Don't clear already cleared fields. +- +- PR target/79481 +- * config/i386/avx512pfintrin.h (_mm512_prefetch_i32gather_pd, +- _mm512_prefetch_i32gather_ps, _mm512_prefetch_i64gather_pd, +- _mm512_prefetch_i64gather_ps): New inline functions and macros. +- +-2017-02-14 Uros Bizjak +- +- PR target/79495 +- * config/i386/i386.md (*movxf_internal): Add (o,rC) alternative. +- +-2017-02-14 H.J. Lu +- +- PR target/79498 +- * config/i386/i386.c (timode_scalar_chain::convert_insn): Insert +- the extra instruction to the right place to store 128-bit constant +- when needed. +- +-2017-02-14 Martin Sebor +- +- PR middle-end/79448 +- * gimple-ssa-sprintf.c (format_directive): Avoid issuing INT_MAX +- warning for strings of unknown length. +- +-2017-02-13 Segher Boessenkool +- +- * config.gcc (supported_defaults) [powerpc*-*-*]: Update. +- +-2017-02-14 Jeff Law +- +- PR target/79404 +- * ira-costs.c (scan_one_insn): Initialize register move costs +- for pseudos seen in USE/CLOBBER insns. +- +- PR tree-optimization/79095 +- * tree-vrp.c (extract_range_from_binary_expr_1): For EXACT_DIV_EXPR, +- if the numerator has the range ~[0,0] make the resultant range ~[0,0]. +- (extract_range_from_binary_expr): For MINUS_EXPR with no derived range, +- if the operands are known to be not equal, then the resulting range +- is ~[0,0]. +- (intersect_ranges): If the new range is ~[0,0] and the old range is +- wide, then prefer ~[0,0]. +- * tree-vrp.c (overflow_comparison_p_1): New function. +- (overflow_comparison_p): New function. +- * tree-vrp.c (register_edge_assert_for_2): Register additional asserts +- if NAME is used in an overflow test. +- (vrp_evaluate_conditional_warnv_with_ops): If the ops represent an +- overflow check that can be expressed as an equality test, then adjust +- ops to be that equality test. +- +-2017-02-14 Andreas Krebbel +- +- * config/s390/s390-builtin-types.def: Remove flags argument. +- * config/s390/s390.c (s390_init_builtins): Likewise. +- +-2017-02-14 Martin Liska +- +- * tree-ssa-loop-unswitch.c (hoist_guard): Release get_loop_body +- vector. Fix trailing white spaces. +- +-2017-02-14 James Greenhalgh +- +- * config/aarch64/aarch64.c (aarch64_simd_container_mode): Handle +- HFmode. +- +-2017-02-14 Kyrylo Tkachov +- +- PR rtl-optimization/68664 +- * config/arm/arm.c (arm_sched_can_speculate_insn): +- New function. Declare prototype. +- (TARGET_SCHED_CAN_SPECULATE_INSN): Define. +- +-2017-02-14 Kyrylo Tkachov +- +- PR rtl-optimization/68664 +- * config/aarch64/aarch64.c (aarch64_sched_can_speculate_insn): +- New function. +- (TARGET_SCHED_CAN_SPECULATE_INSN): Define. +- +-2017-02-14 Amit Pawar +- +- * config/i386/i386.c (znver1_cost): Fix the alignment for function and +- max skip bytes for function, loop and jump. +- +-2017-02-14 Prathamesh Kulkarni +- +- * gimple-pretty-print.c (dump_unary_rhs): Adjust dump format for +- ABS_EXPR for gimple dump. +- +-2017-02-14 Jakub Jelinek +- +- PR target/79462 +- * config/sh/sh.c (expand_cbranchdi4): Don't clear operands[4]. +- +- PR tree-optimization/79408 +- * tree-vrp.c (simplify_div_or_mod_using_ranges): Handle also the +- case when on TRUNC_MOD_EXPR op0 is INTEGER_CST. +- (simplify_stmt_using_ranges): Call simplify_div_or_mod_using_ranges +- also if rhs1 is INTEGER_CST. +- +-2017-02-14 Richard Biener +- +- PR middle-end/79432 +- * tree-into-ssa.c (insert_phi_nodes): When the function can +- have abnormal edges rewrite SSA names with broken use-def +- dominance out of SSA and register them for PHI insertion. +- +-2017-02-13 Martin Sebor +- +- PR middle-end/79496 +- * gimple-ssa-sprintf.c (pass_sprintf_length::handle_gimple_call): Avoid +- clearing info.nowrite flag when snprintf size argument is a range. +- +-2017-02-13 Jakub Jelinek +- +- * cprop.c (cprop_jump): Add missing space in string literal. +- * tree-ssa-structalias.c (rewrite_constraints): Likewise. +- (get_constraint_for_component_ref): Likewise. +- * df-core.c (df_worklist_dataflow_doublequeue): Likewise. +- * tree-outof-ssa.c (insert_partition_copy_on_edge): Likewise. +- * lra-constraints.c (process_alt_operands): Likewise. +- * ipa-inline.c (inline_small_functions): Likewise. +- * tree-ssa-sccvn.c (visit_reference_op_store): Likewise. +- * cgraph.c (cgraph_edge::redirect_call_stmt_to_callee): Likewise. +- * trans-mem.c (diagnose_tm_1_op): Likewise. +- * omp-grid.c (grid_find_single_omp_among_assignments): Likewise. +- (grid_parallel_clauses_gridifiable): Likewise. +- +- * config/nvptx/mkoffload.c (process): Add space in between +- , and %d. +- +- * config/i386/i386.h (REG_CLASS_NAMES): Add , in between +- "MOD4_SSE_REGS" and "ALL_REGS". +- +- * spellcheck.c (test_data): Add , in between "foo" and "food". +- +-2017-02-13 Aaron Sawdey +- +- PR target/79449 +- * config/rs6000/rs6000.c (expand_block_compare): Make sure runtime +- boundary crossing check and subsequent code generation agree. +- +-2017-02-13 Kyrylo Tkachov +- +- * config/aarch64/aarch64.c (has_memory_op): Delete. +- (aarch64_madd_needs_nop): Use contains_mem_rtx_p instead of +- has_memory_op. +- +-2017-02-13 Jakub Jelinek +- +- PR rtl-optimization/79388 +- PR rtl-optimization/79450 +- * combine.c (distribute_notes): When removing TEM_INSN for which +- corresponding dest has last value recorded, invalidate that last +- value. +- +-2017-02-13 Kyrylo Tkachov +- +- * config/arm/arm.c (arm_print_tune_info): Use ASM_COMMENT_START instead +- of explicit '@'. Add missing assembly comment marker on branch costs +- printout. +- +-2017-02-13 Nathan Sidwell +- +- * gengtype-lex.l (): Add '/'. +- +-2017-02-13 Martin Liska +- +- PR c/79471 +- * calls.c (expand_call): Replace XALLOCAVEC with XCNEWVEC. +- +-2017-02-13 Richard Biener +- +- * configure.ac (HAVE_ISL_OPTIONS_SET_SCHEDULE_SERIALIZE_SCCS): +- Remove. +- * configure: Re-generate. +- * config.in: Likewise. +- * graphite-dependences.c: Simplify as if +- HAVE_ISL_OPTIONS_SET_SCHEDULE_SERIALIZE_SCCS was defined. +- * graphite-isl-ast-to-gimple.c: Likewise. +- * graphite-optimize-isl.c: Likewise. +- * graphite-poly.c: Likewise. +- * graphite-sese-to-poly.c: Likewise. +- * graphite.h: Likewise. +- * toplev.c: Include isl/version.h and use isl_version () for +- printing the ISL version. +- * doc/install.texi: Update ISL requirement. +- +-2017-02-12 Gerald Pfeifer +- +- * doc/standards.texi (Standards): Update reference to +- Objective-C 2.0. +- +-2017-02-12 Gerald Pfeifer +-=09 +- * doc/extend.texi (Named Address Spaces): sourceware.org now +- defaults to https. +- * doc/install.texi (Binaries): Ditto. +- (Specific): Ditto. +- +-2017-02-11 Sandra Loosemore +- +- * doc/cpp.texi: Replace "stringify"/"stringification" with C=20 +- standard terminology "stringize"/"stringizing" throughout. +- * doc/cppinternals.texi: Likewise. +- +-2017-02-11 Sandra Loosemore +- +- * doc/extend.texi: Fix some spelling mistakes and typos. +- * doc/invoke.texi: Likewise. +- +-2017-02-11 Jan Hubicka +- +- PR ipa/79224 +- * params.def (inline-min-speedup) Change from 10 to 8. +- +-2017-02-11 Jakub Jelinek +- +- * doc/invoke.texi (fopenmp): Bump OpenMP version from 4.0 to +- 4.5. +- +-2017-02-11 Jan Hubicka +- +- PR ipa/79224 +- * ipa-inline-analysis.c (get_minimal_bb): New function. +- (record_modified): Use it. +- (remap_edge_change_prob): Handle also ancestor functions. +- +-2017-02-11 Gerald Pfeifer +- +- * doc/contrib.texi (Contributors): Remove broken link into +- the Mauve CVS repository. +- +-2017-02-11 Jakub Jelinek +- +- PR middle-end/79454 +- * internal-fn.c (expand_vector_ubsan_overflow): Use piece-wise +- result computation whenever lhs doesn't have vector mode, not +- just when it has BLKmode. +- +-2017-02-10 Gerald Pfeifer +- +- * doc/makefile.texi (profiledbootstrap): Refer to the +- installation instructions only in textual form. +- +-2017-02-10 Aaron Sawdey +- +- PR target/79295 +- * config/rs6000/altivec.md (bcd): Fix constraints. +- +-2017-02-10 Gerald Pfeifer +- +- * doc/install.texi (Specific): Use https for blackfin.uclinux.org. +- (Specific): Update mingw-w64 reference. +- (Binaries): Ditto. +- (Specific): Remove broken link to Renesas RX processor. +- +-2017-02-10 Richard Biener +- +- * toplev.c (process_options): Do not mention obsolete graphite +- options when printing sorry message about missing graphite support. +- Mention -floop-nest-optimize. +- +-2017-02-10 Christophe Lyon +- +- * config/aarch64/arm_neon.h (vtst_p8): Rewrite without asm. +- (vtst_p16): Likewise. +- (vtstq_p8): Likewise. +- (vtstq_p16): Likewise. +- (vtst_p64): New. +- (vtstq_p64): Likewise. +- * config/arm/arm_neon.h (vgetq_lane_p64): New. +- (vset_lane_p64): New. +- (vsetq_lane_p64): New. +- +-2017-02-10 Jakub Jelinek +- +- PR tree-optimization/79411 +- * tree-ssa-reassoc.c (is_reassociable_op): Return false if +- stmt operands are SSA_NAMEs used in abnormal phis. +- (can_reassociate_p): Return false if op is SSA_NAME used in abnormal +- phis. +- +-2017-02-09 Jan Hubicka +- +- PR ipa/70795 +- * cgraphunit.c (cgraph_node::add_new_function): Set externally_visible +- flag if needed. +- +-2017-02-09 Jan Hubicka +- +- * tree-ssa-loop-unswitch.c (hoist_guard): Update profile. +- +-2017-02-09 Jakub Jelinek +- +- * omp-offload.c (oacc_loop_auto_partitions): Use || instead of | +- to avoid warning. +- +- PR c/79413 +- * gimplify.h (is_gimple_sizepos): Only test for INTEGER_CST constants, +- not arbitrary TREE_CONSTANT. +- +- PR c/79431 +- * gimplify.c (gimplify_adjust_omp_clauses): Ignore +- "omp declare target link" attribute unless is_global_var. +- * omp-offload.c (find_link_var_op): Likewise. +- +-2017-02-09 Nathan Sidwell +- Chung-Lin Tang +- +- * gimplify.c (gimplify_scan_omp_clauses): No special handling for +- OMP_CLAUSE_TILE. +- (gimplify_adjust_omp_clauses): Don't delete TILE. +- (gimplify_omp_for): Deal with TILE. +- * internal-fn.c (expand_GOACC_TILE): New function. +- * internal-fn.def (GOACC_DIM_POS): Comment may be overly conservative. +- (GOACC_TILE): New. +- * omp-expand.c (struct oacc_collapse): Add tile and outer fields. +- (expand_oacc_collapse_init): Add LOC paramter. Initialize tile +- element fields. +- (expand_oacc_collapse_vars): Add INNER parm, adjust for tiling, +- avoid DIV for outermost collapse var. +- (expand_oacc_for): Insert tile element loop as needed. Adjust. +- Remove out of date comments, fix whitespace. +- * omp-general.c (omp_extract_for_data): Deal with tiling. +- * omp-general.h (enum oacc_loop_flags): Add OLF_TILE flag, +- adjust OLF_DIM_BASE value. +- (struct omp_for_data): Add tiling field. +- * omp-low.c (scan_sharing_clauses): Allow OMP_CLAUSE_TILE. +- (lower_oacc_head_mark): Add OLF_TILE as appropriate. Ensure 2 levels +- for auto loops. Remove default auto determining, moved to +- oacc_loop_fixed_partitions. +- * omp-offload.c (struct oacc_loop): Change 'ifns' to vector of call +- stmts, add e_mask field. +- (oacc_dim_call): New function, abstracted out from oacc_thread_numbers. +- (oacc_thread_numbers): Use oacc_dim_call. +- (oacc_xform_tile): New. +- (new_oacc_loop_raw): Initialize e_mask, adjust for ifns vector. +- (finish_oacc_loop): Adjust for ifns vector. +- (oacc_loop_discover_walk): Append loop abstraction sites to list, +- add case for GOACC_TILE fns. +- (oacc_loop_xform_loop): Delete. +- (oacc_loop_process): Iterate over call list directly, and add +- handling for GOACC_TILE fns. +- (oacc_loop_fixed_partitions): Determine default auto, deal with TILE, +- dump partitioning. +- (oacc_loop_auto_partitions): Add outer_assign parm. Assign all but +- vector partitioning to outer loops. Assign 2 partitions to loops +- when available. Add TILE handling. +- (oacc_loop_partition): Adjust oacc_loop_auto_partitions call. +- (execite_oacc_device_lower): Process GOACC_TILE fns, ignore unknown spec= s. +- * tree-nested.c (convert_nonlocal_omp_clauses): Allow OMP_CLAUSE_TILE. +- * tree.c (omp_clause_num_ops): Adjust TILE ops. +- * tree.h (OMP_CLAUSE_TILE_ITERVAR, OMP_CLAUSE_TILE_COUNT): New. +- +-2017-02-09 Gerald Pfeifer +- +- * configure.ac (ACX_BUGURL): Update. +- * configure: Regenerate. +- +-2017-02-09 Richard Biener +- +- PR tree-optimization/69823 +- * graphite-scop-detection.c (scop_detection::harmful_loop_in_region): +- Properly enumerate all BBs in the region. Use auto_vec/auto_bitmap. +- +-2017-02-09 Andrew Burgess +- +- * config/arc/arc-c.def: Add __NPS400__ definition. +- * config/arc/arc.h (CPP_SPEC): Don't define __NPS400__ here. +- (TARGET_NPS400): Define. +- +-2017-02-09 Andrew Burgess +- +- * config/arc/arc-arch.h (arc_arch_t): Move unchanged to earlier in +- file. +- (arc_cpu_t): Change base_architecture field, arch, to a arc_arc_t +- pointer, arch_info. +- (arc_cpu_types): Fill the arch_info field with a pointer into the +- arc_arch_types table. +- (arc_selected_cpu): Declare. +- * config/arc/arc.c (arc_selected_cpu): Make global. +- (arc_selected_arch): Delete. +- (arc_base_cpu): Delete. +- (arc_override_options): Remove references to deleted variables, +- update access to arch information. +- (ARC_OPT): Update access to arch information. +- (ARC_OPTX): Likewise. +- * config/arc/arc.h (arc_base_cpu): Remove declaration. +- (TARGET_ARC600): Update access to arch information. +- (TARGET_ARC601): Likewise. +- (TARGET_ARC700): Likewise. +- (TARGET_EM): Likewise. +- (TARGET_HS): Likewise. +- * config/arc/driver-arc.c (arc_cpu_to_as): Update access to arch +- information. +- +-2017-02-08 Pat Haugen +- +- PR target/78604 +- * config/rs6000/rs6000.c (rs6000_emit_vector_cond_expr): Invert +- condition/operands for integer GE/LE/GEU/LEU operations. +- +-2017-02-08 Segher Boessenkool +- +- PR translation/79397 +- * config/rs6000/rs6000.opt (maltivec=3Dle, maltivec=3Dbe): Fix spelling +- of AltiVec. +- +-2017-02-08 Martin Jambor +- +- PR ipa/79375 +- * ipa-prop.c (ipa_alloc_node_params): Make static, return bool +- whether allocation happened. +- (ipa_initialize_node_params): Do not call ipa_alloc_node_params if +- nothing was allocated. +- +-2017-02-08 Jakub Jelinek +- +- PR tree-optimization/79408 +- * tree-vrp.c (simplify_div_or_mod_using_ranges): If op1 is not +- constant, but SSA_NAME with a known integer range, use the minimum +- of that range instead of op1 to determine if modulo can be replaced +- with its first operand. +- +-2016-02-08 Kyrylo Tkachov +- +- * config/riscv/riscv.c (riscv_build_integer_1): Avoid use of INT16_MAX. +- +-2017-02-08 Richard Biener +- +- PR tree-optimization/71824 +- * graphite-scop-detection.c (scop_detection::build_scop_breadth): +- Check all loops contained in the merged region. +- +-2017-02-07 Andrew Pinski +- +- * config/aarch64/aarch64.md (popcount2): New pattern. +- +-2017-02-07 Andrew Pinski +- +- * config/aarch64/aarch64-cores.def (thunderx): Disable LSE. +- (thunderxt88): Likewise. +- (thunderxt81): Disable LSE and change v8.1 to v8. +- (thunderxt83): Likewise. +- +-2017-02-07 Jakub Jelinek +- Richard Biener +- +- PR middle-end/79399 +- * ira-int.h (struct target_ira_int): Change x_max_struct_costs_size +- type from int to size_t. +- * ira-costs.c (struct_costs_size): Change type from int to size_t. +- +-2017-02-07 Jakub Jelinek +- +- PR rtl-optimization/79386 +- * cprop.c (bypass_conditional_jumps): Initialize +- bypass_last_basic_block already before splitting bbs after +- unconditional traps... +- (bypass_conditional_jumps): ... rather than here. +- +- PR target/79299 +- * config/i386/sse.md (xtg_mode, gatherq_mode): New mode attrs. +- (*avx512f_gathersi, *avx512f_gathersi_2, +- *avx512f_gatherdi, *avx512f_gatherdi_2): Use them, +- fix -masm=3Dintel patterns. +- +-2017-02-07 Richard Biener +- +- PR tree-optimization/79256 +- PR middle-end/79278 +- * builtins.c (get_object_alignment_2): Use min_align_of_type +- to extract alignment for MEM_REFs to honor BIGGEST_FIELD_ALIGNMENT +- and ADJUST_FIELD_ALIGN. +- +- * doc/tm.texi.in (ADJUST_FIELD_ALIGN): Adjust to take additional +- type parameter. +- * doc/tm.texi: Regenerate. +- * stor-layout.c (layout_decl): Adjust. +- (update_alignment_for_field): Likewise. +- (place_field): Likewise. +- (min_align_of_type): Likewise. +- * config/arc/arc.h (ADJUST_FIELD_ALIGN): Adjust. +- * config/epiphany/epiphany.h (ADJUST_FIELD_ALIGN): Likewise. +- * config/epiphany/epiphany.c (epiphany_adjust_field_align): Likewise. +- * config/frv/frv.h (ADJUST_FIELD_ALIGN): Likewise. +- * config/frv/frv.c (frv_adjust_field_align): Likewise. +- * config/i386/i386.h (ADJUST_FIELD_ALIGN): Likewise. +- * config/i386/i386.c (x86_field_alignment): Likewise. +- * config/rs6000/aix.h (ADJUST_FIELD_ALIGN): Likewise. +- * config/rs6000/darwin.h (ADJUST_FIELD_ALIGN): Likewise. +- * config/rs6000/freebsd64.h (ADJUST_FIELD_ALIGN): Likewise. +- * config/rs6000/linux64.h (ADJUST_FIELD_ALIGN): Likewise. +- * config/rs6000/sysv4.h (ADJUST_FIELD_ALIGN): Likewise. +- * config/rs6000/rs6000.c (rs6000_special_adjust_field_align_p): +- Likewise. +- +- Revert +- 2017-01-30 Richard Biener +- +- PR tree-optimization/79256 +- * targhooks.c (default_builtin_vector_alignment_reachable): Honor +- BIGGEST_FIELD_ALIGNMENT and ADJUST_FIELD_ALIGN to fix up bogus +- alignment on TYPE. +- +-2017-02-07 Toma Tabacu +- +- * config/mips/mips.c (mips_expand_builtin_insn): Convert the QImode +- argument of the pshufh, psllh, psllw, psrah, psraw, psrlh, psrlw +- builtins to SImode and emit a zero-extend, if necessary. +- +-2017-02-06 Palmer Dabbelt +- +- * docs/invoke.texi (RISC-V Options): Alphabetize. +- +-2017-02-06 Palmer Dabbelt +- +- * doc/invoke.texi (RISC-V Options): Use two spaces to separate +- options. +- +-2017-02-06 Palmer Dabbelt +- +- * config/riscv/riscv.c: New file. +- * gcc/common/config/riscv/riscv-common.c: Likewise. +- * config.gcc: Likewise. +- * config/riscv/constraints.md: Likewise. +- * config/riscv/elf.h: Likewise. +- * config/riscv/generic.md: Likewise. +- * config/riscv/linux.h: Likewise. +- * config/riscv/multilib-generator: Likewise. +- * config/riscv/peephole.md: Likewise. +- * config/riscv/pic.md: Likewise. +- * config/riscv/predicates.md: Likewise. +- * config/riscv/riscv-builtins.c: Likewise. +- * config/riscv/riscv-c.c: Likewise. +- * config/riscv/riscv-ftypes.def: Likewise. +- * config/riscv/riscv-modes.def: Likewise. +- * config/riscv/riscv-opts.h: Likewise. +- * config/riscv/riscv-protos.h: Likewise. +- * config/riscv/riscv.h: Likewise. +- * config/riscv/riscv.md: Likewise. +- * config/riscv/riscv.opt: Likewise. +- * config/riscv/sync.md: Likewise. +- * config/riscv/t-elf-multilib: Likewise. +- * config/riscv/t-linux: Likewise. +- * config/riscv/t-linux-multilib: Likewise. +- * config/riscv/t-riscv: Likewise. +- * configure.ac: Likewise. +- * doc/contrib.texi: Add Kito Cheng, Palmer Dabbelt, and Andrew +- Waterman as RISC-V maintainers. +- * doc/install.texi: Add RISC-V entries. +- * doc/invoke.texi: Add RISC-V options section. +- * doc/md.texi: Add RISC-V constraints section. +- * configure: Regenerated. +- +-2017-02-06 Michael Meissner +- +- PR target/66144 +- * config/rs6000/vector.md (vcond): Allow the true and +- false values to be constant vectors with all 0 or all 1 bits set. +- (vcondu): Likewise. +- * config/rs6000/predicates.md (vector_int_reg_or_same_bit): New +- predicate. +- (fpmask_comparison_operator): Update comment. +- (vecint_comparison_operator): New predicate. +- * config/rs6000/rs6000.c (rs6000_emit_vector_cond_expr): Optimize +- vector conditionals when the true and false values are constant +- vectors with all 0 bits or all 1 bits set. +- +-2017-02-06 Martin Sebor +- +- PR tree-optimization/79376 +- * gimple-fold.c (get_range_strlen): Set the minimum length to zero. +- +-2017-02-06 Uros Bizjak +- +- * config/i386/sse.md (vector modes -> vec_extract* splitter): Use +- explicit subreg RTX with operand 1. Use VECTOR_MODE_P predicate +- to simplify split condition. +- +-2017-02-06 Jakub Jelinek +- +- * omp-expand.c (oxpand_omp_atomic_fetch_op, +- expand_omp_atomic_pipeline): Return false if can_atomic_load_p is +- false. +- +-2017-02-06 Segher Boessenkool +- +- PR rtl-optimization/68664 +- * target.def (can_speculate_insn): New hook. +- * doc/tm.texi.in (TARGET_SCHED_CAN_SPECULATE_INSN): New hook. ++ * target.def (flags_regnum): Also mention effect on delay slot filling. + * doc/tm.texi: Regenerate. +- * sched-rgn.c (can_schedule_ready_p): Use the new hook. +- * config/rs6000/rs6000.c (TARGET_SCHED_CAN_SPECULATE_INSN): New macro. +- (rs6000_sched_can_speculate_insn): New function. +- +-2017-02-06 Jakub Jelinek +- +- PR tree-optimization/79284 +- * tree-vectorizer.h (VECT_SCALAR_BOOLEAN_TYPE_P): Define. +- * tree-vect-stmts.c (vect_get_vec_def_for_operand, +- vectorizable_mask_load_store, vectorizable_operation, +- vect_is_simple_cond, get_same_sized_vectype): Use it instead +- of comparing TREE_CODE of a type against BOOLEAN_TYPE. +- * tree-vect-patterns.c (check_bool_pattern, search_type_for_mask_1, +- vect_recog_bool_pattern, vect_recog_mask_conversion_pattern): Likewise. +- * tree-vect-slp.c (vect_get_constant_vectors): Likewise. +- * tree-vect-loop.c (vect_determine_vectorization_factor): Likewise. +- Remove redundant gimple_code (stmt) =3D=3D GIMPLE_ASSIGN test after +- is_gimple_assign (stmt). Replace another such test with +- is_gimple_assign (stmt). +- +-2017-02-06 Georg-Johann Lay +- +- PR target/78883 +- * config/avr/avr.c (rtl-iter.h): Include it. +- (TARGET_LEGITIMATE_COMBINED_INSN): New hook define... +- (avr_legitimate_combined_insn): ...and implementation. +- +-2017-02-06 Dominik Vogt +- +- * config/s390/predicates.md ("larl_operand"): Use macros from hwint.h. +- * config/s390/s390.c (s390_const_operand_ok) +- (s390_canonicalize_comparison, s390_extract_part) +- (s390_single_part, s390_contiguous_bitmask_nowrap_p) +- (s390_contiguous_bitmask_p, s390_rtx_costs) +- (legitimize_pic_address): Likewise. +- * config/s390/s390.md ("clzdi2", "clztidi2"): Likewise. +- * config/s390/vx-builtins.md ("vec_genbytemaskv16qi") +- ("vec_permi", "vfae", "*vfaes", "vstrc") +- ("*vstrcs"): Use UINTVAL() to set unsigned HOST_WIDE_INT. +- * config/s390/vector.md ("vec_vfenes"): Likewise. +- +-2017-02-06 Georg-Johann Lay +- +- * config/avr/avr.md (*addhi3_zero_extend): Add alternative where +- REGNO($0) =3D=3D REGNO($1). +=20 +-2017-02-06 Andreas Krebbel +- +- * config/s390/linux.h(SIZE_TYPE): Add comment. ++2020-01-23 Jeff Law +=20 +-2017-02-06 Julian Brown +- Naveen H.S +- Virendra Pathak ++ * config/h8300/h8300.c (h8300_option_override): Fix diagnostic text. +=20 +- * config/aarch64/aarch64-cores.def: Change the scheduler +- to Thunderx2t99. +- * config/aarch64/aarch64.md: Include thunderx2t99.md. +- * config/aarch64/thunderx2t99.md: New file. ++2020-01-23 Mikael Tillenius +=20 +-2017-02-05 Gerald Pfeifer ++ * config/h8300/h8300.h (FUNCTION_PROFILER): Fix emission of ++ profiling label +=20 +- * doc/standards.texi (Go Language): Update link to language +- standard. ++2020-01-23 Jakub Jelinek +=20 +-2017-02-05 Jan Hubicka ++ PR rtl-optimization/93402 ++ * postreload.c (reload_combine_recognize_pattern): Don't try to adjust ++ USE insns. +=20 +- * tree-eh.c (lower_resx): Sanitize profile. +- (cleanup_empty_eh_move_lp): Likewise. ++2020-01-23 Dragan Mladjenovic +=20 +-2017-02-05 Jan Hubicka ++ * config.in: Regenerated. ++ * config/mips/linux.h (NEED_INDICATE_EXEC_STACK): Define to 1 ++ for TARGET_LIBC_GNUSTACK. ++ * configure: Regenerated. ++ * configure.ac: Define TARGET_LIBC_GNUSTACK if glibc version is ++ found to be 2.31 or greater. +=20 +- PR tree-ssa/79347 +- * cfgloopmanip.c (lv_adjust_loop_entry_edge, loop_version): Add +- ELSE_PROB. +- * cfgloopmanip.h (loop_version): Update prototype. +- * modulo-sched.c (sms_schedule): Update call of loop_version. +- * tree-if-conv.c(version_loop_for_if_conversion): Likewise. +- * tree-parloops.c (gen_parallel_loop): Likewise. +- * tree-ssa-loop-manip.c (tree_transform_and_unroll_loop): Likewise. +- * tree-ssa-loop-split.c (split_loop): Likewise. +- * tree-ssa-loop-unswitch.c (tree_unswitch_loop): Likewise. +- * tree-vect-loop-manip.c (vect_loop_versioning): Likewise. +- +-2017-02-05 Martin Liska +- +- PR bootstrap/78985 +- * config/s390/s390.c (s390_gimplify_va_arg): Initialize local +- variable to NULL. +- (print_operand_address): Initialize a struct to zero. +- +-2017-02-05 Gerald Pfeifer +- +- * doc/contrib.texi (Contributors): Refer to Hans Boehm's +- garbage collector only in textual form. ++2020-01-23 Dragan Mladjenovic +=20 +-2017-02-05 Gerald Pfeifer +-=09 +- * doc/extend.texi (x86 specific memory model extensions for +- transactional memory): Simplify a phrase. ++ * config/mips/linux.h (NEED_INDICATE_EXEC_STACK): Define to ++ TARGET_SOFT_FLOAT. ++ * config/mips/mips.c (TARGET_ASM_FILE_END): Define to ... ++ (mips_asm_file_end): New function. Delegate to ++ file_end_indicate_exec_stack if NEED_INDICATE_EXEC_STACK is true. ++ * config/mips/mips.h (NEED_INDICATE_EXEC_STACK): Define to 0. +=20 +-2017-02-05 Eric Botcazou ++2020-01-23 Jakub Jelinek +=20 +- PR target/79353 +- * config/sparc/sync.md (atomic_loaddi_1): Replace 'U' constraint with +- 'r', 'm' constraint with 'T' and !TARGET_ARCH64 with TARGET_ARCH32. +- (atomic_storedi_1): Likewise. ++ PR target/93376 ++ * config/i386/i386-modes.def (POImode): New mode. ++ (MAX_BITSIZE_MODE_ANY_INT): Change from 128 to 160. ++ * config/i386/i386.md (DPWI): New mode attribute. ++ (addv4, subv4): Use instead of . ++ (QWI): Rename to... ++ (QPWI): ... this. Use POI instead of OI for TImode. ++ (*addv4_doubleword, *addv4_doubleword_1, ++ *subv4_doubleword, *subv4_doubleword_1): Use ++ instead of . +=20 +-2017-02-04 Jakub Jelinek ++2020-01-23 Richard Sandiford +=20 +- PR tree-optimization/79338 +- * tree-parloops.c (gather_scalar_reductions): Don't call +- vect_analyze_loop_form for loop->inner before destroying loop's +- loop_vinfo. ++ PR target/93341 ++ * config/aarch64/aarch64.md (UNSPEC_SPECULATION_TRACKER_REV): New ++ unspec. ++ (speculation_tracker_rev): New pattern. ++ * config/aarch64/aarch64-speculation.cc (aarch64_do_track_speculation): ++ Use speculation_tracker_rev to track the inverse condition. +=20 +-2017-02-03 Martin Sebor ++2020-01-23 Richard Biener +=20 +- PR tree-optimization/79327 +- * gimple-ssa-sprintf.c (tree_digits): Avoid adding the base prefix +- when precision has resulted in leading zeros. +- (format_integer): Adjust the likely counter to assume an unknown +- argument that may be zero is non-zero. ++ PR tree-optimization/93381 ++ * tree-ssa-sccvn.c (vn_walk_cb_data::push_partial_def): Take ++ alias-set of the def as argument and record the first one. ++ (vn_walk_cb_data::first_set): New member. ++ (vn_reference_lookup_3): Pass the alias-set of the current def ++ to push_partial_def. Fix alias-set used in the aggregate copy ++ case. ++ (vn_reference_lookup): Consistently set *last_vuse_ptr. ++ * real.c (clear_significand_below): Fix out-of-bound access. +=20 +-2017-02-03 Jason Merrill ++2020-01-23 Jakub Jelinek +=20 +- PR c++/78689 +- * tree-inline.c (copy_tree_body_r) [COND_EXPR]: Revert change to +- avoid copying non-taken branch. ++ PR target/93346 ++ * config/i386/i386.md (*bmi2_bzhi_3_2, *bmi2_bzhi_3_3): ++ New define_insn patterns. +=20 +-2017-02-03 Jakub Jelinek ++2020-01-23 Richard Sandiford +=20 +- PR tree-optimization/79340 +- * tree-vect-loop.c (vectorizable_reduction): Release +- vec_defs elements after safe_splicing them into other vectors. +- Formatting fixes. ++ * doc/sourcebuild.texi (check-function-bodies): Add an ++ optional target/xfail selector. +=20 +- PR tree-optimization/79327 +- * gimple-ssa-sprintf.c (adjust_range_for_overflow): If returning +- true, always set *argmin and *argmax to TYPE_{MIN,MAX}_VALUE of +- dirtype. +- (format_integer): Use wide_int_to_tree instead of build_int_cst +- + to_?hwi. If argmin is NULL, just set argmin and argmax to +- TYPE_{MIN,MAX}_VALUE of argtype. Simplify and fix computation +- of shortest and longest sequence. ++2020-01-23 Richard Sandiford +=20 +-2017-02-03 Uros Bizjak ++ PR rtl-optimization/93124 ++ * auto-inc-dec.c (merge_in_block): Don't add auto inc/decs to ++ bare USE and CLOBBER insns. +=20 +- * config/i386/i386.c (dimode_scalar_chain::convert_reg): +- Use pextrd for TARGET_SSE4_1 when creating scalar copy. ++2020-01-22 Andrew Pinski +=20 +-2017-02-03 Walter Lee ++ * config/arc/arc.c (output_short_suffix): Check insn for nullness. +=20 +- PR target/78862 +- * config/tilegx/tilegx.md (tilegx_expand_prologue): Add blockage +- after initial stackframe link reg save. +- * config/tilepro/tilepro.md (tilepro_expand_prologue): Likewise. ++2020-01-22 David Malcolm +=20 +-2017-02-03 Jakub Jelinek ++ PR analyzer/93307 ++ * gdbinit.in (break-on-saved-diagnostic): Update for move of ++ diagnostic_manager into "ana" namespace. ++ * selftest-run-tests.c (selftest::run_tests): Update for move of ++ selftest::run_analyzer_selftests to ++ ana::selftest::run_analyzer_selftests. +=20 +- PR target/79354 +- * config/rs6000/rs6000.md (movsi_from_sf): Use wb constraint instead of +- wu for stxssp alternative. ++2020-01-22 Richard Sandiford +=20 +-2017-02-03 Martin Sebor ++ * cfgexpand.c (union_stack_vars): Update the size. +=20 +- PR tree-optimization/79352 +- * gimple-fold.c (get_range_strlen): Add argument. +- (get_range_strlen): Change return type to bool. +- (get_maxval_strlen): Pass in a dummy argument. +- * gimple-fold.h (get_range_strlen): Change return type to bool. +- * gimple-ssa-sprintf.c (get_string_length): Set unlikely counter. +- * tree.h (array_at_struct_end_p): Add argument. +- * tree.c (array_at_struct_end_p): Handle it. ++2020-01-22 Richard Biener +=20 +-2017-02-03 Martin Liska ++ PR tree-optimization/93381 ++ * tree-ssa-structalias.c (find_func_aliases): Assume offsetting ++ throughout, handle all conversions the same. +=20 +- PR lto/66295 +- * multiple_target.c (create_dispatcher_calls): Redirect edge +- from a caller of a dispatcher. +- (expand_target_clones): Make the clones local. +- (ipa_target_clone): Do both target clones and resolvers. +- (ipa_dispatcher_calls): Remove the pass. +- (pass_dispatcher_calls::gate): Likewise. +- (make_pass_dispatcher_calls): Likewise. +- * passes.def (pass_target_clone): Put as very first IPA early +- pass. ++2020-01-22 Jakub Jelinek +=20 +-2017-02-03 Martin Liska ++ PR target/93335 ++ * config/aarch64/aarch64.c (aarch64_expand_subvti): Only use ++ gen_subdi3_compare1_imm if low_in2 satisfies aarch64_plus_immediate ++ predicate, not whenever it is CONST_INT. Otherwise, force_reg it. ++ Call force_reg on high_in2 unconditionally. +=20 +- * symtab.c (symtab_node::binds_to_current_def_p): Bail out +- in case of a function with ifunc attribute. ++2020-01-22 Martin Liska +=20 +-2017-02-03 Martin Liska ++ PR tree-optimization/92924 ++ * profile.c (compute_value_histograms): Divide ++ all counter values. +=20 +- * cgraph.c (cgraph_node::dump): Dump function version info. +- * symtab.c (symtab_node::dump_base): Add missing new line. ++2020-01-22 Jakub Jelinek +=20 +-2017-02-02 Jan Hubicka ++ PR target/91298 ++ * output.h (assemble_name_resolve): Declare. ++ * varasm.c (assemble_name_resolve): New function. ++ (assemble_name): Use it. ++ * config/i386/i386.h (ASM_OUTPUT_SYMBOL_REF): Define. +=20 +- * tree-ssa-ifcombine.c (update_profile_after_ifcombine): New function. +- (ifcombine_ifandif): Use it. ++2020-01-22 Joseph Myers +=20 +-2017-02-03 Martin Liska ++ * doc/sourcebuild.texi (Texinfo Manuals, Front End): Refer to ++ update_web_docs_git instead of update_web_docs_svn. +=20 +- * doc/invoke.texi: Document default value for +- use-after-scope-direct-emission-threshold. ++2020-01-21 Andrew Pinski +=20 +-2017-02-03 Martin Liska ++ PR target/9311 ++ * config/aarch64/aarch64.md (tlsgd_small_): Have operand 0 ++ as PTR mode. Have operand 1 as being modeless, it can be P mode. ++ (*tlsgd_small_): Likewise. ++ * config/aarch64/aarch64.c (aarch64_load_symref_appropriately) ++ : Call gen_tlsgd_small_* with a ptr_mode ++ register. Convert that register back to dest using convert_mode. +=20 +- PR tree-optimization/79339 +- * gimple-ssa-sprintf.c (format_floating_max): Call mpfr_clear. +- (format_floating): Likewise. ++2020-01-21 Jim Wilson +=20 +-2017-02-03 Martin Liska ++ * config/riscv/riscv-sr.c (riscv_sr_match_prologue): Use INTVAL ++ instead of XINT. +=20 +- PR ipa/79337 +- * ipa-prop.c (ipa_node_params_t::insert): Remove current +- implementation. +- (ipa_node_params_t::remove): Likewise. +- * ipa-prop.h (ipa_node_params::ipa_node_params): Make default +- initialization from removed ipa_node_params_t::insert. +- (ipa_node_params::~ipa_node_params): Move from removed +- ipa_node_params_t::release. +- * symbol-summary.h (symbol_summary::m_released): New member. +- Do not release a summary twice. Do not allow to call finalizer +- for types of a summary that live in GGC memory. ++2020-01-21 H.J. Lu ++ Uros Bizjak +=20 +-2017-02-02 Naveen H.S ++ PR target/93319 ++ * config/i386/i386.c (ix86_tls_module_base): Replace Pmode ++ with ptr_mode. ++ (legitimize_tls_address): Do GNU2 TLS address computation in ++ ptr_mode and zero-extend result to Pmode. ++ * config/i386/i386.md (@tls_dynamic_gnu2_64_): Replace ++ :P with :PTR and Pmode with ptr_mode. ++ (*tls_dynamic_gnu2_lea_64_): Likewise. ++ (*tls_dynamic_gnu2_call_64_): Likewise. ++ (*tls_dynamic_gnu2_combine_64_): Likewise. +=20 +- * config/aarch64/aarch64.c (thunderx2t99_tunings): Enable AES and +- cmp_branch fusion. +- +-2017-02-02 Martin Sebor +- +- PR middle-end/79275 +- * gimple-ssa-sprintf.c (get_string_length): Set lower bound to zero. +- (format_string): Tighten up the range of output for non-constant +- strings and correct the expected range for wide non-constant strings. +- +-2017-02-02 Martin Sebor ++2020-01-21 Jakub Jelinek +=20 +- * doc/invoke.texi (-maccumulate-args): Fix bad grammar. ++ PR target/93333 ++ * config/riscv/riscv.c (riscv_rtx_costs) : Verify ++ the last two operands are CONST_INT_P before using them as such. +=20 +- PR middle-end/32003 +- * doc/invoke.texi (-fdump-tree-): Remove pass-specific options from +- index. +- (-fdump-tree-@var): Add to index and document how to come up +- with pass-specific option and dump file names. +- (-fdump-passes): Clarify where to look for output. ++2020-01-21 Richard Sandiford +=20 +-2017-02-02 Jan Hubicka ++ * config/aarch64/aarch64-sve-builtins.def: Use get_typenode_from_name ++ to get the integer element types. +=20 +- PR middle-end/77445 +- * tree-ssa-threadbackward.c (profitable_jump_thread_path): Dump +- statistics of the analyzed path; allow threading for speed when +- any of BBs along the path are optimized for speed. ++2020-01-21 Richard Sandiford +=20 +-2017-02-02 Eric Botcazou ++ * config/aarch64/aarch64-sve-builtins.h ++ (function_expander::convert_to_pmode): Declare. ++ * config/aarch64/aarch64-sve-builtins.cc ++ (function_expander::convert_to_pmode): New function. ++ (function_expander::get_contiguous_base): Use it. ++ (function_expander::prepare_gather_address_operands): Likewise. ++ * config/aarch64/aarch64-sve-builtins-sve2.cc ++ (svwhilerw_svwhilewr_impl::expand): Likewise. +=20 +- PR middle-end/78468 +- * emit-rtl.c (init_emit): Add ??? comment for problematic alignment +- settings of the virtual registers. ++2020-01-21 Szabolcs Nagy +=20 +- Revert again +- 2016-08-23 Dominik Vogt ++ PR target/92424 ++ * config/aarch64/aarch64.c (aarch64_declare_function_name): Set ++ cfun->machine->label_is_assembled. ++ (aarch64_print_patchable_function_entry): New. ++ (TARGET_ASM_PRINT_PATCHABLE_FUNCTION_ENTRY): Define. ++ * config/aarch64/aarch64.h (struct machine_function): New field, ++ label_is_assembled. +=20 +- * explow.c (get_dynamic_stack_size): Take known alignment of stack +- pointer + STACK_DYNAMIC_OFFSET into account when calculating the size +- needed. ++2020-01-21 David Malcolm +=20 +-2017-02-02 Andreas Krebbel ++ PR ipa/93315 ++ * ipa-profile.c (ipa_profile): Delete call_sums and set it to ++ NULL on exit. +=20 +- * config/s390/vx-builtins.md ("vec_ceil", "vec_floor") +- ("vec_trunc", "vec_roundc", "vec_round"): Remove expanders. ++2020-01-18 Jan Hubicka +=20 +-2017-02-02 Andreas Krebbel ++ PR lto/93318=09 ++ * cgraph.c (cgraph_edge::resolve_speculation, ++ cgraph_edge::redirect_call_stmt_to_callee): Fix update of ++ call_stmt_site_hash. +=20 +- * config/s390/s390.md: Add missing comments with the expanded +- mnemonics. +- * config/s390/vector.md: Likewise. +- * config/s390/vx-builtins.md: Likewise. ++2020-01-21 Martin Liska +=20 +-2017-02-02 Jakub Jelinek ++ * config/rs6000/rs6000.c (common_mode_defined): Remove ++ unused variable. +=20 +- PR target/79197 +- * config/rs6000/rs6000.md (*fixuns_truncdi2_fctiduz): Rename to ... +- (fixuns_truncdi2): ... this, remove previous expander. Put all +- conditions on a single line. ++2020-01-21 Richard Biener +=20 +-2017-02-02 Andreas Krebbel ++ PR tree-optimization/92328 ++ * tree-ssa-sccvn.c (vn_reference_lookup_3): Preserve ++ type when value-numbering same-sized store by inserting a ++ VIEW_CONVERT_EXPR. ++ (eliminate_dom_walker::eliminate_stmt): When eliminating ++ a redundant store handle bit-reinterpretation of the same value. +=20 +- * config/s390/s390-c.c (s390_cpu_cpp_builtins_internal): Rename +- __S390_VX__ to __VX__. ++2020-01-21 Andrew Pinski +=20 +-2017-02-01 Andrew Pinski +- +- * tree-vect-loop.c (vect_compute_single_scalar_iteration_cost): Pass +- stmt_info to record_stmt_cost. +- (vect_get_known_peeling_cost): Pass stmt_info if known to +- record_stmt_cost. +- * config/aarch64/aarch64-protos.h (cpu_vector_cost): Split +- cpu_vector_cost field into +- scalar_int_stmt_cost and scalar_fp_stmt_cost. Split vec_stmt_cost +- field into vec_int_stmt_cost and vec_fp_stmt_cost. +- * config/aarch64/aarch64.c (generic_vector_cost): Update for the +- splitting of scalar_stmt_cost and vec_stmt_cost. +- (thunderx_vector_cost): Likewise. +- (cortexa57_vector_cost): LIkewise. +- (exynosm1_vector_cost): Likewise. +- (xgene1_vector_cost): Likewise. +- (thunderx2t99_vector_cost): Improve after the splitting of the two +- fields. +- (aarch64_builtin_vectorization_cost): Update for the splitting of +- scalar_stmt_cost and vec_stmt_cost. +- +-2017-02-01 Torvald Riegel +- Richard Henderson +- +- * builtins.c (fold_builtin_atomic_always_lock_free): Make "lock-free" +- conditional on existance of a fast atomic load. +- * optabs-query.c (can_atomic_load_p): New function. +- * optabs-query.h (can_atomic_load_p): Declare it. +- * optabs.c (expand_atomic_exchange): Always delegate to libatomic if +- no fast atomic load is available for the particular size of access. +- (expand_atomic_compare_and_swap): Likewise. +- (expand_atomic_load): Likewise. +- (expand_atomic_store): Likewise. +- (expand_atomic_fetch_op): Likewise. +- * testsuite/lib/target-supports.exp +- (check_effective_target_sync_int_128): Remove x86 because it provides +- no fast atomic load. +- (check_effective_target_sync_int_128_runtime): Likewise. +- +-2017-02-01 Richard Biener +- +- * graphite.c: Include tree-vectorizer.h for find_loop_location. +- (graphite_transform_loops): Provide opt-info for optimized nests. +- * tree-parloop.c (parallelize_loops): Provide opt-info for +- parallelized loops. +- +-2017-02-01 Richard Biener +- +- PR middle-end/79315 +- * tree-cfg.c (move_stmt_op): Never set TREE_BLOCK when it +- was not set before. +- +-2017-02-01 Richard Biener +- +- PR tree-optimization/71824 +- * graphite-scop-detection.c (scop_detection::build_scop_breadth): +- Verify the loops are valid in the merged SESE region. +- (scop_detection::can_represent_loop_1): Check analyzing the +- evolution of the number of iterations in the region succeeds. +- +-2017-01-31 Ian Lance Taylor +- +- * config/i386/i386.c (ix86_expand_split_stack_prologue): Add +- REG_ARGS_SIZE note to 32-bit push insns and call insn. +- +-2017-01-31 David Malcolm +- +- PR preprocessor/79210 +- * input.c (get_substring_ranges_for_loc): Replace line_width +- assertion with error-handling. +- +-2017-01-31 Richard Biener +- +- PR tree-optimization/77318 +- * graphite-sese-to-poly.c (extract_affine): Fix assert. +- (create_pw_aff_from_tree): Take loop parameter. +- (add_condition_to_pbb): Pass loop of the condition to +- create_pw_aff_from_tree. +- +-2017-01-31 Jakub Jelinek +- +- * config/s390/s390.c (s390_asan_shadow_offset): New function. +- (TARGET_ASAN_SHADOW_OFFSET): Redefine. +- +-2017-01-31 Michael Meissner +- +- PR target/78597 +- PR target/79038 +- * config/rs6000/rs6000-protos.h (convert_float128_to_int): Delete, +- no longer used. +- (convert_int_to_float128): Likewise. +- * config/rs6000/rs6000.c (convert_float128_to_int): Likewise. +- (convert_int_to_float128): Likewise. +- * config/rs6000/rs6000.md (UNSPEC_IEEE128_MOVE): Likewise. +- (UNSPEC_IEEE128_CONVERT): Likewise. +- (floatsi2, FLOAT128 iterator): Bypass calling +- rs6000_expand_float128_convert if we have IEEE 128-bit hardware. +- Use local variables for IBM extended format. +- (fix_truncsi2, FLOAT128 iterator): Likewise. +- (fix_truncsi2_fprs): Likewise. +- (fixuns_trunc2): Likewise. +- (floatuns2, IEEE128 iterator): Likewise. +- (fix_si2_hw): Rework the IEEE 128-bt hardware support +- to know that we can now have integers of all sizes in vector +- registers. +- (fix_di2_hw): Likewise. +- (float_si2_hw): Likewise. +- (fix_si2_hw): Likewise. +- (fixuns_si2_hw): Likewise. +- (float_di2_hw): Likewise. +- (float_di2_hw): Likewise. +- (float_si2_hw): Likewise. +- (floatuns_di2_hw): Likewise. +- (floatuns_si2_hw): Likewise. +- (xscvqpwz_): Delete, no longer used. +- (xscvqpdz_): Likewise. +- (xscvdqp_): Likewise. +- (ieee128_mfvsrd_64bit): Likewise. +- (ieee128_mfvsrd_32bit): Likewise. +- (ieee128_mfvsrwz): Likewise. +- (ieee128_mtvsrw): Likewise. +- (ieee128_mtvsrd_64bit): Likewise. +- (ieee128_mtvsrd_32bit): Likewise. +- +-2017-01-31 Martin Liska +- +- PR ipa/79285 +- * ipa-prop.c (ipa_free_all_node_params): Call release method +- instead of ~sumbol_summary to not to trigger double times +- dtor of hash_map. +- +-2017-01-31 Aldy Hernandez +- +- PR tree-optimization/71691 +- * bitmap.h (class auto_bitmap): New. +- * tree-ssa-loop-unswitch.c (tree_may_unswitch_on): Call +- is_maybe_undefined instead of ssa_undefined_value_p. +- +-2017-01-31 Andreas Krebbel +- +- * config/s390/s390-c.c (s390_cpu_cpp_builtins_internal): Rename +- __S390_ARCH_LEVEL__ to __ARCH__. +- +-2017-01-31 Jakub Jelinek +- +- PR tree-optimization/79267 +- * value-prof.c (gimple_ic): Only drop lhs for noreturn calls +- if should_remove_lhs_p is true. +- +-2017-01-30 Alexandre Oliva +- +- PR debug/63238 +- * dwarf2out.c (clone_as_declaration): Drop DW_AT_alignment. +- (add_alignment_attribute): New. +- (base_type_die): Add alignment attribute. +- (subrange_type_die): Likewise. +- (modified_type_die): Likewise. +- (gen_array_type_die): Likewise. +- (gen_descr_array_type_die: Likewise. +- (gen_enumeration_type_die): Likewise. +- (gen_subprogram_die): Likewise. +- (gen_variable_die): Likewise. +- (gen_field_die): Likewise. +- (gen_ptr_to_mbr_type_die): Likewise. +- (gen_struct_or_union_type_die): Likewise. +- (gen_subroutine_type_die): Likewise. +- (gen_typedef_die): Likewise. +- (base_type_cmp): Compare alignment attribute. +- +-2017-01-30 Aaron Sawdey +- +- PR target/79170 +- * config/rs6000/altivec.md (*setb_internal): Rename to setb_signed. +- (setb_unsigned) New pattern for setb with CCUNS. +- * config/rs6000/rs6000.c (expand_block_compare): Use a different +- subfc./subfe sequence to avoid overflow problems. Generate a +- shorter sequence with cmpld/setb for power9. +- * config/rs6000/rs6000.md (subf3_carry_dot2): Add a new pattern +- for generating subfc. instruction. +- (cmpstrsi): Add TARGET_POPCNTD predicate as the generate sequence +- now uses this instruction. +- +-2017-01-30 Ian Lance Taylor +- +- PR debug/79289 +- * dwarf2out.c (gen_type_die_with_usage): When picking a variant +- for FUNCTION_TYPE/METHOD_TYPE, use the first matching one. +- +-2017-01-30 Martin Sebor +- +- * gimple-ssa-sprintf.c (fmtresult::adjust_for_width_or_precision): +- Move constant to the right of a relational operator. +- (get_mpfr_format_length, format_character, format_string): Ditto. +- (should_warn_p, maybe_warn): Same. +- +- * doc/invoke.texi (-Wformat-truncation=3D1): Fix typo. ++ PR tree-opt/93321 ++ * tree-into-ssa.c (prepare_block_for_update_1): Split out ++ from ... ++ (prepare_block_for_update): This. Use a worklist instead of ++ recursing. +=20 +-2017-01-30 Maxim Ostapenko ++2020-01-21 Mihail-Calin Ionescu +=20 +- PR lto/79061 +- * asan.c (get_translation_unit_decl): Remove function. +- (asan_add_global): Force has_dynamic_init to zero in LTO mode. ++ * gcc/config/arm/arm.c (clear_operation_p): ++ Initialise last_regno, skip first iteration ++ based on the first_set value and use ints instead ++ of the unnecessary HOST_WIDE_INTs. +=20 +-2017-01-30 Martin Liska ++2020-01-21 Jakub Jelinek +=20 +- PR gcov-profile/79259 +- * opts.c (common_handle_option): Enable flag_ipa_bit_cp w/ +- -fprofile-generate. ++ PR target/93073 ++ * config/rs6000/rs6000.c (rs6000_emit_cmove): If using fsel, punt for ++ compare_mode other than SFmode or DFmode. +=20 +-2017-01-30 Martin Liska ++2020-01-21 Kito Cheng +=20 +- PR bootstrap/78985 +- * config/aarch64/cortex-a57-fma-steering.c (func_fma_steering::analyze): +- Initialize variables with NULL value. ++ PR target/93304 ++ * config/riscv/riscv-protos.h (riscv_hard_regno_rename_ok): New. ++ * config/riscv/riscv.c (riscv_hard_regno_rename_ok): New. ++ * config/riscv/riscv.h (HARD_REGNO_RENAME_OK): Defined. ++ ++2020-01-20 Wilco Dijkstra ++ ++ * config/aarch64/aarch64.c (neoversen1_tunings): Set jump_align to 4. ++ ++2020-01-20 Andrew Pinski +=20 +-2017-01-30 Richard Earnshaw ++ PR middle-end/93242 ++ * targhooks.c (default_print_patchable_function_entry): Use ++ output_asm_insn to emit the nop instruction. +=20 +- PR target/79260 +- * config.gcc (arm*-*-*): Add arm/arm-flags.h and arm/arm-isa.h to +- tm_p_file. +- * arm/arm-protos.h: Don't directly include arm-flags.h and arm-isa.h. ++2020-01-20 Fangrui Song +=20 +-2017-01-30 Richard Biener ++ PR middle-end/93194 ++ * targhooks.c (default_print_patchable_function_entry): Align to ++ POINTER_SIZE. +=20 +- PR tree-optimization/79276 +- * tree-vrp.c (process_assert_insertions): Properly adjust common +- when removing a duplicate. ++2020-01-20 H.J. Lu +=20 +-2017-01-30 Richard Biener ++ PR target/93319 ++ * config/i386/i386.c (legitimize_tls_address): Pass Pmode to ++ gen_tls_dynamic_gnu2_64. Compute GNU2 TLS address in ptr_mode. ++ * config/i386/i386.md (tls_dynamic_gnu2_64): Renamed to ... ++ (@tls_dynamic_gnu2_64_): This. Replace DI with P. ++ (*tls_dynamic_gnu2_lea_64): Renamed to ... ++ (*tls_dynamic_gnu2_lea_64_): This. Replace DI with P. ++ Remove the {q} suffix from lea. ++ (*tls_dynamic_gnu2_call_64): Renamed to ... ++ (*tls_dynamic_gnu2_call_64_): This. Replace DI with P. ++ (*tls_dynamic_gnu2_combine_64): Renamed to ... ++ (*tls_dynamic_gnu2_combine_64_): This. Replace DI with P. ++ Pass Pmode to gen_tls_dynamic_gnu2_64. +=20 +- PR tree-optimization/79256 +- * targhooks.c (default_builtin_vector_alignment_reachable): Honor +- BIGGEST_FIELD_ALIGNMENT and ADJUST_FIELD_ALIGN to fix up bogus +- alignment on TYPE. +- * tree.c (build_aligned_type): Set TYPE_USER_ALIGN. ++2020-01-20 Wilco Dijkstra +=20 +-2017-01-30 Dominik Vogt ++ * config/aarch64/aarch64.h (SLOW_BYTE_ACCESS): Set to 1. ++ ++2020-01-20 Richard Sandiford ++ ++ * config/aarch64/aarch64-sve-builtins-base.cc ++ (svld1ro_impl::memory_vector_mode): Remove parameter name. ++ ++2020-01-20 Richard Biener ++ ++ PR debug/92763 ++ * dwarf2out.c (prune_unused_types): Unconditionally mark ++ called function DIEs. +=20 +- PR target/79240 +- * config/s390/s390.md ("*rsbg__srl_bitmask") +- ("*rsbg__sll_bitmask") +- ("*extzv__srl") +- ("*extzv__sll"): +- Use contiguous_bitmask_nowrap_operand. ++2020-01-20 Martin Liska ++ ++ PR tree-optimization/93199 ++ * tree-eh.c (struct leh_state): Add ++ new field outer_non_cleanup. ++ (cleanup_is_dead_in): Pass leh_state instead ++ of eh_region. Add a checking that state->outer_non_cleanup ++ points to outer non-clean up region. ++ (lower_try_finally): Record outer_non_cleanup ++ for this_state. ++ (lower_catch): Likewise. ++ (lower_eh_filter): Likewise. ++ (lower_eh_must_not_throw): Likewise. ++ (lower_cleanup): Likewise. ++ ++2020-01-20 Richard Biener ++ ++ PR tree-optimization/93094 ++ * tree-vectorizer.h (vect_loop_versioning): Adjust. ++ (vect_transform_loop): Likewise. ++ * tree-vectorizer.c (try_vectorize_loop_1): Pass down ++ loop_vectorized_call to vect_transform_loop. ++ * tree-vect-loop.c (vect_transform_loop): Pass down ++ loop_vectorized_call to vect_loop_versioning. ++ * tree-vect-loop-manip.c (vect_loop_versioning): Use ++ the earlier discovered loop_vectorized_call. ++ ++2020-01-19 Eric S. Raymond ++ ++ * doc/contribute.texi: Update for SVN -> Git transition. ++ * doc/install.texi: Likewise. ++ ++2020-01-18 Jan Hubicka ++ ++ PR lto/93318 ++ * cgraph.c (cgraph_edge::make_speculative): Increase number of ++ speculative targets. ++ (verify_speculative_call): New function ++ (cgraph_node::verify_node): Use it. ++ * ipa-profile.c (ipa_profile): Fix formating; do not set number of ++ speculations. ++ ++2020-01-18 Jan Hubicka ++ ++ PR lto/93318 ++ * cgraph.c (cgraph_edge::resolve_speculation): Fix foramting. ++ (cgraph_edge::make_direct): Remove all indirect targets. ++ (cgraph_edge::redirect_call_stmt_to_callee): Use make_direct.. ++ (cgraph_node::verify_node): Verify that only one call_stmt or ++ lto_stmt_uid is set. ++ * cgraphclones.c (cgraph_edge::clone): Set only one call_stmt or ++ lto_stmt_uid. ++ * lto-cgraph.c (lto_output_edge): Simplify streaming of stmt. ++ (lto_output_ref): Simplify streaming of stmt. ++ * lto-streamer-in.c (fixup_call_stmt_edges_1): Clear lto_stmt_uid. ++ ++2020-01-18 Tamar Christina ++ ++ * config/aarch64/aarch64-sve-builtins-base.cc (memory_vector_mode): ++ Mark parameter unused. ++ ++2020-01-18 Hans-Peter Nilsson ++ ++ * config.gcc : Add crisv32-*-* and cris-*-linux* ++ ++2019-01-18 Gerald Pfeifer ++ ++ * varpool.c (ctor_useable_for_folding_p): Fix grammar. ++ ++2020-01-18 Iain Sandoe ++ ++ * Makefile.in: Add coroutine-passes.o. ++ * builtin-types.def (BT_CONST_SIZE): New. ++ (BT_FN_BOOL_PTR): New. ++ (BT_FN_PTR_PTR_CONST_SIZE_BOOL): New. ++ * builtins.def (DEF_COROUTINE_BUILTIN): New. ++ * coroutine-builtins.def: New file. ++ * coroutine-passes.cc: New file. ++ * function.h (struct GTY function): Add a bit to indicate that the ++ function is a coroutine component. ++ * internal-fn.c (expand_CO_FRAME): New. ++ (expand_CO_YIELD): New. ++ (expand_CO_SUSPN): New. ++ (expand_CO_ACTOR): New. ++ * internal-fn.def (CO_ACTOR): New. ++ (CO_YIELD): New. ++ (CO_SUSPN): New. ++ (CO_FRAME): New. ++ * passes.def: Add pass_coroutine_lower_builtins, ++ pass_coroutine_early_expand_ifns. ++ * tree-pass.h (make_pass_coroutine_lower_builtins): New. ++ (make_pass_coroutine_early_expand_ifns): New. ++ * doc/invoke.texi: Document the fcoroutines command line ++ switch. ++ ++2020-01-18 Jakub Jelinek ++ ++ * config/arm/vfp.md (*clear_vfp_multiple): Remove unused variable. ++ ++ PR target/93312 ++ * config/arm/arm.c (clear_operation_p): Don't use REGNO until ++ after checking the argument is a REG. Don't use REGNO (reg) ++ again to set last_regno, reuse regno variable instead. ++ ++2020-01-17 David Malcolm ++ ++ * doc/analyzer.texi (Limitations): Add note about NaN. ++ ++2020-01-17 Mihail-Calin Ionescu ++ Sudakshina Das ++ ++ * config/arm/arm.md (ashldi3): Generate thumb2_lsll for both reg ++ and valid immediate. ++ (ashrdi3): Generate thumb2_asrl for both reg and valid immediate. ++ (lshrdi3): Generate thumb2_lsrl for valid immediates. ++ * config/arm/constraints.md (Pg): New. ++ * config/arm/predicates.md (long_shift_imm): New. ++ (arm_reg_or_long_shift_imm): Likewise. ++ * config/arm/thumb2.md (thumb2_asrl): New immediate alternative. ++ (thumb2_lsll): Likewise. ++ (thumb2_lsrl): New. ++ ++2020-01-17 Mihail-Calin Ionescu ++ Sudakshina Das +=20 +-2017-01-29 Bill Schmidt ++ * config/arm/arm.md (ashldi3): Generate thumb2_lsll for TARGET_HAVE_MVE. ++ (ashrdi3): Generate thumb2_asrl for TARGET_HAVE_MVE. ++ * config/arm/arm.c (arm_hard_regno_mode_ok): Allocate even odd ++ register pairs for doubleword quantities for ARMv8.1M-Mainline. ++ * config/arm/thumb2.md (thumb2_asrl): New. ++ (thumb2_lsll): Likewise. ++ ++2020-01-17 Jakub Jelinek ++ ++ * config/arm/arm.c (cmse_nonsecure_call_inline_register_clear): Remove ++ unused variable. ++ ++2020-01-17 Alexander Monakov ++ ++ * gdbinit.in (help-gcc-hooks): New command. ++ (pp, pr, prl, pt, pct, pgg, pgq, pgs, pge, pmz, ptc, pdn, ptn, pdd, prc, ++ pi, pbm, pel, trt): Take $arg0 instead of $ if supplied. Update ++ documentation. ++ ++2020-01-17 Matthew Malcomson ++ ++ * config/aarch64/aarch64-sve.md (@aarch64_sve_ld1ro): Use the ++ correct target macro. +=20 +- PR target/79268 +- * config/rs6000/altivec.h (vec_xl): Revise #define. +- (vec_xst): Likewise. ++2020-01-17 Matthew Malcomson +=20 +-2017-01-27 Uros Bizjak ++ * config/aarch64/aarch64-protos.h ++ (aarch64_sve_ld1ro_operand_p): New. ++ * config/aarch64/aarch64-sve-builtins-base.cc ++ (class load_replicate): New. ++ (class svld1ro_impl): New. ++ (class svld1rq_impl): Change to inherit from load_replicate. ++ (svld1ro): New sve intrinsic function base. ++ * config/aarch64/aarch64-sve-builtins-base.def (svld1ro): ++ New DEF_SVE_FUNCTION. ++ * config/aarch64/aarch64-sve-builtins-base.h ++ (svld1ro): New decl. ++ * config/aarch64/aarch64-sve-builtins.cc ++ (function_expander::add_mem_operand): Modify assert to allow ++ OImode. ++ * config/aarch64/aarch64-sve.md (@aarch64_sve_ld1ro): New ++ pattern. ++ * config/aarch64/aarch64.c ++ (aarch64_sve_ld1rq_operand_p): Implement in terms of ... ++ (aarch64_sve_ld1rq_ld1ro_operand_p): This. ++ (aarch64_sve_ld1ro_operand_p): New. ++ * config/aarch64/aarch64.md (UNSPEC_LD1RO): New unspec. ++ * config/aarch64/constraints.md (UOb,UOh,UOw,UOd): New. ++ * config/aarch64/predicates.md ++ (aarch64_sve_ld1ro_operand_{b,h,w,d}): New. ++ ++2020-01-17 Matthew Malcomson ++ ++ * config/aarch64/aarch64-c.c (_ARM_FEATURE_MATMUL_FLOAT64): ++ Introduce this ACLE specified predefined macro. ++ * config/aarch64/aarch64-option-extensions.def (f64mm): New. ++ (fp): Disabling this disables f64mm. ++ (simd): Disabling this disables f64mm. ++ (fp16): Disabling this disables f64mm. ++ (sve): Disabling this disables f64mm. ++ * config/aarch64/aarch64.h (AARCH64_FL_F64MM): New. ++ (AARCH64_ISA_F64MM): New. ++ (TARGET_F64MM): New. ++ * doc/invoke.texi (f64mm): Document new option. ++ ++2020-01-17 Wilco Dijkstra ++ ++ * config/aarch64/aarch64.c (generic_tunings): Add branch fusion. ++ (neoversen1_tunings): Likewise. ++ ++2020-01-17 Wilco Dijkstra ++ ++ PR target/92692 ++ * config/aarch64/aarch64.c (aarch64_split_compare_and_swap) ++ Add assert to ensure prolog has been emitted. ++ (aarch64_split_atomic_op): Likewise. ++ * config/aarch64/atomics.md (aarch64_compare_and_swap) ++ Use epilogue_completed rather than reload_completed. ++ (aarch64_atomic_exchange): Likewise. ++ (aarch64_atomic_): Likewise. ++ (atomic_nand): Likewise. ++ (aarch64_atomic_fetch_): Likewise. ++ (atomic_fetch_nand): Likewise. ++ (aarch64_atomic__fetch): Likewise. ++ (atomic_nand_fetch): Likewise. ++ ++2020-01-17 Richard Sandiford ++ ++ PR target/93133 ++ * config/aarch64/aarch64.h (REVERSIBLE_CC_MODE): Return false ++ for FP modes. ++ (REVERSE_CONDITION): Delete. ++ * config/aarch64/iterators.md (CC_ONLY): New mode iterator. ++ (CCFP_CCFPE): Likewise. ++ (e): New mode attribute. ++ * config/aarch64/aarch64.md (ccmp): Rename to... ++ (@ccmp): ...this, using CC_ONLY instead of CC. ++ (fccmp, fccmpe): Merge into... ++ (@ccmp): ...this combined pattern. ++ (@ccmp_rev): New pattern. ++ (@ccmp_rev): Likewise. ++ * config/aarch64/aarch64.c (aarch64_gen_compare_reg): Update ++ name of generator from gen_ccmpdi to gen_ccmpccdi. ++ (aarch64_gen_ccmp_next): Use code_for_ccmp. If we want to reverse ++ the previous comparison but aren't able to, use the new ccmp_rev ++ patterns instead. ++ ++2020-01-17 Richard Sandiford ++ ++ * gimplify.c (gimplify_return_expr): Use poly_int_tree_p rather ++ than testing directly for INTEGER_CST. ++ (gimplify_target_expr, gimplify_omp_depend): Likewise. ++ ++2020-01-17 Jakub Jelinek ++ ++ PR tree-optimization/93292 ++ * tree-vect-stmts.c (vectorizable_comparison): Punt also if ++ get_vectype_for_scalar_type returns NULL. ++ ++2020-01-16 Jan Hubicka ++ ++ * params.opt (-param=3Dmax-predicted-iterations): Increase range from 0. ++ * predict.c (estimate_loops): Add 1 to param_max_predicted_iterations. ++ ++2020-01-16 Jan Hubicka ++ ++ * ipa-fnsummary.c (estimate_calls_size_and_time): Fix formating of ++ dump. ++ * params.opt: (max-predicted-iterations): Set bounds. ++ * predict.c (real_almost_one, real_br_prob_base, ++ real_inv_br_prob_base, real_one_half, real_bb_freq_max): Remove. ++ (propagate_freq): Add max_cyclic_prob parameter; cap cyclic ++ probabilities; do not truncate to reg_br_prob_bases. ++ (estimate_loops_at_level): Pass max_cyclic_prob. ++ (estimate_loops): Compute max_cyclic_prob. ++ (estimate_bb_frequencies): Do not initialize real_*; update calculation ++ of back edge prob. ++ * profile-count.c (profile_probability::to_sreal): New. ++ * profile-count.h (class sreal): Move up in file. ++ (profile_probability::to_sreal): Declare. ++ ++2020-01-16 Stam Markianos-Wright ++ ++ * config/arm/arm.c ++ (arm_invalid_conversion): New function for target hook. ++ (arm_invalid_unary_op): New function for target hook. ++ (arm_invalid_binary_op): New function for target hook. ++ ++2020-01-16 Stam Markianos-Wright ++ ++ * config.gcc: Add arm_bf16.h. ++ * config/arm/arm-builtins.c (arm_mangle_builtin_type): Fix comment. ++ (arm_simd_builtin_std_type): Add BFmode. ++ (arm_init_simd_builtin_types): Define element types for vector types. ++ (arm_init_bf16_types): New function. ++ (arm_init_builtins): Add arm_init_bf16_types function call. ++ * config/arm/arm-modes.def: Add BFmode and V4BF, V8BF vector modes. ++ * config/arm/arm-simd-builtin-types.def: Add V4BF, V8BF. ++ * config/arm/arm.c (aapcs_vfp_sub_candidate): Add BFmode. ++ (arm_hard_regno_mode_ok): Add BFmode and tidy up statements. ++ (arm_vector_mode_supported_p): Add V4BF, V8BF. ++ (arm_mangle_type): Add __bf16. ++ * config/arm/arm.h: Add V4BF, V8BF to VALID_NEON_DREG_MODE,=20 ++ VALID_NEON_QREG_MODE respectively. Add export arm_bf16_type_node, ++ arm_bf16_ptr_type_node. ++ * config/arm/arm.md: Add BFmode to movhf expand, mov pattern and ++ define_split between ARM registers. ++ * config/arm/arm_bf16.h: New file. ++ * config/arm/arm_neon.h: Add arm_bf16.h and Bfloat vector types. ++ * config/arm/iterators.md: (ANY64_BF, VDXMOV, VHFBF, HFBF, fporbf): New. ++ (VQXMOV): Add V8BF. ++ * config/arm/neon.md: Add BF vector types to movhf NEON move patterns. ++ * config/arm/vfp.md: Add BFmode to movhf patterns. ++ ++2020-01-16 Mihail Ionescu ++ Andre Vieira ++ ++ * config/arm/arm-cpus.in (mve, mve_float): New features. ++ (dsp, mve, mve.fp): New options. ++ * config/arm/arm.h (TARGET_HAVE_MVE, TARGET_HAVE_MVE_FLOAT): Define. ++ * config/arm/t-rmprofile: Map v8.1-M multilibs to v8-M. ++ * doc/invoke.texi: Document the armv8.1-m mve and dps options. ++ ++2020-01-16 Mihail-Calin Ionescu ++ Thomas Preud'homme ++ ++ * config/arm/arm-cpus.in (ARMv8_1m_main): Redefine as an extension to ++ Armv8-M Mainline. ++ * config/arm/arm.c (arm_options_perform_arch_sanity_checks): Remove ++ error for using -mcmse when targeting Armv8.1-M Mainline. ++ ++2020-01-16 Mihail-Calin Ionescu ++ Thomas Preud'homme ++ ++ * config/arm/arm.md (nonsecure_call_internal): Do not force memory ++ address in r4 when targeting Armv8.1-M Mainline. ++ (nonsecure_call_value_internal): Likewise. ++ * config/arm/thumb2.md (nonsecure_call_reg_thumb2): Make memory address ++ a register match_operand again. Emit BLXNS when targeting ++ Armv8.1-M Mainline. ++ (nonsecure_call_value_reg_thumb2): Likewise. ++ ++2020-01-16 Mihail-Calin Ionescu ++ Thomas Preud'homme ++ ++ * config/arm/arm.c (arm_add_cfa_adjust_cfa_note): Declare early. ++ (cmse_nonsecure_call_inline_register_clear): Define new lazy_fpclear ++ variable as true when floating-point ABI is not hard. Replace ++ check against TARGET_HARD_FLOAT_ABI by checks against lazy_fpclear. ++ Generate VLSTM and VLLDM instruction respectively before and ++ after a function call to cmse_nonsecure_call function. ++ * config/arm/unspecs.md (VUNSPEC_VLSTM): Define unspec. ++ (VUNSPEC_VLLDM): Likewise. ++ * config/arm/vfp.md (lazy_store_multiple_insn): New define_insn. ++ (lazy_load_multiple_insn): Likewise. ++ ++2020-01-16 Mihail-Calin Ionescu ++ Thomas Preud'homme ++ ++ * config/arm/arm.c (vfp_emit_fstmd): Declare early. ++ (arm_emit_vfp_multi_reg_pop): Likewise. ++ (cmse_nonsecure_call_inline_register_clear): Abstract number of VFP ++ registers to clear in max_fp_regno. Emit VPUSH and VPOP to save and ++ restore callee-saved VFP registers. ++ ++2020-01-16 Mihail-Calin Ionescu ++ Thomas Preud'homme ++ ++ * config/arm/arm.c (arm_emit_multi_reg_pop): Declare early. ++ (cmse_nonsecure_call_clear_caller_saved): Rename into ... ++ (cmse_nonsecure_call_inline_register_clear): This. Save and clear ++ callee-saved GPRs as well as clear ip register before doing a nonsecure ++ call then restore callee-saved GPRs after it when targeting ++ Armv8.1-M Mainline. ++ (arm_reorg): Adapt to function rename. ++ ++2020-01-16 Mihail-Calin Ionescu ++ Thomas Preud'homme ++ ++ * config/arm/arm-protos.h (clear_operation_p): Adapt prototype. ++ * config/arm/arm.c (clear_operation_p): Extend to be able to check a ++ clear_vfp_multiple pattern based on a new vfp parameter. ++ (cmse_clear_registers): Generate VSCCLRM to clear VFP registers when ++ targeting Armv8.1-M Mainline. ++ (cmse_nonsecure_entry_clear_before_return): Clear VFP registers ++ unconditionally when targeting Armv8.1-M Mainline architecture. Check ++ whether VFP registers are available before looking call_used_regs for a ++ VFP register. ++ * config/arm/predicates.md (clear_multiple_operation): Adapt to change ++ of prototype of clear_operation_p. ++ (clear_vfp_multiple_operation): New predicate. ++ * config/arm/unspecs.md (VUNSPEC_VSCCLRM_VPR): New volatile unspec. ++ * config/arm/vfp.md (clear_vfp_multiple): New define_insn. ++ ++2020-01-16 Mihail-Calin Ionescu ++ Thomas Preud'homme ++ ++ * config/arm/arm-protos.h (clear_operation_p): Declare. ++ * config/arm/arm.c (clear_operation_p): New function. ++ (cmse_clear_registers): Generate clear_multiple instruction pattern if ++ targeting Armv8.1-M Mainline or successor. ++ (output_return_instruction): Only output APSR register clearing if ++ Armv8.1-M Mainline instructions not available. ++ (thumb_exit): Likewise. ++ * config/arm/predicates.md (clear_multiple_operation): New predicate. ++ * config/arm/thumb2.md (clear_apsr): New define_insn. ++ (clear_multiple): Likewise. ++ * config/arm/unspecs.md (VUNSPEC_CLRM_APSR): New volatile unspec. ++ ++2020-01-16 Mihail-Calin Ionescu ++ Thomas Preud'homme ++ ++ * config/arm/arm.c (fp_sysreg_names): Declare and define. ++ (use_return_insn): Also return false for Armv8.1-M Mainline. ++ (output_return_instruction): Skip FPSCR clearing if Armv8.1-M ++ Mainline instructions are available. ++ (arm_compute_frame_layout): Allocate space in frame for FPCXTNS ++ when targeting Armv8.1-M Mainline Security Extensions. ++ (arm_expand_prologue): Save FPCXTNS if this is an Armv8.1-M ++ Mainline entry function. ++ (cmse_nonsecure_entry_clear_before_return): Clear IP and r4 if ++ targeting Armv8.1-M Mainline or successor. ++ (arm_expand_epilogue): Fix indentation of caller-saved register ++ clearing. Restore FPCXTNS if this is an Armv8.1-M Mainline ++ entry function. ++ * config/arm/arm.h (TARGET_HAVE_FP_CMSE): New macro. ++ (FP_SYSREGS): Likewise. ++ (enum vfp_sysregs_encoding): Define enum. ++ (fp_sysreg_names): Declare. ++ * config/arm/unspecs.md (VUNSPEC_VSTR_VLDR): New volatile unspec. ++ * config/arm/vfp.md (push_fpsysreg_insn): New define_insn. ++ (pop_fpsysreg_insn): Likewise. ++ ++2020-01-16 Mihail-Calin Ionescu ++ Thomas Preud'homme ++ ++ * config/arm/arm-cpus.in (armv8_1m_main): New feature. ++ (ARMv4, ARMv4t, ARMv5t, ARMv5te, ARMv5tej, ARMv6, ARMv6j, ARMv6k, ++ ARMv6z, ARMv6kz, ARMv6zk, ARMv6t2, ARMv6m, ARMv7, ARMv7a, ARMv7ve, ++ ARMv7r, ARMv7m, ARMv7em, ARMv8a, ARMv8_1a, ARMv8_2a, ARMv8_3a, ++ ARMv8_4a, ARMv8_5a, ARMv8m_base, ARMv8m_main, ARMv8r): Reindent. ++ (ARMv8_1m_main): New feature group. ++ (armv8.1-m.main): New architecture. ++ * config/arm/arm-tables.opt: Regenerate. ++ * config/arm/arm.c (arm_arch8_1m_main): Define and default initialize. ++ (arm_option_reconfigure_globals): Initialize arm_arch8_1m_main. ++ (arm_options_perform_arch_sanity_checks): Error out when targeting ++ Armv8.1-M Mainline Security Extensions. ++ * config/arm/arm.h (arm_arch8_1m_main): Declare. ++ ++2020-01-16 Stam Markianos-Wright ++ ++ * config/aarch64/aarch64-simd-builtins.def (aarch64_bfdot, ++ aarch64_bfdot_lane, aarch64_bfdot_laneq): New. ++ * config/aarch64/aarch64-simd.md (aarch64_bfdot, aarch64_bfdot_lane, ++ aarch64_bfdot_laneq): New. ++ * config/aarch64/arm_bf16.h (vbfdot_f32, vbfdotq_f32, ++ vbfdot_lane_f32, vbfdotq_lane_f32, vbfdot_laneq_f32, ++ vbfdotq_laneq_f32): New. ++ * config/aarch64/iterators.md (UNSPEC_BFDOT, Vbfdottype, ++ VBFMLA_W, VBF): New. ++ (isquadop): Add V4BF, V8BF. ++ ++2020-01-16 Stam Markianos-Wright ++ ++ * config/aarch64/aarch64-builtins.c: (enum aarch64_type_qualifiers): ++ New qualifier_lane_quadtup_index, TYPES_TERNOP_SSUS, ++ TYPES_QUADOPSSUS_LANE_QUADTUP, TYPES_QUADOPSSSU_LANE_QUADTUP. ++ (aarch64_simd_expand_args): Add case SIMD_ARG_LANE_QUADTUP_INDEX. ++ (aarch64_simd_expand_builtin): Add qualifier_lane_quadtup_index. ++ * config/aarch64/aarch64-simd-builtins.def (usdot, usdot_lane, ++ usdot_laneq, sudot_lane,sudot_laneq): New. ++ * config/aarch64/aarch64-simd.md (aarch64_usdot): New. ++ (aarch64_dot_lane): New. ++ * config/aarch64/arm_neon.h (vusdot_s32): New. ++ (vusdotq_s32): New. ++ (vusdot_lane_s32): New. ++ (vsudot_lane_s32): New. ++ * config/aarch64/iterators.md (DOTPROD_I8MM): New iterator. ++ (UNSPEC_USDOT, UNSPEC_SUDOT): New unspecs. +=20 +- * config/i386/i386.c (print_reg): Use REGNO instead of true_regnum. ++2020-01-16 Martin Liska +=20 +-2017-01-27 Bernd Schmidt ++ * value-prof.c (dump_histogram_value): Fix ++ obvious spacing issue. +=20 +- PR rtl-optimization/79194 +- * cprop.c (one_cprop_pass): Move deletion of code after unconditional +- traps before call to bypass_conditional_jumps. ++2020-01-16 Andrew Pinski ++ ++ * tree-ssa-sccvn.c(vn_reference_lookup_3): Check lhs for ++ !storage_order_barrier_p. ++ ++2020-01-16 Andrew Pinski ++ ++ * sched-int.h (_dep): Add unused bit-field field for the padding. ++ * sched-deps.c (init_dep_1): Init unused field. ++ ++2020-01-16 Andrew Pinski +=20 +-2017-01-27 Vladimir Makarov ++ * optabs.h (create_expand_operand): Initialize target field also. +=20 +- PR tree-optimization/71374 +- * lra-constraints.c (check_conflict_input_operands): New. +- (match_reload): Use it. ++2020-01-16 Andre Vieira +=20 +-2017-01-27 Vladimir Makarov ++ PR tree-optimization/92429 ++ * tree-ssa-loop-niter.h (simplify_replace_tree): Add parameter. ++ * tree-ssa-loop-niter.c (simplify_replace_tree): Add parameter to ++ control folding. ++ * tree-vect-loop.c (update_epilogue_vinfo): Do not fold when replacing ++ tree. +=20 +- PR target/79131 +- * lra-assigns.c (find_hard_regno_for_1): Take endianess for into +- account to calculate conflict_set. ++2020-01-16 Richard Sandiford +=20 +-2017-01-27 Bin Cheng ++ * config/aarch64/aarch64.c (aarch64_split_sve_subreg_move): Apply ++ aarch64_sve_int_mode to each mode. +=20 +- PR rtl-optimization/78559 +- * combine.c (try_combine): Discard REG_EQUAL and REG_EQUIV for +- other_insn in combine. ++2020-01-15 David Malcolm +=20 +-2017-01-27 Pekka J=C3=A4=C3=A4skel=C3=A4inen ++ * doc/analyzer.texi (Overview): Add note about ++ -fdump-ipa-analyzer. +=20 +- * builtin-types.def: Use unsigned_char_type_node for BT_UINT8. Use +- uint16_type_node for BT_UINT16. ++2020-01-15 Wilco Dijkstra +=20 +-2017-01-27 David Malcolm ++ PR tree-optimization/93231 ++ * tree-ssa-forwprop.c (optimize_count_trailing_zeroes): Check ++ input_type is unsigned. Use tree_to_shwi for shift constant. ++ Check CST_STRING element size is CHAR_TYPE_SIZE bits. ++ (simplify_count_trailing_zeroes): Add test to handle known non-zero ++ inputs more efficiently. +=20 +- * doc/sourcebuild.texi (Testsuites): Add "GIMPLE Tests" and +- "RTL Tests" to menu. +- (GIMPLE Tests): New node. +- (RTL Tests): New node. ++2020-01-15 Uro=C5=A1 Bizjak +=20 +-2017-01-27 Richard Biener ++ * config/i386/i386.md (*movsf_internal): Do not require ++ SSE2 ISA for alternatives 14 and 15. +=20 +- PR tree-optimization/79245 +- * tree-loop-distribution.c (distribute_loop): Apply cost +- modeling also to detected patterns. ++2020-01-15 Richard Biener +=20 +-2017-01-27 Richard Biener ++ PR middle-end/93273 ++ * tree-eh.c (sink_clobbers): If we already visited the destination ++ block do not defer insertion. ++ (pass_lower_eh_dispatch::execute): Maintain BB_VISITED for ++ the purpose of defered insertion. +=20 +- PR tree-optimization/71433 +- * tree-vrp.c (register_new_assert_for): Revert earlier changes. +- (compare_assert_loc): New function. +- (process_assert_insertions): Sort and optimize assert locations +- to remove duplicates and push down identical assertions on +- edges to their destination block. ++2020-01-15 Jakub Jelinek +=20 +-2017-01-27 Richard Biener ++ * BASE-VER: Bump to 10.0.1. +=20 +- PR tree-optimization/79244 +- * tree-vrp.c (remove_range_assertions): Forcefully propagate +- out SSA names even if abnormal. ++2020-01-15 Richard Sandiford +=20 +-2017-01-27 Jakub Jelinek ++ PR tree-optimization/93247 ++ * tree-vect-loop.c (update_epilogue_loop_vinfo): Check the access ++ type of the stmt that we're going to vectorize. +=20 +- * realmpfr.h: Poison MPFR_RND{N,Z,U,D}. +- * gimple-ssa-sprintf.c (format_floating_max): Use GMP_RNDN +- instead of MPFR_RNDN. ++2020-01-15 Richard Sandiford +=20 +-2017-01-27 Richard Earnshaw ++ * tree-vect-slp.c (vectorize_slp_instance_root_stmt): Use a ++ VIEW_CONVERT_EXPR if the vectorized constructor has a diffeent ++ type from the lhs. +=20 +- PR target/79239 +- * arm.c (arm_option_override): Don't call build_target_option_node +- until after doing all option overrides. +- (arm_valid_target_attribute_tree): Likewise. ++2020-01-15 Martin Liska +=20 +-2017-01-27 Martin Liska ++ * ipa-profile.c (ipa_profile_read_edge_summary): Do not allow ++ 2 calls of streamer_read_hwi in a function call. +=20 +- * doc/invoke.texi (-fprofile-arcs): Document profiling support +- for {cd}tors and C++ {cd}tors. ++2020-01-15 Richard Biener +=20 +-2017-01-27 Dominik Vogt ++ * alias.c (record_alias_subset): Avoid redundant work when ++ subset is already recorded. +=20 +- * config/s390/s390.md ("*setmem_long_and") +- ("*setmem_long_and_31z"): Use zero_extend instead of and. ++2020-01-14 David Malcolm +=20 +-2017-01-26 Martin Sebor ++ * doc/invoke.texi (-fdiagnostics-show-cwe): Add note that some of ++ the analyzer options provide CWE identifiers. +=20 +- * gimple-ssa-sprintf.c (format_floating): Simplify the computation +- of precision. ++2020-01-14 David Malcolm +=20 +-2017-01-26 Martin Sebor ++ * tree-diagnostic-path.cc (path_summary::event_range::print): ++ When testing for UNKNOWN_LOCATION, look through ad-hoc wrappers ++ using get_pure_location. +=20 +- * gimple-ssa-sprintf.c (format_floating): Test HAVE_XFmode and +- HAVE_DFmode before using XFmode or DFmode. +- (parse_directive): Avoid using the z length modifier to avoid +- the ISO C++98 does not support the =E2=80=98z=E2=80=99 gnu_printf length= modifier. ++2020-01-15 Jakub Jelinek +=20 +- PR middle-end/78703 +- * gimple-ssa-sprintf.c (adjust_for_width_or_precision): Change +- to accept adjustment as an array. +- (get_int_range): New function. +- (struct directive): Make width and prec arrays. +- (directive::set_width, directive::set_precision): Call get_int_range. +- (format_integer, format_floating): Handle width and precision ranges. +- (format_string, parse_directive): Same. +- +-2017-01-26 Jakub Jelinek +- +- PR debug/79129 +- * dwarf2out.c (generate_skeleton_bottom_up): For children with +- comdat_type_p set, just clone them, but keep the children in the +- original DIE. ++ PR tree-optimization/93262 ++ * tree-ssa-dse.c (maybe_trim_memstar_call): For *_chk builtins, ++ perform head trimming only if the last argument is constant, ++ either all ones, or larger or equal to head trim, in the latter ++ case decrease the last argument by head_trim. +=20 +- PR debug/78835 +- * dwarf2out.c (prune_unused_types): Mark all functions with DIEs +- which have direct callers with -fvar-tracking-assignments enabled +- in the current TU. +- (resolve_addr): Avoid adding skeleton DIEs for DW_AT_call_origin +- inside of type units. +- +-2017-01-26 Martin Sebor ++ PR tree-optimization/93249 ++ * tree-ssa-dse.c: Include builtins.h and gimple-fold.h. ++ (maybe_trim_memstar_call): Move head_trim and tail_trim vars to ++ function body scope, reindent. For BUILTIN_IN_STRNCPY*, don't ++ perform head trim unless we can prove there are no '\0' chars ++ from the source among the first head_trim chars. +=20 +- PR middle-end/78703 +- * gimple-ssa-sprintf.c (struct result_range): Add likely and +- unlikely counters. +- (struct format_result): Replace number_chars, number_chars_min, +- and number_chars_max with a single member of struct result_range. +- Remove bounded. +- (format_result::operator+=3D): Adjust. +- (struct fmtresult): Remove bounded. Handle likely and unlikely +- counters. +- (fmtresult::adjust_for_width_or_precision): New function. +- (fmtresult:type_max_digits): New function. +- (bytes_remaining): Handle likely and unlikely counters. +- (min_bytes_remaining): Remove. +- (format_percent): Simplify. +- (format_integer, format_floating): Set likely and unlikely counters. +- (get_string_length, format_character, format_string): Same. +- (format_plain, should_warn_p): New function. +- (maybe_warn): Call should_warn_p. Update diagnostic messages +- and handle those for all directives, including plain strings. +- (format_directive): Handle likely and unlikely counters. +- Remove unnecessary quoting from diagnostics. Add an informational +- note. +- (add_bytes): Remove. +- (pass_sprintf_length::compute_format_length): Simplify. +- (try_substitute_return_value): Handle likely and unlikely counters. +- +-2017-01-26 Carl Love +- +- * config/rs6000/rs6000-c (altivec_overloaded_builtins): Remove +- bogus entries for the P8V_BUILTIN_VEC_VGBBD built-ins ++2020-01-14 David Malcolm +=20 +-2017-01-26 Vladimir Makarov ++ * Makefile.in (ANALYZER_OBJS): Add analyzer/function-set.o. +=20 +- PR target/79131 +- * lra-assigns.c (setup_live_pseudos_and_spill_after_risky): Take +- endianess for subregs into account. +- * lra-constraints.c (lra_constraints): Do risky transformations +- always on the first iteration. +- * lra-lives.c (check_pseudos_live_through_calls): Add arg +- last_call_used_reg_set. +- (process_bb_lives): Define and use last_call_used_reg_set. +- * lra.c (lra): Always continue after lra_constraints on the first +- iteration. +- +-2017-01-26 Kirill Yukhin +- +- * gcc.target/i386/avx512bw-kshiftlq-2.c: Use unsigned long long +- constant. +- * gcc.target/i386/avx512bw-kshiftrq-2.c: Ditto. +- +-2017-01-26 Jakub Jelinek +- +- * config/i386/avx512fintrin.h (_ktest_mask16_u8, +- _ktestz_mask16_u8, _ktestc_mask16_u8, _kadd_mask16): Move to ... +- * config/i386/avx512dqintrin.h (_ktest_mask16_u8, +- _ktestz_mask16_u8, _ktestc_mask16_u8, _kadd_mask16): ... here. +- * config/i386/i386-builtin.def (__builtin_ia32_ktestchi, +- __builtin_ia32_ktestzhi, __builtin_ia32_kaddhi): Use +- OPTION_MASK_ISA_AVX512DQ instead of OPTION_MASK_ISA_AVX512F. +- * config/i386/sse.md (SWI1248_AVX512BWDQ2): New mode iterator. +- (kadd, ktest): Use it instead of SWI1248_AVX512BWDQ. +- +-2017-01-26 Marek Polacek +- +- PR c/79199 +- * fold-const.c (operand_equal_p) [COND_EXPR]: Use OP_SAME_WITH_NULL +- for the third operand. +- +-2017-01-26 Jakub Jelinek +- +- PR middle-end/79236 +- * omp-low.c (struct omp_context): Add simt_stmt field. +- (scan_omp_for): Return omp_context *. +- (scan_omp_simd): Set simt_stmt on the non-_simt_ SIMD +- context to the _simt_ SIMD stmt. +- (lower_omp_for): For combined SIMD with sibling _simt_ +- SIMD, make sure to use the same decls in _looptemp_ +- clauses as in the sibling. +- +-2017-01-26 David Sherwood +- +- PR middle-end/79212 +- * gimplify.c (omp_notice_variable): Add GOVD_SEEN flag to variables in +- all contexts. +- +-2017-01-26 Jakub Jelinek +- +- PR target/70465 +- * reg-stack.c (emit_swap_insn): Instead of fld a; fld b; fxchg %st(1); +- emit fld b; fld a; if possible. +- +- * brig-builtins.def: Update copyright years. +- * config/arm/arm_acle_builtins.def: Update copyright years. +- +-2017-01-25 Michael Meissner +- +- PR target/79179 +- * config/rs6000/vsx.md (vsx_extract__store): Use wY +- constraint instead of o for the stxsd instruction. +- +-2017-01-25 Carl Love +- +- * config/rs6000/rs6000-c (altivec_overloaded_builtins): Fix order +- of entries for ALTIVEC_BUILTIN_VEC_PACKS and P8V_BUILTIN_VEC_VGBBD. +- +-2017-01-25 Jonathan Wakely +- +- * doc/invoke.texi (C++ Dialect Options): Fix typo. +- +-2017-01-25 Richard Biener ++2020-01-15 Jakub Jelinek +=20 +- PR tree-optimization/69264 +- * target.def (vector_alignment_reachable): Improve documentation. +- * doc/tm.texi: Regenerate. +- * targhooks.c (default_builtin_vector_alignment_reachable): Simplify +- and add a comment. +- * tree-vect-data-refs.c (vect_supportable_dr_alignment): Revert +- earlier changes with respect to TYPE_USER_ALIGN. +- (vector_alignment_reachable_p): Likewise. Improve dumping. +- +-2016-01-25 Kyrylo Tkachov +- +- PR target/79145 +- * config/arm/arm.md (xordi3): Force constant operand into a register +- for TARGET_IWMMXT. +- +-2016-01-25 Kyrylo Tkachov +- +- * doc/invoke.texi (-fstore-merging): Correct default optimization +- levels at which it is enabled. +- (-O): Move -fstore-merging from list to... +- (-O2): ... Here. +- +-2017-01-25 Richard Biener +- +- PR debug/78363 +- * omp-expand.c: Include debug.h. +- (expand_omp_taskreg): Make sure to generate early debug before +- outlining anything from a function. +- (expand_omp_target): Likewise. +- (grid_expand_target_grid_body): Likewise. +- +-2017-01-25 Maxim Ostapenko +- +- PR lto/79061 +- * asan.c (get_translation_unit_decl): New function. +- (asan_add_global): Extract modules file name from globals +- TRANSLATION_UNIT_DECL name. +- +-2017-01-24 Eric Botcazou +- +- PR target/77439 +- * config/arm/arm.c (arm_function_ok_for_sibcall): Add back restriction +- for long calls with APCS frame and VFP. +- +-2017-01-24 David Malcolm +- +- * cfg.c (original_copy_tables_initialized_p): New function. +- * cfg.h (original_copy_tables_initialized_p): New decl. +- * cfgrtl.c (relink_block_chain): Guard the call to +- free_original_copy_tables with a call to +- original_copy_tables_initialized_p. +- * cgraph.h (symtab_node::native_rtl_p): New decl. +- * cgraphunit.c (symtab_node::native_rtl_p): New function. +- (symtab_node::needed_p): Don't assert for early assembly output +- for __RTL functions. +- (cgraph_node::finalize_function): Set "force_output" for __RTL +- functions. +- (cgraph_node::analyze): Bail out early for __RTL functions. +- (analyze_functions): Update assertion to support __RTL functions. +- (cgraph_node::expand): Bail out early for __RTL functions. +- * final.c (rest_of_clean_state): Don't call delete_tree_ssa for +- __RTL functions. +- * function.h (struct function): Update comment for field +- "pass_startwith". +- * gimple-expr.c: Include "tree-pass.h". +- (gimple_has_body_p): Return false for __RTL functions. +- * Makefile.in (OBJS): Add run-rtl-passes.o. +- * pass_manager.h (gcc::pass_manager::get_rest_of_compilation): New +- accessor. +- (gcc::pass_manager::get_clean_slate): New accessor. +- * passes.c: Include "insn-addr.h". +- (should_skip_pass_p): Add logging. Update logic for running +- "expand" to be compatible with both __GIMPLE and __RTL. Guard +- property-provider override so it is only done for gimple passes. +- Don't skip dfinit. +- (skip_pass): New function. +- (execute_one_pass): Call skip_pass when skipping passes. +- * read-md.c (md_reader::read_char): Support filtering +- the input to a subset of line numbers. +- (md_reader::md_reader): Initialize fields +- m_first_line and m_last_line. +- (md_reader::read_file_fragment): New function. +- * read-md.h (md_reader::read_file_fragment): New decl. +- (md_reader::m_first_line): New field. +- (md_reader::m_last_line): New field. +- * read-rtl-function.c (function_reader::create_function): Only +- create cfun if it doesn't already exist. Set PROP_rtl on cfun's +- curr_properties. Set DECL_INITIAL to a dummy block. +- (read_rtl_function_body_from_file_range): New function. +- * read-rtl-function.h (read_rtl_function_body_from_file_range): +- New decl. +- * run-rtl-passes.c: New file. +- * run-rtl-passes.h: New file. +- +-2017-01-24 Jeff Law +- +- * config/microblaze/microblaze.h (ASM_FORMAT_PRIVATE_NAME): Increase +- buffer size. +- +-2017-01-24 Bin Cheng +- +- PR tree-optimization/79159 +- * tree-ssa-loop-niter.c (get_cst_init_from_scev): New function. +- (record_nonwrapping_iv): Improve boundary using above function if no +- value range information. +- +-2017-01-24 Pekka J=C3=A4=C3=A4skel=C3=A4inen +- Martin Jambor +- +- * brig-builtins.def: New file. +- * builtins.def (DEF_HSAIL_BUILTIN): New macro. +- (DEF_HSAIL_ATOMIC_BUILTIN): Likewise. +- (DEF_HSAIL_SAT_BUILTIN): Likewise. +- (DEF_HSAIL_INTR_BUILTIN): Likewise. +- (DEF_HSAIL_CVT_ZEROI_SAT_BUILTIN): Likewise. +- * builtin-types.def (BT_INT8): New. +- (BT_INT16): Likewise. +- (BT_UINT8): Likewise. +- (BT_UINT16): Likewise. +- (BT_FN_ULONG): Likewise. +- (BT_FN_UINT_INT): Likewise. +- (BT_FN_UINT_ULONG): Likewise. +- (BT_FN_UINT_LONG): Likewise. +- (BT_FN_UINT_PTR): Likewise. +- (BT_FN_ULONG_PTR): Likewise. +- (BT_FN_INT8_FLOAT): Likewise. +- (BT_FN_INT16_FLOAT): Likewise. +- (BT_FN_UINT32_FLOAT): Likewise. +- (BT_FN_UINT16_FLOAT): Likewise. +- (BT_FN_UINT8_FLOAT): Likewise. +- (BT_FN_UINT64_FLOAT): Likewise. +- (BT_FN_UINT16_UINT32): Likewise. +- (BT_FN_UINT32_UINT16): Likewise. +- (BT_FN_UINT16_UINT16_UINT16): Likewise. +- (BT_FN_INT_PTR_INT): Likewise. +- (BT_FN_UINT_PTR_UINT): Likewise. +- (BT_FN_LONG_PTR_LONG): Likewise. +- (BT_FN_ULONG_PTR_ULONG): Likewise. +- (BT_FN_VOID_UINT64_UINT64): Likewise. +- (BT_FN_UINT8_UINT8_UINT8): Likewise. +- (BT_FN_INT8_INT8_INT8): Likewise. +- (BT_FN_INT16_INT16_INT16): Likewise. +- (BT_FN_INT_INT_INT): Likewise. +- (BT_FN_UINT_FLOAT_UINT): Likewise. +- (BT_FN_FLOAT_UINT_UINT): Likewise. +- (BT_FN_ULONG_UINT_UINT): Likewise. +- (BT_FN_ULONG_UINT_PTR): Likewise. +- (BT_FN_ULONG_ULONG_ULONG): Likewise. +- (BT_FN_UINT_UINT_UINT): Likewise. +- (BT_FN_VOID_UINT_PTR): Likewise. +- (BT_FN_UINT_UINT_PTR: Likewise. +- (BT_FN_UINT32_UINT64_PTR): Likewise. +- (BT_FN_INT_INT_UINT_UINT): Likewise. +- (BT_FN_UINT_UINT_UINT_UINT): Likewise. +- (BT_FN_UINT_UINT_UINT_PTR): Likewise. +- (BT_FN_UINT_ULONG_ULONG_UINT): Likewise. +- (BT_FN_ULONG_ULONG_ULONG_ULONG): Likewise. +- (BT_FN_LONG_LONG_UINT_UINT): Likewise. +- (BT_FN_ULONG_ULONG_UINT_UINT): Likewise. +- (BT_FN_VOID_UINT32_UINT64_PTR): Likewise. +- (BT_FN_VOID_UINT32_UINT32_PTR): Likewise. +- (BT_FN_UINT_UINT_UINT_UINT_UINT): Likewise. +- (BT_FN_UINT_FLOAT_FLOAT_FLOAT_FLOAT): Likewise. +- (BT_FN_ULONG_ULONG_ULONG_UINT_UINT): Likewise. +- * doc/frontends.texi: List BRIG FE. +- * doc/install.texi (Testing): Add BRIG tesring requirements. +- * doc/invoke.texi (Overall Options): Mention BRIG. +- * doc/standards.texi (Standards): Doucment BRIG HSA version. +- +-2017-01-24 Richard Biener +- +- PR translation/79208 +- * ipa-devirt.c (odr_types_equivalent_p): Fix typo in diagnostic. +- +-2017-01-24 Martin Jambor +- +- PR bootstrap/79198 +- * ipa-prop.c (ipa_free_all_node_params): Call summary destructor. +- * ipa-prop.c (ipa_node_params_t::insert): Initialize fields known_csts +- and known_contexts. +- +-2017-01-24 Aldy Hernandez +- +- PR middle-end/79123 +- * gimple-ssa-warn-alloca.c (alloca_call_type): Make sure +- casts from signed to unsigned really don't have a range. +- +-2017-01-24 Markus Trippelsdorf +- +- * gimple-ssa-sprintf.c (format_floating): Change MPFR_RNDx to +- GMP_RNDx for compatiblity. +- +-2017-01-24 Martin Liska +- +- PR bootstrap/79132 +- * tree-ssa-reassoc.c (rewrite_expr_tree_parallel): Insert assert +- that would prevent us to call alloca with -1 as argument. +- +-2017-01-24 Jakub Jelinek +- +- * dwarf2out.c (output_compilation_unit_header, output_file_names): +- Avoid -Wformat-security warning. +- +-2017-01-23 Andrew Pinski +- +- * config/aarch64/aarch64.c (thunderx2t99_addrcost_table): Improve +- cost table. +- +-2017-01-23 Martin Sebor +- +- PR middle-end/78703 +- * gimple-ssa-sprintf.c (warn_level): New global. +- (format_integer): Use it here and throughout the rest of the file. +- Use the same switch to compute sign as base. +- (maybe_warn): New function. +- (format_directive): Factor out warnings into maybe_warn. +- Add debugging output. Use warn_level. +- (add_bytes): Use warn_level. +- (pass_sprintf_length::compute_format_length): Add debugging output. +- (try_substitute_return_value): Same. +- (pass_sprintf_length::handle_gimple_call): Set and use warn_level. +- +- PR middle-end/78703 +- * gimple-ssa-sprintf.c (struct format_result): Remove constant member. +- (struct fmtresult, format_integer, format_floating): Adjust. +- (fmtresult::fmtresult): Set max correctly in two argument ctor. +- (get_string_length, format_string,format_directive): Same. +- (pass_sprintf_length::compute_format_length): Same. +- (try_substitute_return_value): Simplify slightly. +- +- PR middle-end/78703 +- * gimple-ssa-sprintf.c (pass_sprintf_length::gate): Adjust formatting. +- (fmtresult::operator+=3D): Outlined. +- (struct fmtresult): Add ctors. +- (struct conversion_spec): Rename... +- (struct directive): ...to this. Add and remove data members. +- (directive::set_width, directive::set_precision): New functions. +- (format_percent): Use fmtresult ctor. +- (get_width_and_precision): Remove. +- (format_integer): Make naming changes. Avoid computing width and +- precision. +- (format_floating): Same. Adjust indentation. +- (format_character, format_none): New functions. +- (format_string): Moved character handling to format_character. +- (format_directive): Remove arguments, change return type. +- (parse_directive): New function. +- (pass_sprintf_length::compute_format_length): Move directive +- parsing to parse_directive. +- +-2017-01-23 Jakub Jelinek +- +- * tree.h (assign_assembler_name_if_neeeded): Rename to ... +- (assign_assembler_name_if_needed): ... this. +- * tree.c (assign_assembler_name_if_neeeded): Rename to ... +- (assign_assembler_name_if_needed): ... this. +- (free_lang_data_in_cgraph): Adjust callers. +- * cgraphunit.c (cgraph_node::analyze): Likewise. +- * omp-expand.c (expand_omp_taskreg, expand_omp_target): ++ PR target/93009 ++ * config/i386/sse.md ++ (*fma_fmadd__bcst_1, ++ *fma_fmsub__bcst_1, ++ *fma_fnmadd__bcst_1, ++ *fma_fnmsub__bcst_1): Use ++ just a single alternative instead of two, make operands 1 and 2 ++ commutative. ++ ++2020-01-14 Jan Hubicka ++ ++ PR lto/91576 ++ * ipa-devirt.c (odr_types_equivalent_p): Compare TREE_ADDRESSABLE and ++ TYPE_MODE. ++ ++2020-01-14 David Malcolm ++ ++ * Makefile.in (lang_opt_files): Add analyzer.opt. ++ (ANALYZER_OBJS): New. ++ (OBJS): Add digraph.o, graphviz.o, ordered-hash-map-tests.o, ++ tristate.o and ANALYZER_OBJS. ++ (TEXI_GCCINT_FILES): Add analyzer.texi. ++ * common.opt (-fanalyzer): New driver option. ++ * config.in: Regenerate. ++ * configure: Regenerate. ++ * configure.ac (--disable-analyzer, ENABLE_ANALYZER): New option. ++ (gccdepdir): Also create depdir for "analyzer" subdir. ++ * digraph.cc: New file. ++ * digraph.h: New file. ++ * doc/analyzer.texi: New file. ++ * doc/gccint.texi ("Static Analyzer") New menu item. ++ (analyzer.texi): Include it. ++ * doc/invoke.texi ("Static Analyzer Options"): New list and new section. ++ ("Warning Options"): Add static analysis warnings to the list. ++ (-Wno-analyzer-double-fclose): New option. ++ (-Wno-analyzer-double-free): New option. ++ (-Wno-analyzer-exposure-through-output-file): New option. ++ (-Wno-analyzer-file-leak): New option. ++ (-Wno-analyzer-free-of-non-heap): New option. ++ (-Wno-analyzer-malloc-leak): New option. ++ (-Wno-analyzer-possible-null-argument): New option. ++ (-Wno-analyzer-possible-null-dereference): New option. ++ (-Wno-analyzer-null-argument): New option. ++ (-Wno-analyzer-null-dereference): New option. ++ (-Wno-analyzer-stale-setjmp-buffer): New option. ++ (-Wno-analyzer-tainted-array-index): New option. ++ (-Wno-analyzer-use-after-free): New option. ++ (-Wno-analyzer-use-of-pointer-in-stale-stack-frame): New option. ++ (-Wno-analyzer-use-of-uninitialized-value): New option. ++ (-Wanalyzer-too-complex): New option. ++ (-fanalyzer-call-summaries): New warning. ++ (-fanalyzer-checker=3D): New warning. ++ (-fanalyzer-fine-grained): New warning. ++ (-fno-analyzer-state-merge): New warning. ++ (-fno-analyzer-state-purge): New warning. ++ (-fanalyzer-transitivity): New warning. ++ (-fanalyzer-verbose-edges): New warning. ++ (-fanalyzer-verbose-state-changes): New warning. ++ (-fanalyzer-verbosity=3D): New warning. ++ (-fdump-analyzer): New warning. ++ (-fdump-analyzer-callgraph): New warning. ++ (-fdump-analyzer-exploded-graph): New warning. ++ (-fdump-analyzer-exploded-nodes): New warning. ++ (-fdump-analyzer-exploded-nodes-2): New warning. ++ (-fdump-analyzer-exploded-nodes-3): New warning. ++ (-fdump-analyzer-supergraph): New warning. ++ * doc/sourcebuild.texi (dg-require-dot): New. ++ (dg-check-dot): New. ++ * gdbinit.in (break-on-saved-diagnostic): New command. ++ * graphviz.cc: New file. ++ * graphviz.h: New file. ++ * ordered-hash-map-tests.cc: New file. ++ * ordered-hash-map.h: New file. ++ * passes.def (pass_analyzer): Add before ++ pass_ipa_whole_program_visibility. ++ * selftest-run-tests.c (selftest::run_tests): Call ++ selftest::ordered_hash_map_tests_cc_tests. ++ * selftest.h (selftest::ordered_hash_map_tests_cc_tests): New ++ decl. ++ * shortest-paths.h: New file. ++ * timevar.def (TV_ANALYZER): New timevar. ++ (TV_ANALYZER_SUPERGRAPH): Likewise. ++ (TV_ANALYZER_STATE_PURGE): Likewise. ++ (TV_ANALYZER_PLAN): Likewise. ++ (TV_ANALYZER_SCC): Likewise. ++ (TV_ANALYZER_WORKLIST): Likewise. ++ (TV_ANALYZER_DUMP): Likewise. ++ (TV_ANALYZER_DIAGNOSTICS): Likewise. ++ (TV_ANALYZER_SHORTEST_PATHS): Likewise. ++ * tree-pass.h (make_pass_analyzer): New decl. ++ * tristate.cc: New file. ++ * tristate.h: New file. ++ ++2020-01-14 Uro=C5=A1 Bizjak ++ ++ PR target/93254 ++ * config/i386/i386.md (*movsf_internal): Require SSE2 ISA for ++ alternatives 9 and 10. ++ ++2020-01-14 David Malcolm ++ ++ * attribs.c (excl_hash_traits::empty_zero_p): New static constant. ++ * gcov.c (function_start_pair_hash::empty_zero_p): Likewise. ++ * graphite.c (struct sese_scev_hash::empty_zero_p): Likewise. ++ * hash-map-tests.c (selftest::test_nonzero_empty_key): New selftest. ++ (selftest::hash_map_tests_c_tests): Call it. ++ * hash-map-traits.h (simple_hashmap_traits::empty_zero_p): ++ New static constant, using the value of =3D H::empty_zero_p. ++ (unbounded_hashmap_traits::empty_zero_p): Likewise, using the value ++ from default_hash_traits . ++ * hash-map.h (hash_map::empty_zero_p): Likewise, using the value ++ from Traits. ++ * hash-set-tests.c (value_hash_traits::empty_zero_p): Likewise. ++ * hash-table.h (hash_table::alloc_entries): Guard the loop of ++ calls to mark_empty with !Descriptor::empty_zero_p. ++ (hash_table::empty_slow): Conditionalize the memset call with a ++ check that Descriptor::empty_zero_p; otherwise, loop through the ++ entries calling mark_empty on them. ++ * hash-traits.h (int_hash::empty_zero_p): New static constant. ++ (pointer_hash::empty_zero_p): Likewise. ++ (pair_hash::empty_zero_p): Likewise. ++ * ipa-devirt.c (default_hash_traits ::empty_zero_p): ++ Likewise. ++ * ipa-prop.c (ipa_bit_ggc_hash_traits::empty_zero_p): Likewise. ++ (ipa_vr_ggc_hash_traits::empty_zero_p): Likewise. ++ * profile.c (location_triplet_hash::empty_zero_p): Likewise. ++ * sanopt.c (sanopt_tree_triplet_hash::empty_zero_p): Likewise. ++ (sanopt_tree_couple_hash::empty_zero_p): Likewise. ++ * tree-hasher.h (int_tree_hasher::empty_zero_p): Likewise. ++ * tree-ssa-sccvn.c (vn_ssa_aux_hasher::empty_zero_p): Likewise. ++ * tree-vect-slp.c (bst_traits::empty_zero_p): Likewise. ++ * tree-vectorizer.h ++ (default_hash_traits::empty_zero_p): + Likewise. +=20 +-2017-01-23 Richard Biener +- +- PR tree-optimization/79088 +- PR tree-optimization/79188 +- * tree-ssa-threadupdate.c (mark_threaded_blocks): Move code +- resetting loop bounds after last path deletion. Reset loop +- bounds of the target loop, make code match the comments. +- * tree-ssa-threadbackwards.c (pass_early_thread_jumps::execute): +- Make sure loops need no fixups. +- +-2017-01-23 Kelvin Nilsen +- +- * config/rs6000/rs6000-builtin.def (VSIEDPF): Add scalar insert +- exponent support with double type for first argument. +- * config/rs6000/rs6000-c.c (altivec_overloaded_builtins): Changed +- type returned by __builtin_vec_extract_sig, +- __builtin_vec_extract_sig_sp, and __builtin_vec_extract_sig_dp +- functions from "vector int" to "vector unsigned int" or from +- "vector long long int" to "vector unsigned long long int". +- Changed type returned by __builtin_vec_extract_exp, +- __builtin_vec_extract_exp_sp, and __builtin_vec_extract_exp_dp +- functions from "vector int" to "vector unsigned int" or from +- "vector long long int" to "vector unsigned long long int". +- Changed return type of __builtin_vec_test_data_class, +- __builtin_vec_test_data_class_sp, and +- __builtin_vec_test_data_class_dp from "vector int" to +- "vector bool int" or from "vector long long int" to "vector bool +- long long int" and changed second argument type from "unsigned +- int" to "int". Added new overloaded function forms "vector float +- __builtin_vec_insert_exp (vector float, vector unsigned int)" and +- "vector float __builtin_vec_insert_exp_sp (vector float, vector +- unsigned int)" and "vector double __builtin_vec_insert_exp (vector +- double, vector unsigned long long int)" and "vector double +- __builtin_vec_insert_exp_dp (vector double, vector unsigned long +- long int)". Changed return type of +- __builtin_scalar_test_data_class and +- __builtin_scalar_test_data_class_sp and +- __builtin_scalar_test_data_class_dp from "unsigned int" to "bool +- int" and changed second argument from "unsigned int" to "int". +- Changed type returned by __builtin_scalar_test_neg, +- __builtin_scalar_test_neg_sp, and __builtin_scalar_test_neg_dp +- from "int" to "bool int". Added new overloaded function form +- "double __builtin_scalar_insert_exp (double, unsigned long long int)". +- * config/rs6000/vsx.md (xsiexpdpf): New insn for scalar insert +- exponent double-precision with floating point first argument. +- * doc/extend.texi (PowerPC AltiVec Built-in Functions): Adjust +- documentation of scalar_test_data_class, scalar_test_neg, +- scalar_extract_sig, scalar_extract_exp, scalar_insert_exp, +- vector_extract_exp, vec_extract_sig, vec_insert_exp, and +- vec_test_data_class built-in functions to reflect refinements in +- their type signatures. +- +-2017-01-23 Andreas Tobler +- +- * config/aarch64/aarch64.c (aarch64_elf_asm_constructor): Increase +- size of buf. +- (aarch64_elf_asm_destructor): Likewise. +- +-2017-01-23 Bernd Schmidt +- +- PR rtl-optimization/78634 +- * config/i386/i386.c (ix86_max_noce_ifcvt_seq_cost): New function. +- (TARGET_MAX_NOCE_IFCVT_SEQ_COST): Define. +- * ifcvt.c (noce_try_cmove): Add missing cost check. +- +- PR rtl-optimization/71724 +- * combine.c (if_then_else_cond): Look for situations where it is +- beneficial to undo the work of one of the recursive calls. +- +-2017-01-23 Bin Cheng +- +- PR tree-optimization/70754 +- * tree-predcom.c (stmt_combining_refs): New parameter INSERT_BEFORE. +- (reassociate_to_the_same_stmt): New parameter INSERT_BEFORE. Insert +- combined stmt before it if not NULL. +- (combine_chains): Process refs reversely and compute dominance point +- for root ref. +- +-2017-01-23 Martin Liska +- +- PR tree-optimization/79196 +- * tree-ssa-strlen.c (fold_strstr_to_memcmp): Rename to ... +- (fold_strstr_to_strncmp): ... this. Fold the pattern to strncmp +- instead of memcmp. +- (strlen_optimize_stmt): Call the renamed function. +- +-2017-01-23 Michael Matz +- +- PR tree-optimization/78384 +- * tree-ssa-loop-split.c (patch_loop_exit): Use correct edge. +- +-2017-01-23 Richard Biener +- +- PR tree-optimization/79186 +- * tree-vrp.c (register_new_assert_for): Make sure we've seen +- both incoming edges before moving an assert. +- +-2017-01-23 Martin Jambor +- +- * ipa-prop.c (load_from_param_1): Removed. +- (load_from_unmodified_param): Bits from load_from_param_1 put back +- here. +- (load_from_param): Removed. +- (compute_complex_assign_jump_func): Removed stmt2 and just replaced it +- with stmt. Reverted back to use of load_from_unmodified_param. +- +-2017-01-23 Martin Jambor +- +- PR ipa/79108 +- * ipa-prop.h (ipa_param_descriptor): Anotate with with GTY(()). +- (ipa_node_params): Annotate with GTY((for_user)). Make descriptors +- field a pointer to garbage collected vector, mark lattices and +- ipcp_orig_node with GTY((skip)). +- (ipa_get_param_count): Adjust to descriptors being a pointer. +- (ipa_get_param): Likewise. +- (ipa_get_type): Likewise. +- (ipa_get_param_move_cost): Likewise. +- (ipa_set_param_used): Likewise. +- (ipa_get_controlled_uses): Likewise. +- (ipa_set_controlled_uses): Likewise. +- (ipa_is_param_used): Likewise. +- (ipa_node_params_t): Move into garbage collector. New methods insert +- and remove. +- (ipa_node_params_sum): Annotate wth GTY(()). +- (ipa_check_create_node_params): Adjust to ipa_node_params_sum being +- garbage collected. +- (ipa_load_from_parm_agg): Adjust declaration. +- * ipa-icf.c (param_used_p): Adjust to descriptors being a pointer. +- * ipa-profile.c (ipa_profile): Likewise. +- * ipa-prop.c (ipa_get_param_decl_index_1): Likewise. +- (ipa_populate_param_decls): Make descriptors parameter garbage +- collected. +- (ipa_dump_param): Adjust to descriptors being a pointer. +- (ipa_alloc_node_params): Likewise. +- (ipa_initialize_node_params): Likewise. +- (load_from_param_1): Make descriptors parameter garbage collected. +- (load_from_unmodified_param): Likewise. +- (load_from_param): Likewise. +- (ipa_load_from_parm_agg): Likewise. +- (ipa_node_params::~ipa_node_params): Removed. +- (ipa_free_all_node_params): Remove call to delete operator. +- (ipa_node_params_t::insert): New. +- (ipa_node_params_t::remove): Likewise. +- (ipa_node_params_t::duplicate): Adjust to descriptors being a pointer, +- copy known_csts and known_contexts vectors. +- (ipa_read_node_info): Adjust to descriptors being a pointer. +- (ipcp_modif_dom_walker): Make m_descriptors field garbage +- collected. +- (ipcp_transform_function): Make descriptors variable garbage +- collected. +- +-2017-01-23 Andrew Senkevich +- +- * config/i386/avx512bwintrin.h: Add k-mask test, kortest intrinsics. +- * config/i386/avx512dqintrin.h: Ditto. +- * config/i386/avx512fintrin.h: Ditto. +- * gcc/config/i386/i386.c: Handle new builtins. +- * config/i386/i386-builtin.def: Add new builtins. +- * config/i386/sse.md (ktest, kortest): New. +- (UNSPEC_KORTEST, UNSPEC_KTEST): New. +- +-2017-01-23 Jakub Jelinek +- Martin Liska +- +- * asan.h: Define ASAN_USE_AFTER_SCOPE_ATTRIBUTE. +- * asan.c (asan_expand_poison_ifn): Support stores and use +- appropriate ASAN report function. +- * internal-fn.c (expand_ASAN_POISON_USE): New function. +- * internal-fn.def (ASAN_POISON_USE): Declare. +- * tree-into-ssa.c (maybe_add_asan_poison_write): New function. +- (maybe_register_def): Create ASAN_POISON_USE when sanitizing. +- * tree-ssa-dce.c (eliminate_unnecessary_stmts): Remove +- ASAN_POISON calls w/o LHS. +- * tree-ssa.c (execute_update_addresses_taken): Create clobber +- for ASAN_MARK (UNPOISON, &x, ...) in order to prevent usage of a LHS +- from ASAN_MARK (POISON, &x, ...) coming to a PHI node. +- * gimplify.c (asan_poison_variables): Add attribute +- use_after_scope_memory to variables that really needs to live +- in memory. +- * tree-ssa.c (is_asan_mark_p): Do not rewrite into SSA when +- having the attribute. +- +-2017-01-23 Martin Liska +- +- * asan.c (create_asan_shadow_var): New function. +- (asan_expand_poison_ifn): Likewise. +- * asan.h (asan_expand_poison_ifn): New declaration. +- * internal-fn.c (expand_ASAN_POISON): Likewise. +- * internal-fn.def (ASAN_POISON): New builtin. +- * sanopt.c (pass_sanopt::execute): Expand +- asan_expand_poison_ifn. +- * tree-inline.c (copy_decl_for_dup_finish): Make function +- external. +- * tree-inline.h (copy_decl_for_dup_finish): Likewise. +- * tree-ssa.c (is_asan_mark_p): New function. +- (execute_update_addresses_taken): Rewrite local variables +- (identified just by use-after-scope as addressable) into SSA. +- +-2017-01-22 Gerald Pfeifer +- +- * doc/install.texi (Specific): opensource.apple.com uses https +- now. Remove trailing slash. +- +-2017-01-22 Gerald Pfeifer +- +- * README.Portability: Remove note on an Irix compatibility issue. +- +-2017-01-22 Dimitry Andric +- +- * gcov.c (INCLUDE_ALGORITHM): Define. +- (INCLUDE_VECTOR): Define. +- No longer include and directly. +- +-2017-01-21 Gerald Pfeifer +- +- * doc/extend.texi (Thread-Local): Change www.akkadia.org reference +- to https. +- * doc/invoke.texi (Code Gen Options): Ditto. +- +-2017-01-21 Jan Hubicka +- +- PR lto/78407 +- * cfg.c (update_bb_profile_for_threading): Fix updating of probablity. +- +-2017-01-21 Bernd Schmidt +- +- rtl-optimization/79125 +- * cprop.c (local_cprop_pass): Handle cases where we make an +- unconditional trap. +- +-2017-01-20 Segher Boessenkool +- +- PR target/61729 +- PR target/77850 +- * config/rs6000/rs6000.c (rs6000_gimplify_va_arg): Adjust address to +- read from, for big endian. +- +-2017-01-20 Jiong Wang +- +- * config/aarch64/aarch64-builtins.c (aarch64_init_builtins): Register +- register pauth builtins for LP64 only. +- +-2017-01-20 Marek Polacek +- +- PR c/79152 +- * gimplify.c (should_warn_for_implicit_fallthrough): Handle consecutive +- non-case labels. +- +-2017-01-20 Alexander Monakov +- +- * omp-expand.c (expand_omp_simd): Clear PROP_gimple_lomp_dev regardless +- of safelen status. +- * omp-offload.c (pass_omp_device_lower::gate): Use PROP_gimple_lomp_dev. +- * passes.c (dump_properties): Handle PROP_gimple_lomp_dev. +- * tree-inline.c (expand_call_inline): Propagate PROP_gimple_lomp_dev. +- +-2017-01-20 Kyrylo Tkachov +- +- PR target/71270 +- * config/arm/arm.c (neon_valid_immediate): Reject vector constants +- in big-endian mode when they are not a single duplicated value. +- +-2017-01-20 Richard Biener +- +- * BASE-VER: Bump to 7.0.1. +- +-2017-01-20 Alexander Monakov +- +- * omp-low.c (omplow_simd_context): New struct. Use it... +- (lower_rec_simd_input_clauses): ...here and... +- (lower_rec_input_clauses): ...here to hold common data. Adjust all +- references to idx, lane, max_vf, is_simt. +- +-2017-01-20 Graham Markall +- +- * config/arc/arc.h (LINK_SPEC): Use arclinux_nps emulation when +- mcpu=3Dnps400. +- +-2017-01-20 Martin Jambor +- +- * hsa.h: Renaed to hsa-common.h. Adjusted a comment. +- * hsa.c: Renaed to hsa-common.c. Change include of gt-hsa.h to +- gt-hsa-common.h. +- * Makefile.in (OBJS): Rename hsa.o to hsa-common.o. +- (GTFILES): Rename hsa.c to hsa-common.c. +- * hsa-brig.c: Change include of hsa.h to hsa-common.h. +- * hsa-dump.c: Likewise. +- * hsa-gen.c: Likewise. +- * hsa-regalloc.c: Likewise. +- * ipa-hsa.c: Likewise. +- * omp-expand.c: Likewise. +- * omp-low.c: Likewise. +- * toplev.c: Likewise. +- +-2017-01-20 Marek Polacek +- +- PR c/64279 +- * doc/invoke.texi: Document -Wduplicated-branches. +- * fold-const.c (operand_equal_p): Handle MODIFY_EXPR, INIT_EXPR, +- COMPOUND_EXPR, PREDECREMENT_EXPR, PREINCREMENT_EXPR, +- POSTDECREMENT_EXPR, POSTINCREMENT_EXPR, CLEANUP_POINT_EXPR, EXPR_STMT, +- STATEMENT_LIST, and RETURN_EXPR. For non-pure non-const functions +- return 0 only when not OEP_LEXICOGRAPHIC. +- (fold_build_cleanup_point_expr): Use the expression +- location when building CLEANUP_POINT_EXPR. +- * tree-core.h (enum operand_equal_flag): Add OEP_LEXICOGRAPHIC. +- * tree.c (add_expr): Handle error_mark_node. +- +-2017-01-20 Martin Liska +- +- PR lto/69188 +- * tree-profile.c (init_ic_make_global_vars): Do not call +- finalize_decl. +- (gimple_init_gcov_profiler): Likewise. +- +-2017-01-20 Martin Liska +- +- PR ipa/71190 +- * cgraph.h (maybe_create_reference): Remove argument and +- update comment. +- * cgraphclones.c (cgraph_node::create_virtual_clone): Remove one +- argument. +- * ipa-cp.c (create_specialized_node): Likewise. +- * symtab.c (symtab_node::maybe_create_reference): Handle +- VAR_DECLs and ADDR_EXPRs and select ipa_ref_use type. +- +-2017-01-20 Martin Liska +- +- * read-rtl-function.c (function_reader::create_function): Use +- build_decl instread of build_decl_stat. +- +-2017-01-20 Andrew Senkevich +- +- * config/i386/avx512bwintrin.h: Add k-mask registers shift intrinsics. +- * config/i386/avx512dqintrin.h: Ditto. +- * config/i386/avx512fintrin.h: Ditto. +- * config/i386/i386-builtin-types.def: Add new types. +- * gcc/config/i386/i386.c: Handle new types. +- * config/i386/i386-builtin.def (__builtin_ia32_kshiftliqi) +- (__builtin_ia32_kshiftlihi, __builtin_ia32_kshiftlisi) +- (__builtin_ia32_kshiftlidi, __builtin_ia32_kshiftriqi) +- (__builtin_ia32_kshiftrihi, __builtin_ia32_kshiftrisi) +- (__builtin_ia32_kshiftridi): New. +- * config/i386/sse.md (k): Rename *k. +- +-2017-01-19 Segher Boessenkool +- +- PR target/78875 +- PR target/79140 +- * config/rs6000/rs6000.c (TARGET_STACK_PROTECT_GUARD): Unconditionally +- define to rs6000_init_stack_protect_guard. +- (rs6000_init_stack_protect_guard): New function. +- +-2017-01-19 Matthew Fortune +- Yunqiang Su +- +- * config.gcc (supported_defaults): Add madd4. +- (with_madd4): Add validation. +- (all_defaults): Add madd4. +- * config/mips/mips.opt (mmadd4): New option. +- * gcc/config/mips/mips.h (OPTION_DEFAULT_SPECS): Add a default for +- mmadd4. +- (TARGET_CPU_CPP_BUILTINS): Add builtin_define for +- __mips_no_madd4. +- (ISA_HAS_UNFUSED_MADD4): Gate with mips_madd4. +- (ISA_HAS_FUSED_MADD4): Likewise. +- * gcc/doc/invoke.texi (-mmadd4): Document the new option. +- * gcc/doc/install.texi (--with-madd4): Document the new option. +- +-2017-01-19 Jiong Wang +- +- * config/aarch64/aarch64-builtins.c (enum aarch64_builtins): New +- entries for AARCH64_PAUTH_BUILTIN_XPACLRI, +- AARCH64_PAUTH_BUILTIN_PACIA1716, AARCH64_PAUTH_BUILTIN_AUTIA1716. +- (aarch64_init_pauth_hint_builtins): New. +- (aarch64_init_builtins): Call aarch64_init_pauth_hint_builtins. +- (aarch64_expand_builtin): Expand new builtins. +- +-2017-01-19 Jiong Wang +- +- * reg-notes.def (CFA_TOGGLE_RA_MANGLE): New reg-note. +- * combine-stack-adj.c (no_unhandled_cfa): Handle +- REG_CFA_TOGGLE_RA_MANGLE. +- * dwarf2cfi.c (dwarf2out_frame_debug): Handle REG_CFA_TOGGLE_RA_MANGLE. +- * config/aarch64/aarch64.c (aarch64_expand_prologue): Generates DWARF +- info for return address signing. +- (aarch64_expand_epilogue): Likewise. +- +-2017-01-19 Jiong Wang +- +- * config/aarch64/aarch64-opts.h (aarch64_function_type): New enum. +- * config/aarch64/aarch64-protos.h +- (aarch64_return_address_signing_enabled): New declaration. +- * config/aarch64/aarch64.c (aarch64_return_address_signing_enabled): +- New function. +- (aarch64_expand_prologue): Sign return address before it's pushed onto +- stack. +- (aarch64_expand_epilogue): Authenticate return address fetched from +- stack. +- (aarch64_override_options): Sanity check for ILP32 and ISA level. +- (aarch64_attributes): New function attributes for "sign-return-address". +- * config/aarch64/aarch64.md (UNSPEC_AUTI1716, UNSPEC_AUTISP, +- UNSPEC_PACI1716, UNSPEC_PACISP, UNSPEC_XPACLRI): New unspecs. +- ("*do_return"): Generate combined instructions according to key index. +- ("sp", " +- +- * doc/invoke.texi: Add missing -mlxc1-sxc1 options to +- overall option summary. +- +-2017-01-19 Jiong Wang +- +- * config/aarch64/aarch64-arches.def: New entry for "armv8.3-a". +- * config/aarch64/aarch64.h (AARCH64_FL_V8_3, AARCH64_FL_FOR_ARCH8_3, +- AARCH64_ISA_V8_3, TARGET_ARMV8_3): New. +- * doc/invoke.texi (AArch64 Options): Document "armv8.3-a". +- +-2017-01-19 Michael Meissner ++2020-01-14 Kewen Lin ++ ++ * cfgloopanal.c (average_num_loop_insns): Free bbs when early return, ++ fix typo on return value. ++ ++2020-01-14 Xiong Hu Luo ++ ++ PR ipa/69678 ++ * cgraph.c (symbol_table::create_edge): Init speculative_id and ++ target_prob. ++ (cgraph_edge::make_speculative): Add param for setting speculative_id ++ and target_prob. ++ (cgraph_edge::speculative_call_info): Update comments and find reference ++ by speculative_id for multiple indirect targets. ++ (cgraph_edge::resolve_speculation): Decrease the speculations ++ for indirect edge, drop it's speculative if not direct target ++ left. Update comments. ++ (cgraph_edge::redirect_call_stmt_to_callee): Likewise. ++ (cgraph_node::dump): Print num_speculative_call_targets. ++ (cgraph_node::verify_node): Don't report error if speculative ++ edge not include statement. ++ (cgraph_edge::num_speculative_call_targets_p): New function. ++ * cgraph.h (int common_target_id): Remove. ++ (int common_target_probability): Remove. ++ (num_speculative_call_targets): New variable. ++ (make_speculative): Add param for setting speculative_id. ++ (cgraph_edge::num_speculative_call_targets_p): New declare. ++ (target_prob): New variable. ++ (speculative_id): New variable. ++ * ipa-fnsummary.c (analyze_function_body): Create and duplicate ++ call summaries for multiple speculative call targets. ++ * cgraphclones.c (cgraph_node::create_clone): Clone speculative_id. ++ * ipa-profile.c (struct speculative_call_target): New struct. ++ (class speculative_call_summary): New class. ++ (class speculative_call_summaries): New class. ++ (call_sums): New variable. ++ (ipa_profile_generate_summary): Generate indirect multiple targets summa= ries. ++ (ipa_profile_write_edge_summary): New function. ++ (ipa_profile_write_summary): Stream out indirect multiple targets summar= ies. ++ (ipa_profile_dump_all_summaries): New function. ++ (ipa_profile_read_edge_summary): New function. ++ (ipa_profile_read_summary_section): New function. ++ (ipa_profile_read_summary): Stream in indirect multiple targets summarie= s. ++ (ipa_profile): Generate num_speculative_call_targets from ++ profile summaries. ++ * ipa-ref.h (speculative_id): New variable. ++ * ipa-utils.c (ipa_merge_profiles): Update with target_prob. ++ * lto-cgraph.c (lto_output_edge): Remove indirect common_target_id and ++ common_target_probability. Stream out speculative_id and ++ num_speculative_call_targets. ++ (input_edge): Likewise. ++ * predict.c (dump_prediction): Remove edges count assert to be ++ precise. ++ * symtab.c (symtab_node::create_reference): Init speculative_id. ++ (symtab_node::clone_references): Clone speculative_id. ++ (symtab_node::clone_referring): Clone speculative_id. ++ (symtab_node::clone_reference): Clone speculative_id. ++ (symtab_node::clear_stmts_in_references): Clear speculative_id. ++ * tree-inline.c (copy_bb): Duplicate all the speculative edges ++ if indirect call contains multiple speculative targets. ++ * value-prof.h (check_ic_target): Remove. ++ * value-prof.c (gimple_value_profile_transformations): ++ Use void function gimple_ic_transform. ++ * value-prof.c (gimple_ic_transform): Handle topn case. ++ Fix comment typos. Change it to a void function. ++ ++2020-01-13 Andrew Pinski ++ ++ * config/aarch64/aarch64-cores.def (octeontx2): New define. ++ (octeontx2t98): New define. ++ (octeontx2t96): New define. ++ (octeontx2t93): New define. ++ (octeontx2f95): New define. ++ (octeontx2f95n): New define. ++ (octeontx2f95mm): New define. ++ * config/aarch64/aarch64-tune.md: Regenerate. ++ * doc/invoke.texi (-mcpu=3D): Document the new cpu types. ++ ++2020-01-13 Jason Merrill ++ ++ PR c++/33799 - destroy return value if local cleanup throws. ++ * gimplify.c (gimplify_return_expr): Handle COMPOUND_EXPR. ++ ++2020-01-13 Martin Liska ++ ++ * ipa-cp.c (get_max_overall_size): Use newly ++ renamed param param_ipa_cp_unit_growth. ++ * params.opt: Remove legacy param name. ++ ++2020-01-13 Martin Sebor ++ ++ PR tree-optimization/93213 ++ * tree-ssa-strlen.c (handle_store): Only allow single-byte nul-over-nul ++ stores to be eliminated. ++ ++2020-01-13 Martin Liska ++ ++ * opts.c (print_help): Do not print CL_PARAM ++ and CL_WARNING for CL_OPTIMIZATION. ++ ++2020-01-13 Jonathan Wakely ++ ++ PR driver/92757 ++ * doc/invoke.texi (Warning Options): Add caveat about some warnings ++ depending on optimization settings. ++ ++2020-01-13 Jakub Jelinek ++ ++ PR tree-optimization/90838 ++ * tree-ssa-forwprop.c (simplify_count_trailing_zeroes): Use ++ SCALAR_INT_TYPE_MODE directly in CTZ_DEFINED_VALUE_AT_ZERO macro ++ argument rather than to initialize temporary for targets that ++ don't use the mode argument at all. Initialize ctzval to avoid ++ warning at -O0. ++ ++2020-01-10 Thomas Schwinge ++ ++ * tree.h (OMP_CLAUSE_USE_DEVICE_PTR_IF_PRESENT): New definition. ++ * tree-core.h: Document it. ++ * gimplify.c (gimplify_omp_workshare): Set it. ++ * omp-low.c (lower_omp_target): Use it. ++ * tree-pretty-print.c (dump_omp_clause): Print it. ++ ++ * omp-low.c (lower_omp_target) : ++ Assert that for OpenACC we always have 'GOMP_MAP_USE_DEVICE_PTR'. ++ ++2020-01-10 David Malcolm ++ ++ * Makefile.in (OBJS): Add tree-diagnostic-path.o. ++ * common.opt (fdiagnostics-path-format=3D): New option. ++ (diagnostic_path_format): New enum. ++ (fdiagnostics-show-path-depths): New option. ++ * coretypes.h (diagnostic_event_id_t): New forward decl. ++ * diagnostic-color.c (color_dict): Add "path". ++ * diagnostic-event-id.h: New file. ++ * diagnostic-format-json.cc (json_from_expanded_location): Make ++ non-static. ++ (json_end_diagnostic): Call context->make_json_for_path if it ++ exists and the diagnostic has a path. ++ (diagnostic_output_format_init): Clear context->print_path. ++ * diagnostic-path.h: New file. ++ * diagnostic-show-locus.c (colorizer::set_range): Special-case ++ when printing a run of events in a diagnostic_path so that they ++ all get the same color. ++ (layout::m_diagnostic_path_p): New field. ++ (layout::layout): Initialize it. ++ (layout::print_any_labels): Don't colorize the label text for an ++ event in a diagnostic_path. ++ (gcc_rich_location::add_location_if_nearby): Add ++ "restrict_to_current_line_spans" and "label" params. Pass the ++ former to layout.maybe_add_location_range; pass the latter ++ when calling add_range. ++ * diagnostic.c: Include "diagnostic-path.h". ++ (diagnostic_initialize): Initialize context->path_format and ++ context->show_path_depths. ++ (diagnostic_show_any_path): New function. ++ (diagnostic_path::interprocedural_p): New function. ++ (diagnostic_report_diagnostic): Call diagnostic_show_any_path. ++ (simple_diagnostic_path::num_events): New function. ++ (simple_diagnostic_path::get_event): New function. ++ (simple_diagnostic_path::add_event): New function. ++ (simple_diagnostic_event::simple_diagnostic_event): New ctor. ++ (simple_diagnostic_event::~simple_diagnostic_event): New dtor. ++ (debug): New overload taking a diagnostic_path *. ++ * diagnostic.def (DK_DIAGNOSTIC_PATH): New. ++ * diagnostic.h (enum diagnostic_path_format): New enum. ++ (json::value): New forward decl. ++ (diagnostic_context::path_format): New field. ++ (diagnostic_context::show_path_depths): New field. ++ (diagnostic_context::print_path): New callback field. ++ (diagnostic_context::make_json_for_path): New callback field. ++ (diagnostic_show_any_path): New decl. ++ (json_from_expanded_location): New decl. ++ * doc/invoke.texi (-fdiagnostics-path-format=3D): New option. ++ (-fdiagnostics-show-path-depths): New option. ++ (-fdiagnostics-color): Add "path" to description of default ++ GCC_COLORS; describe it. ++ (-fdiagnostics-format=3Djson): Document how diagnostic paths are ++ represented in the JSON output format. ++ * gcc-rich-location.h (gcc_rich_location::add_location_if_nearby): ++ Add optional params "restrict_to_current_line_spans" and "label". ++ * opts.c (common_handle_option): Handle ++ OPT_fdiagnostics_path_format_ and ++ OPT_fdiagnostics_show_path_depths. ++ * pretty-print.c: Include "diagnostic-event-id.h". ++ (pp_format): Implement "%@" format code for printing ++ diagnostic_event_id_t *. ++ (selftest::test_pp_format): Add tests for "%@". ++ * selftest-run-tests.c (selftest::run_tests): Call ++ selftest::tree_diagnostic_path_cc_tests. ++ * selftest.h (selftest::tree_diagnostic_path_cc_tests): New decl. ++ * toplev.c (general_init): Initialize global_dc->path_format and ++ global_dc->show_path_depths. ++ * tree-diagnostic-path.cc: New file. ++ * tree-diagnostic.c (maybe_unwind_expanded_macro_loc): Make ++ non-static. Drop "diagnostic" param in favor of storing the ++ original value of "where" and re-using it. ++ (virt_loc_aware_diagnostic_finalizer): Update for dropped param of ++ maybe_unwind_expanded_macro_loc. ++ (tree_diagnostics_defaults): Initialize context->print_path and ++ context->make_json_for_path. ++ * tree-diagnostic.h (default_tree_diagnostic_path_printer): New ++ decl. ++ (default_tree_make_json_for_path): New decl. ++ (maybe_unwind_expanded_macro_loc): New decl. ++ ++2020-01-10 Jakub Jelinek ++ ++ PR tree-optimization/93210 ++ * fold-const.h (native_encode_initializer, ++ can_native_interpret_type_p): Declare. ++ * fold-const.c (native_encode_string): Fix up handling with off !=3D -1, ++ simplify. ++ (native_encode_initializer): New function, moved from dwarf2out.c. ++ Adjust to native_encode_expr compatible arguments, including dry-run ++ and partial extraction modes. Don't handle STRING_CST. ++ (can_native_interpret_type_p): No longer static. ++ * gimple-fold.c (fold_ctor_reference): For native_encode_expr, verify ++ offset / BITS_PER_UNIT fits into int and don't call it if ++ can_native_interpret_type_p fails. If suboff is NULL and for ++ CONSTRUCTOR fold_{,non}array_ctor_reference returns NULL, retry with ++ native_encode_initializer. ++ (fold_const_aggregate_ref_1): Formatting fix. ++ * dwarf2out.c (native_encode_initializer): Moved to fold-const.c. ++ (tree_add_const_value_attribute): Adjust caller. ++ ++ PR tree-optimization/90838 ++ * tree-ssa-forwprop.c (simplify_count_trailing_zeroes): Use ++ SCALAR_INT_TYPE_MODE instead of TYPE_MODE as operand of ++ CTZ_DEFINED_VALUE_AT_ZERO. ++ ++2020-01-10 Vladimir Makarov ++ ++ PR inline-asm/93027 ++ * lra-constraints.c (match_reload): Permit input operands have the ++ same mode as output while other input operands have a different ++ mode. ++ ++2020-01-10 Wilco Dijkstra ++ ++ PR tree-optimization/90838 ++ * tree-ssa-forwprop.c (check_ctz_array): Add new function. ++ (check_ctz_string): Likewise. ++ (optimize_count_trailing_zeroes): Likewise. ++ (simplify_count_trailing_zeroes): Likewise. ++ (pass_forwprop::execute): Try ctz simplification. ++ * match.pd: Add matching for ctz idioms. ++ ++2020-01-10 Stam Markianos-Wright ++ ++ * config/aarch64/aarch64.c (aarch64_invalid_conversion): New function ++ for target hook. ++ (aarch64_invalid_unary_op): New function for target hook. ++ (aarch64_invalid_binary_op): New function for target hook. ++ ++2020-01-10 Stam Markianos-Wright ++ ++ * config.gcc: Add arm_bf16.h. ++ * config/aarch64/aarch64-builtins.c ++ (aarch64_simd_builtin_std_type): Add BFmode. ++ (aarch64_init_simd_builtin_types): Define element types for vector ++ types. ++ (aarch64_init_bf16_types): New function. ++ (aarch64_general_init_builtins): Add arm_init_bf16_types function call. ++ * config/aarch64/aarch64-modes.def: Add BFmode and V4BF, V8BF vector ++ modes. ++ * config/aarch64/aarch64-simd-builtin-types.def: Add BF SIMD types. ++ * config/aarch64/aarch64-simd.md: Add BF vector types to NEON move ++ patterns. ++ * config/aarch64/aarch64.h (AARCH64_VALID_SIMD_DREG_MODE): Add V4BF. ++ (AARCH64_VALID_SIMD_QREG_MODE): Add V8BF. ++ * config/aarch64/aarch64.c ++ (aarch64_classify_vector_mode): Add support for BF types. ++ (aarch64_gimplify_va_arg_expr): Add support for BF types. ++ (aarch64_vq_mode): Add support for BF types. ++ (aarch64_simd_container_mode): Add support for BF types. ++ (aarch64_mangle_type): Add support for BF scalar type. ++ * config/aarch64/aarch64.md: Add BFmode to movhf pattern. ++ * config/aarch64/arm_bf16.h: New file. ++ * config/aarch64/arm_neon.h: Add arm_bf16.h and Bfloat vector types. ++ * config/aarch64/iterators.md: Add BF types to mode attributes. ++ (HFBF, GPF_TF_F16_MOV, VDMOV, VQMOV, VQMOV_NO2Em VALL_F16MOV): New. +=20 +- * config/rs6000/rs6000-cpus.def (ISA_3_0_MASKS_SERVER): Enable +- -mpower9-minmax by default for -mcpu=3Dpower9. +- (ISA_3_MASKS_IEEE): Require -mvsx-small-integer to enable IEEE +- 128-bit floating point. ++2020-01-10 Jason Merrill +=20 +-2017-01-20 Alan Modra ++ PR c++/93173 - incorrect tree sharing. ++ * gimplify.c (copy_if_shared): No longer static. ++ * gimplify.h: Declare it. ++ ++2020-01-10 Richard Sandiford +=20 +- * config/rs6000/rs6000.md (cmpstrnsi, cmpstrsi): Fail if +- optimizing for size. ++ * doc/invoke.texi (-msve-vector-bits=3D): Document that ++ -msve-vector-bits=3D128 now generates VL-specific code for ++ little-endian targets. ++ * config/aarch64/aarch64-sve-builtins.cc (register_builtin_types): Use ++ build_vector_type_for_mode to construct the data vector types. ++ * config/aarch64/aarch64.c (aarch64_convert_sve_vector_bits): Generate ++ VL-specific code for -msve-vector-bits=3D128 on little-endian targets. ++ (aarch64_simd_container_mode): Always prefer Advanced SIMD modes ++ for 128-bit vectors. +=20 +-2017-01-20 Alan Modra ++2020-01-10 Richard Sandiford +=20 +- PR target/79144 +- * config/rs6000/rs6000.c (expand_strn_compare): Get the asm name +- for strcmp and strncmp from corresponding builtin decl. ++ * config/aarch64/aarch64.c (aarch64_evpc_sel): Fix gen_vcond_mask ++ invocation. +=20 +-2017-01-19 Uros Bizjak ++2020-01-10 Richard Sandiford +=20 +- * config.gcc (x86_64-*-rtems*): Use i386/rtemself.h +- instead of i386/rtems-64.h. +- * config/i386/rtems-64.h: Remove. ++ * config/aarch64/aarch64-builtins.c ++ (aarch64_builtin_vectorized_function): Check for specific vector modes, ++ rather than checking the number of elements and the element mode. ++ ++2020-01-10 Richard Sandiford ++ ++ * tree-vect-loop.c (vect_create_epilog_for_reduction): Use ++ get_related_vectype_for_scalar_type rather than build_vector_type ++ to create the index type for a conditional reduction. ++ ++2020-01-10 Richard Sandiford ++ ++ * tree-vect-loop.c (update_epilogue_loop_vinfo): Update DR_REF ++ for any type of gather or scatter, including strided accesses. ++ ++2020-01-10 Andre Vieira ++ ++ * tree-vectorizer.h (get_dr_vinfo_offset): Add missing function ++ comment. ++ ++2020-01-10 Andre Vieira ++ ++ * tree-vect-data-refs.c (vect_create_addr_base_for_vector_ref): Use ++ get_dr_vinfo_offset ++ * tree-vect-loop.c (update_epilogue_loop_vinfo): Remove orig_drs_init ++ parameter and its use to reset DR_OFFSET's. ++ (vect_transform_loop): Remove orig_drs_init argument. ++ * tree-vect-loop-manip.c (vect_update_init_of_dr): Update the offset ++ member of dr_vec_info rather than the offset of the associated ++ data_reference's innermost_loop_behavior. ++ (vect_update_init_of_dr): Pass dr_vec_info instead of data_reference. ++ (vect_do_peeling): Remove orig_drs_init parameter and its construction. ++ * tree-vect-stmts.c (check_scan_store): Replace use of DR_OFFSET with ++ get_dr_vinfo_offset. ++ (vectorizable_store): Likewise. ++ (vectorizable_load): Likewise. ++ ++2020-01-10 Richard Biener ++ ++ * gimple-ssa-store-merging ++ (pass_store_merging::terminate_all_aliasing_chains): Cache alias info. ++ ++2020-01-10 Martin Liska ++ ++ PR ipa/93217 ++ * ipa-inline-analysis.c (offline_size): Make proper parenthesis ++ encapsulation that was there before r280040. ++ ++2020-01-10 Richard Biener ++ ++ PR middle-end/93199 ++ * tree-eh.c (sink_clobbers): Move clobbers to out-of-IL ++ sequences to avoid walking them again for secondary opportunities. ++ (pass_lower_eh_dispatch::execute): Instead actually insert ++ them here. ++ ++2020-01-10 Richard Biener ++ ++ PR middle-end/93199 ++ * tree-eh.c (redirect_eh_edge_1): Avoid some work if possible. ++ (cleanup_all_empty_eh): Walk landing pads in reverse order to ++ avoid quadraticness. ++ ++2020-01-10 Martin Jambor ++ ++ * params.opt (param_ipa_sra_max_replacements): Mark as Optimization. ++ * ipa-sra.c (pull_accesses_from_callee): New parameter caller, use it ++ to get param_ipa_sra_max_replacements. ++ (param_splitting_across_edge): Pass the caller to ++ pull_accesses_from_callee. ++ ++2020-01-10 Martin Jambor ++ ++ * params.opt (param_ipcp_unit_growth): Mark as Optimization. ++ * ipa-cp.c (max_new_size): Removed. ++ (orig_overall_size): New variable. ++ (get_max_overall_size): New function. ++ (estimate_local_effects): Use it. Adjust dump. ++ (decide_about_value): Likewise. ++ (ipcp_propagate_stage): Do not calculate max_new_size, just store ++ orig_overall_size. Adjust dump. ++ (ipa_cp_c_finalize): Clear orig_overall_size instead of max_new_size. ++ ++2020-01-10 Martin Jambor ++ ++ * params.opt (param_ipa_max_agg_items): Mark as Optimization ++ * ipa-cp.c (merge_agg_lats_step): New parameter max_agg_items, use ++ instead of param_ipa_max_agg_items. ++ (merge_aggregate_lattices): Extract param_ipa_max_agg_items from ++ optimization info for the callee. ++ ++2020-01-09 Kwok Cheung Yeung ++ ++ * lto-streamer-in.c (input_function): Remove streamed-in inline debug ++ markers if debug_inline_points is false. ++ ++2020-01-09 Richard Sandiford ++ ++ * config.gcc (aarch64*-*-*): Add aarch64-sve-builtins-sve2.o to ++ extra_objs. ++ * config/aarch64/t-aarch64 (aarch64-sve-builtins.o): Depend on ++ aarch64-sve-builtins-base.def, aarch64-sve-builtins-sve2.def and ++ aarch64-sve-builtins-sve2.h. ++ (aarch64-sve-builtins-sve2.o): New rule. ++ * config/aarch64/aarch64.h (AARCH64_ISA_SVE2_AES): New macro. ++ (AARCH64_ISA_SVE2_BITPERM, AARCH64_ISA_SVE2_SHA3): Likewise. ++ (AARCH64_ISA_SVE2_SM4, TARGET_SVE2_AES, TARGET_SVE2_BITPERM): Likewise. ++ (TARGET_SVE2_SHA, TARGET_SVE2_SM4): Likewise. ++ * config/aarch64/aarch64-c.c (aarch64_update_cpp_builtins): Handle ++ TARGET_SVE2_AES, TARGET_SVE2_BITPERM, TARGET_SVE2_SHA3 and ++ TARGET_SVE2_SM4. ++ * config/aarch64/aarch64-sve.md: Update comments with SVE2 ++ instructions that are handled here. ++ (@cond_asrd): Generalize to... ++ (@cond_): ...this. ++ (*cond_asrd_2): Generalize to... ++ (*cond__2): ...this. ++ (*cond_asrd_z): Generalize to... ++ (*cond__z): ...this. ++ * config/aarch64/aarch64.md (UNSPEC_LDNT1_GATHER): New unspec. ++ (UNSPEC_STNT1_SCATTER, UNSPEC_WHILEGE, UNSPEC_WHILEGT): Likewise. ++ (UNSPEC_WHILEHI, UNSPEC_WHILEHS): Likewise. ++ * config/aarch64/aarch64-sve2.md (@aarch64_gather_ldnt): New ++ pattern. ++ (@aarch64_gather_ldnt_) ++ (@aarch64_scatter_stnt): Likewise. ++ (@aarch64_scatter_stnt_) ++ (@aarch64_mul_lane_): Likewise. ++ (@aarch64_sve_suqadd_const): Likewise. ++ (*h): Generalize to... ++ (@aarch64_pred_): ...this ++ new pattern. ++ (@cond_): New expander. ++ (*cond__2): New pattern. ++ (*cond__3): Likewise. ++ (*cond__any): Likewise. ++ (*cond__z): Likewise. ++ (@aarch64_sve_):: Likewise. ++ (@aarch64_sve__lane_): Likewise. ++ (@aarch64_pred_): Likewise. ++ (@cond_): New expander. ++ (*cond__2): New pattern. ++ (*cond__3): Likewise. ++ (*cond__any): Likewise. ++ (@aarch64_sve_): Likewise. ++ (@aarch64_sve__lane_) ++ (@aarch64_sve_add_mul_lane_): Likewise. ++ (@aarch64_sve_sub_mul_lane_): Likewise. ++ (@aarch64_sve2_xar): Likewise. ++ (@aarch64_sve2_bcax): Likewise. ++ (*aarch64_sve2_eor3): Rename to... ++ (@aarch64_sve2_eor3): ...this. ++ (@aarch64_sve2_bsl): New expander. ++ (@aarch64_sve2_nbsl): Likewise. ++ (@aarch64_sve2_bsl1n): Likewise. ++ (@aarch64_sve2_bsl2n): Likewise. ++ (@aarch64_sve_add_): Likewise. ++ (*aarch64_sve2_sra): Add MOVPRFX support. ++ (@aarch64_sve_add_): New pattern. ++ (@aarch64_sve_): Likewise. ++ (@aarch64_sve2_aba): New expander. ++ (*aarch64_sve2_aba): New pattern. ++ (@aarch64_sve_): Likewise. ++ (mull): Generalize to... ++ (@aarch64_sve_): ...this new ++ pattern. ++ (@aarch64_sve__lane_) ++ (@aarch64_sve_) ++ (@aarch64_sve_add_) ++ (@aarch64_sve_add__lane_) ++ (@aarch64_sve_qadd_) ++ (@aarch64_sve_qadd__lane_) ++ (@aarch64_sve_sub_) ++ (@aarch64_sve_sub__lane_) ++ (@aarch64_sve_qsub_) ++ (@aarch64_sve_qsub__lane_) ++ (@aarch64_sve_): New patterns. ++ (@aarch64__lane_) ++ (@aarch64_sve_): Likewise. ++ (@aarch64_sve_): Likewise. ++ (@aarch64_sve_): Likewise. ++ (@aarch64_sve_): Likewise. ++ (shrnb): Generalize to... ++ (@aarch64_sve_): ...this ++ new pattern. ++ (shrnt): Generalize to... ++ (@aarch64_sve_): ...this ++ new pattern. ++ (@aarch64_pred_): New pattern. ++ (@aarch64_pred_): Likewise. ++ (@cond_): New expander. ++ (*cond__2): New pattern. ++ (*cond__z): Likewise. ++ (@aarch64_sve_): Likewise. ++ (@aarch64_sve_): Likewise. ++ (@aarch64__lane_): Likewise. ++ (@aarch64_sve_): Likewise. ++ (@aarch64__lane_): Likewise. ++ (@aarch64_pred_): Likewise. ++ (@cond_): New expander. ++ (*cond_): New pattern. ++ (@aarch64_sve2_cvtnt): Likewise. ++ (@aarch64_pred_): Likewise. ++ (@cond_): New expander. ++ (*cond__any): New pattern. ++ (@aarch64_sve2_cvtxnt): Likewise. ++ (@aarch64_pred_): Likewise. ++ (@cond_): New expander. ++ (*cond_): New pattern. ++ (@aarch64_pred_): Likewise. ++ (@cond_): New expander. ++ (*cond_): New pattern. ++ (@aarch64_sve2_pmul): Likewise. ++ (@aarch64_sve_): Likewise. ++ (@aarch64_sve_): Likewise. ++ (@aarch64_sve2_tbl2): Likewise. ++ (@aarch64_sve2_tbx): Likewise. ++ (@aarch64_sve_): Likewise. ++ (@aarch64_sve2_histcnt): Likewise. ++ (@aarch64_sve2_histseg): Likewise. ++ (@aarch64_pred_): Likewise. ++ (*aarch64_pred__cc): Likewise. ++ (*aarch64_pred__ptest): Likewise. ++ (aarch64_sve2_aes): Likewise. ++ (aarch64_sve2_aes): Likewise. ++ (*aarch64_sve2_aese_fused, *aarch64_sve2_aesd_fused): Likewise. ++ (aarch64_sve2_rax1, aarch64_sve2_sm4e, aarch64_sve2_sm4ekey): Likewise. ++ (mulhs3): Update after above pattern name changes. ++ * config/aarch64/iterators.md (VNx16QI_ONLY, VNx4SF_ONLY) ++ (SVE_STRUCT2, SVE_FULL_BHI, SVE_FULL_HSI, SVE_FULL_HDI) ++ (SVE2_PMULL_PAIR_I): New mode iterators. ++ (UNSPEC_ADCLB, UNSPEC_ADCLT, UNSPEC_ADDHNB, UNSPEC_ADDHNT, UNSPEC_BDEP) ++ (UNSPEC_BEXT, UNSPEC_BGRP, UNSPEC_CADD90, UNSPEC_CADD270, UNSPEC_CDOT) ++ (UNSPEC_CDOT90, UNSPEC_CDOT180, UNSPEC_CDOT270, UNSPEC_CMLA) ++ (UNSPEC_CMLA90, UNSPEC_CMLA180, UNSPEC_CMLA270, UNSPEC_COND_FCVTLT) ++ (UNSPEC_COND_FCVTNT, UNSPEC_COND_FCVTX, UNSPEC_COND_FCVTXNT) ++ (UNSPEC_COND_FLOGB, UNSPEC_EORBT, UNSPEC_EORTB, UNSPEC_FADDP) ++ (UNSPEC_FMAXP, UNSPEC_FMAXNMP, UNSPEC_FMLALB, UNSPEC_FMLALT) ++ (UNSPEC_FMLSLB, UNSPEC_FMLSLT, UNSPEC_FMINP, UNSPEC_FMINNMP) ++ (UNSPEC_HISTCNT, UNSPEC_HISTSEG, UNSPEC_MATCH, UNSPEC_NMATCH) ++ (UNSPEC_PMULLB, UNSPEC_PMULLB_PAIR, UNSPEC_PMULLT, UNSPEC_PMULLT_PAIR) ++ (UNSPEC_RADDHNB, UNSPEC_RADDHNT, UNSPEC_RSUBHNB, UNSPEC_RSUBHNT) ++ (UNSPEC_SLI, UNSPEC_SRI, UNSPEC_SABDLB, UNSPEC_SABDLT, UNSPEC_SADDLB) ++ (UNSPEC_SADDLBT, UNSPEC_SADDLT, UNSPEC_SADDWB, UNSPEC_SADDWT) ++ (UNSPEC_SBCLB, UNSPEC_SBCLT, UNSPEC_SMAXP, UNSPEC_SMINP) ++ (UNSPEC_SQCADD90, UNSPEC_SQCADD270, UNSPEC_SQDMULLB, UNSPEC_SQDMULLBT) ++ (UNSPEC_SQDMULLT, UNSPEC_SQRDCMLAH, UNSPEC_SQRDCMLAH90) ++ (UNSPEC_SQRDCMLAH180, UNSPEC_SQRDCMLAH270, UNSPEC_SQRSHRNB) ++ (UNSPEC_SQRSHRNT, UNSPEC_SQRSHRUNB, UNSPEC_SQRSHRUNT, UNSPEC_SQSHRNB) ++ (UNSPEC_SQSHRNT, UNSPEC_SQSHRUNB, UNSPEC_SQSHRUNT, UNSPEC_SQXTNB) ++ (UNSPEC_SQXTNT, UNSPEC_SQXTUNB, UNSPEC_SQXTUNT, UNSPEC_SSHLLB) ++ (UNSPEC_SSHLLT, UNSPEC_SSUBLB, UNSPEC_SSUBLBT, UNSPEC_SSUBLT) ++ (UNSPEC_SSUBLTB, UNSPEC_SSUBWB, UNSPEC_SSUBWT, UNSPEC_SUBHNB) ++ (UNSPEC_SUBHNT, UNSPEC_TBL2, UNSPEC_UABDLB, UNSPEC_UABDLT) ++ (UNSPEC_UADDLB, UNSPEC_UADDLT, UNSPEC_UADDWB, UNSPEC_UADDWT) ++ (UNSPEC_UMAXP, UNSPEC_UMINP, UNSPEC_UQRSHRNB, UNSPEC_UQRSHRNT) ++ (UNSPEC_UQSHRNB, UNSPEC_UQSHRNT, UNSPEC_UQXTNB, UNSPEC_UQXTNT) ++ (UNSPEC_USHLLB, UNSPEC_USHLLT, UNSPEC_USUBLB, UNSPEC_USUBLT) ++ (UNSPEC_USUBWB, UNSPEC_USUBWT): New unspecs. ++ (UNSPEC_SMULLB, UNSPEC_SMULLT, UNSPEC_UMULLB, UNSPEC_UMULLT) ++ (UNSPEC_SMULHS, UNSPEC_SMULHRS, UNSPEC_UMULHS, UNSPEC_UMULHRS) ++ (UNSPEC_RSHRNB, UNSPEC_RSHRNT, UNSPEC_SHRNB, UNSPEC_SHRNT): Move ++ further down file. ++ (VNARROW, Ventype): New mode attributes. ++ (Vewtype): Handle VNx2DI. Fix typo in comment. ++ (VDOUBLE): New mode attribute. ++ (sve_lane_con): Handle VNx8HI. ++ (SVE_INT_UNARY): Include ss_abs and ss_neg for TARGET_SVE2. ++ (SVE_INT_BINARY): Likewise ss_plus, us_plus, ss_minus and us_minus. ++ (sve_int_op, sve_int_op_rev): Handle the above codes. ++ (sve_pred_int_rhs2_operand): Likewise. ++ (MULLBT, SHRNB, SHRNT): Delete. ++ (SVE_INT_SHIFT_IMM): New int iterator. ++ (SVE_WHILE): Add UNSPEC_WHILEGE, UNSPEC_WHILEGT, UNSPEC_WHILEHI ++ and UNSPEC_WHILEHS for TARGET_SVE2. ++ (SVE2_U32_UNARY, SVE2_INT_UNARY_NARROWB, SVE2_INT_UNARY_NARROWT) ++ (SVE2_INT_BINARY, SVE2_INT_BINARY_LANE, SVE2_INT_BINARY_LONG) ++ (SVE2_INT_BINARY_LONG_LANE, SVE2_INT_BINARY_NARROWB) ++ (SVE2_INT_BINARY_NARROWT, SVE2_INT_BINARY_PAIR, SVE2_FP_BINARY_PAIR) ++ (SVE2_INT_BINARY_PAIR_LONG, SVE2_INT_BINARY_WIDE): New int iterators. ++ (SVE2_INT_SHIFT_IMM_LONG, SVE2_INT_SHIFT_IMM_NARROWB): Likewise. ++ (SVE2_INT_SHIFT_IMM_NARROWT, SVE2_INT_SHIFT_INSERT, SVE2_INT_CADD) ++ (SVE2_INT_BITPERM, SVE2_INT_TERNARY, SVE2_INT_TERNARY_LANE): Likewise. ++ (SVE2_FP_TERNARY_LONG, SVE2_FP_TERNARY_LONG_LANE, SVE2_INT_CMLA) ++ (SVE2_INT_CDOT, SVE2_INT_ADD_BINARY_LONG, SVE2_INT_QADD_BINARY_LONG) ++ (SVE2_INT_SUB_BINARY_LONG, SVE2_INT_QSUB_BINARY_LONG): Likewise. ++ (SVE2_INT_ADD_BINARY_LONG_LANE, SVE2_INT_QADD_BINARY_LONG_LANE) ++ (SVE2_INT_SUB_BINARY_LONG_LANE, SVE2_INT_QSUB_BINARY_LONG_LANE) ++ (SVE2_COND_INT_UNARY_FP, SVE2_COND_FP_UNARY_LONG): Likewise. ++ (SVE2_COND_FP_UNARY_NARROWB, SVE2_COND_INT_BINARY): Likewise. ++ (SVE2_COND_INT_BINARY_NOREV, SVE2_COND_INT_BINARY_REV): Likewise. ++ (SVE2_COND_INT_SHIFT, SVE2_MATCH, SVE2_PMULL): Likewise. ++ (optab): Handle the new unspecs. ++ (su, r): Remove entries for UNSPEC_SHRNB, UNSPEC_SHRNT, UNSPEC_RSHRNB ++ and UNSPEC_RSHRNT. ++ (lr): Handle the new unspecs. ++ (bt): Delete. ++ (cmp_op, while_optab_cmp, sve_int_op): Handle the new unspecs. ++ (sve_int_op_rev, sve_int_add_op, sve_int_qadd_op, sve_int_sub_op) ++ (sve_int_qsub_op): New int attributes. ++ (sve_fp_op, rot): Handle the new unspecs. ++ * config/aarch64/aarch64-sve-builtins.h ++ (function_resolver::require_matching_pointer_type): Declare. ++ (function_resolver::resolve_unary): Add an optional boolean argument. ++ (function_resolver::finish_opt_n_resolution): Add an optional ++ type_suffix_index argument. ++ (gimple_folder::redirect_call): Declare. ++ (gimple_expander::prepare_gather_address_operands): Add an optional ++ bool parameter. ++ * config/aarch64/aarch64-sve-builtins.cc: Include ++ aarch64-sve-builtins-sve2.h. ++ (TYPES_b_unsigned, TYPES_b_integer, TYPES_bh_integer): New macros. ++ (TYPES_bs_unsigned, TYPES_hs_signed, TYPES_hs_integer): Likewise. ++ (TYPES_hd_unsigned, TYPES_hsd_signed): Likewise. ++ (TYPES_hsd_integer): Use TYPES_hsd_signed. ++ (TYPES_s_float_hsd_integer, TYPES_s_float_sd_integer): New macros. ++ (TYPES_s_unsigned): Likewise. ++ (TYPES_s_integer): Use TYPES_s_unsigned. ++ (TYPES_sd_signed, TYPES_sd_unsigned): New macros. ++ (TYPES_sd_integer): Use them. ++ (TYPES_d_unsigned): New macro. ++ (TYPES_d_integer): Use it. ++ (TYPES_d_data, TYPES_cvt_long, TYPES_cvt_narrow_s): New macros. ++ (TYPES_cvt_narrow): Likewise. ++ (DEF_SVE_TYPES_ARRAY): Include the new types macros above. ++ (preds_mx): New variable. ++ (function_builder::add_overloaded_function): Allow the new feature ++ set to be more restrictive than the original one. ++ (function_resolver::infer_pointer_type): Remove qualifiers from ++ the pointer type before printing it. ++ (function_resolver::require_matching_pointer_type): New function. ++ (function_resolver::resolve_sv_displacement): Handle functions ++ that don't support 32-bit vector indices or svint32_t vector offsets. ++ (function_resolver::finish_opt_n_resolution): Take the inferred type ++ as a separate argument. ++ (function_resolver::resolve_unary): Optionally treat all forms in ++ the same way as normal merging functions. ++ (gimple_folder::redirect_call): New function. ++ (function_expander::prepare_gather_address_operands): Add an argument ++ that says whether scaled forms are available. If they aren't, ++ handle scaling of vector indices and don't add the extension and ++ scaling operands. ++ (function_expander::map_to_unspecs): If aarch64_sve isn't available, ++ fall back to using cond_* instead. ++ * config/aarch64/aarch64-sve-builtins-functions.h (rtx_code_function): ++ Split out the member variables into... ++ (rtx_code_function_base): ...this new base class. ++ (rtx_code_function_rotated): Inherit rtx_code_function_base. ++ (unspec_based_function): Split out the member variables into... ++ (unspec_based_function_base): ...this new base class. ++ (unspec_based_function_rotated): Inherit unspec_based_function_base. ++ (unspec_based_function_exact_insn): New class. ++ (unspec_based_add_function, unspec_based_add_lane_function) ++ (unspec_based_lane_function, unspec_based_pred_function) ++ (unspec_based_qadd_function, unspec_based_qadd_lane_function) ++ (unspec_based_qsub_function, unspec_based_qsub_lane_function) ++ (unspec_based_sub_function, unspec_based_sub_lane_function): New ++ typedefs. ++ (unspec_based_fused_function): New class. ++ (unspec_based_mla_function, unspec_based_mls_function): New typedefs. ++ (unspec_based_fused_lane_function): New class. ++ (unspec_based_mla_lane_function, unspec_based_mls_lane_function): New ++ typedefs. ++ (CODE_FOR_MODE1): New macro. ++ (fixed_insn_function): New class. ++ (while_comparison): Likewise. ++ * config/aarch64/aarch64-sve-builtins-shapes.h (binary_long_lane) ++ (binary_long_opt_n, binary_narrowb_opt_n, binary_narrowt_opt_n) ++ (binary_to_uint, binary_wide, binary_wide_opt_n, compare, compare_ptr) ++ (load_ext_gather_index_restricted, load_ext_gather_offset_restricted) ++ (load_gather_sv_restricted, shift_left_imm_long): Declare. ++ (shift_left_imm_to_uint, shift_right_imm_narrowb): Likewise. ++ (shift_right_imm_narrowt, shift_right_imm_narrowb_to_uint): Likewise. ++ (shift_right_imm_narrowt_to_uint, store_scatter_index_restricted) ++ (store_scatter_offset_restricted, tbl_tuple, ternary_long_lane) ++ (ternary_long_opt_n, ternary_qq_lane_rotate, ternary_qq_rotate) ++ (ternary_shift_left_imm, ternary_shift_right_imm, ternary_uint) ++ (unary_convert_narrowt, unary_long, unary_narrowb, unary_narrowt) ++ (unary_narrowb_to_uint, unary_narrowt_to_uint, unary_to_int): Likewise. ++ * config/aarch64/aarch64-sve-builtins-shapes.cc (apply_predication): ++ Also add an initial argument for unary_convert_narrowt, regardless ++ of the predication type. ++ (build_32_64): Allow loads and stores to specify MODE_none. ++ (build_sv_index64, build_sv_uint_offset): New functions. ++ (long_type_suffix): New function. ++ (binary_imm_narrowb_base, binary_imm_narrowt_base): New classes. ++ (binary_imm_long_base, load_gather_sv_base): Likewise. ++ (shift_right_imm_narrow_wrapper, ternary_shift_imm_base): Likewise. ++ (ternary_resize2_opt_n_base, ternary_resize2_lane_base): Likewise. ++ (unary_narrowb_base, unary_narrowt_base): Likewise. ++ (binary_long_lane_def, binary_long_lane): New shape. ++ (binary_long_opt_n_def, binary_long_opt_n): Likewise. ++ (binary_narrowb_opt_n_def, binary_narrowb_opt_n): Likewise. ++ (binary_narrowt_opt_n_def, binary_narrowt_opt_n): Likewise. ++ (binary_to_uint_def, binary_to_uint): Likewise. ++ (binary_wide_def, binary_wide): Likewise. ++ (binary_wide_opt_n_def, binary_wide_opt_n): Likewise. ++ (compare_def, compare): Likewise. ++ (compare_ptr_def, compare_ptr): Likewise. ++ (load_ext_gather_index_restricted_def, ++ load_ext_gather_index_restricted): Likewise. ++ (load_ext_gather_offset_restricted_def, ++ load_ext_gather_offset_restricted): Likewise. ++ (load_gather_sv_def): Inherit from load_gather_sv_base. ++ (load_gather_sv_restricted_def, load_gather_sv_restricted): New shape. ++ (shift_left_imm_def, shift_left_imm): Likewise. ++ (shift_left_imm_long_def, shift_left_imm_long): Likewise. ++ (shift_left_imm_to_uint_def, shift_left_imm_to_uint): Likewise. ++ (store_scatter_index_restricted_def, ++ store_scatter_index_restricted): Likewise. ++ (store_scatter_offset_restricted_def, ++ store_scatter_offset_restricted): Likewise. ++ (tbl_tuple_def, tbl_tuple): Likewise. ++ (ternary_long_lane_def, ternary_long_lane): Likewise. ++ (ternary_long_opt_n_def, ternary_long_opt_n): Likewise. ++ (ternary_qq_lane_def): Inherit from ternary_resize2_lane_base. ++ (ternary_qq_lane_rotate_def, ternary_qq_lane_rotate): New shape ++ (ternary_qq_opt_n_def): Inherit from ternary_resize2_opt_n_base. ++ (ternary_qq_rotate_def, ternary_qq_rotate): New shape. ++ (ternary_shift_left_imm_def, ternary_shift_left_imm): Likewise. ++ (ternary_shift_right_imm_def, ternary_shift_right_imm): Likewise. ++ (ternary_uint_def, ternary_uint): Likewise. ++ (unary_convert): Fix typo in comment. ++ (unary_convert_narrowt_def, unary_convert_narrowt): New shape. ++ (unary_long_def, unary_long): Likewise. ++ (unary_narrowb_def, unary_narrowb): Likewise. ++ (unary_narrowt_def, unary_narrowt): Likewise. ++ (unary_narrowb_to_uint_def, unary_narrowb_to_uint): Likewise. ++ (unary_narrowt_to_uint_def, unary_narrowt_to_uint): Likewise. ++ (unary_to_int_def, unary_to_int): Likewise. ++ * config/aarch64/aarch64-sve-builtins-base.cc (unspec_cmla) ++ (unspec_fcmla, unspec_cond_fcmla, expand_mla_mls_lane): New functions. ++ (svasrd_impl): Delete. ++ (svcadd_impl::expand): Handle integer operations too. ++ (svcmla_impl::expand, svcmla_lane::expand): Likewise, using the ++ new functions to derive the unspec numbers. ++ (svmla_svmls_lane_impl): Replace with... ++ (svmla_lane_impl, svmls_lane_impl): ...these new classes. Handle ++ integer operations too. ++ (svwhile_impl): Rename to... ++ (svwhilelx_impl): ...this and inherit from while_comparison. ++ (svasrd): Use unspec_based_function. ++ (svmla_lane): Use svmla_lane_impl. ++ (svmls_lane): Use svmls_lane_impl. ++ (svrecpe, svrsqrte): Handle unsigned integer operations too. ++ (svwhilele, svwhilelt): Use svwhilelx_impl. ++ * config/aarch64/aarch64-sve-builtins-sve2.h: New file. ++ * config/aarch64/aarch64-sve-builtins-sve2.cc: Likewise. ++ * config/aarch64/aarch64-sve-builtins-sve2.def: Likewise. ++ * config/aarch64/aarch64-sve-builtins.def: Include ++ aarch64-sve-builtins-sve2.def. ++ ++2020-01-09 Richard Sandiford ++ ++ * config/aarch64/aarch64-protos.h (aarch64_sve_arith_immediate_p) ++ (aarch64_sve_sqadd_sqsub_immediate_p): Add a machine_mode argument. ++ * config/aarch64/aarch64.c (aarch64_sve_arith_immediate_p) ++ (aarch64_sve_sqadd_sqsub_immediate_p): Likewise. Handle scalar ++ immediates as well as vector ones. ++ * config/aarch64/predicates.md (aarch64_sve_arith_immediate) ++ (aarch64_sve_sub_arith_immediate, aarch64_sve_qadd_immediate) ++ (aarch64_sve_qsub_immediate): Update calls accordingly. ++ ++2020-01-09 Richard Sandiford ++ ++ * config/aarch64/aarch64-sve2.md: Add banner comments. ++ (mulhs3): Move further up file. ++ (mull, shrnb, shrnt) ++ (*aarch64_sve2_sra): Move further down file. ++ * config/aarch64/t-aarch64 (s-check-sve-md): Check aarch64-sve2.md too. ++ ++2020-01-09 Richard Sandiford ++ ++ * config/aarch64/iterators.md (SVE_WHILE): Add UNSPEC_WHILERW ++ and UNSPEC_WHILEWR. ++ (while_optab_cmp): Handle them. ++ * config/aarch64/aarch64-sve.md ++ (*while__ptest): Make public ++ and add a "@" marker. ++ * config/aarch64/aarch64-sve2.md (check__ptrs): Use it ++ instead of gen_aarch64_sve2_while_ptest. ++ (@aarch64_sve2_while_ptest): Delete. ++ ++2020-01-09 Richard Sandiford ++ ++ * config/aarch64/aarch64.md (UNSPEC_WHILE_LE): Rename to... ++ (UNSPEC_WHILELE): ...this. ++ (UNSPEC_WHILE_LO): Rename to... ++ (UNSPEC_WHILELO): ...this. ++ (UNSPEC_WHILE_LS): Rename to... ++ (UNSPEC_WHILELS): ...this. ++ (UNSPEC_WHILE_LT): Rename to... ++ (UNSPEC_WHILELT): ...this. ++ * config/aarch64/iterators.md (SVE_WHILE): Update accordingly. ++ (cmp_op, while_optab_cmp): Likewise. ++ * config/aarch64/aarch64.c (aarch64_sve_move_pred_via_while): Likewise. ++ * config/aarch64/aarch64-sve-builtins-base.cc (svwhilele): Likewise. ++ (svwhilelt): Likewise. ++ ++2020-01-09 Richard Sandiford ++ ++ * config/aarch64/aarch64-sve-builtins-shapes.h (unary_count): Delete. ++ (unary_to_uint): Define. ++ * config/aarch64/aarch64-sve-builtins-shapes.cc (unary_count_def) ++ (unary_count): Rename to... ++ (unary_to_uint_def, unary_to_uint): ...this. ++ * config/aarch64/aarch64-sve-builtins-base.def: Update accordingly. ++ ++2020-01-09 Richard Sandiford ++ ++ * config/aarch64/aarch64-sve-builtins-functions.h ++ (code_for_mode_function): New class. ++ (CODE_FOR_MODE0, QUIET_CODE_FOR_MODE0): New macros. ++ * config/aarch64/aarch64-sve-builtins-base.cc (svcompact_impl) ++ (svext_impl, svmul_lane_impl, svsplice_impl, svtmad_impl): Delete. ++ (svcompact, svext, svsplice): Use QUIET_CODE_FOR_MODE0. ++ (svmul_lane, svtmad): Use CODE_FOR_MODE0. ++ ++2020-01-09 Richard Sandiford ++ ++ * config/aarch64/iterators.md (addsub): New code attribute. ++ * config/aarch64/aarch64-simd.md (aarch64_): ++ Re-express as... ++ (aarch64_q): ...this, making the same change ++ in the asm string and attributes. Fix indentation. ++ * config/aarch64/aarch64-sve.md (@aarch64_): ++ Re-express as... ++ (@aarch64_sve_): ...this. ++ * config/aarch64/aarch64-sve-builtins.h ++ (function_expander::expand_signed_unpred_op): Delete. ++ * config/aarch64/aarch64-sve-builtins.cc ++ (function_expander::expand_signed_unpred_op): Likewise. ++ (function_expander::map_to_rtx_codes): If the optab isn't defined, ++ try using code_for_aarch64_sve instead. ++ * config/aarch64/aarch64-sve-builtins-base.cc (svqadd_impl): Delete. ++ (svqsub_impl): Likewise. ++ (svqadd, svqsub): Use rtx_code_function instead. ++ ++2020-01-09 Richard Sandiford ++ ++ * config/aarch64/iterators.md (SRHSUB, URHSUB): Delete. ++ (HADDSUB, sur, addsub): Remove them. ++ ++2020-01-09 Richard Sandiford ++ ++ * tree-nrv.c (pass_return_slot::execute): Handle all internal ++ functions the same way, rather than singling out those that ++ aren't mapped directly to optabs. ++ ++2020-01-09 Richard Sandiford ++ ++ * target.def (compatible_vector_types_p): New target hook. ++ * hooks.h (hook_bool_const_tree_const_tree_true): Declare. ++ * hooks.c (hook_bool_const_tree_const_tree_true): New function. ++ * doc/tm.texi.in (TARGET_COMPATIBLE_VECTOR_TYPES_P): New hook. ++ * doc/tm.texi: Regenerate. ++ * gimple-expr.c: Include target.h. ++ (useless_type_conversion_p): Use targetm.compatible_vector_types_p. ++ * config/aarch64/aarch64.c (aarch64_compatible_vector_types_p): New ++ function. ++ (TARGET_COMPATIBLE_VECTOR_TYPES_P): Define. ++ * config/aarch64/aarch64-sve-builtins.cc (gimple_folder::convert_pred): ++ Use the original predicate if it already has a suitable type. ++ ++2020-01-09 Martin Jambor ++ ++ * cgraph.h (cgraph_edge): Make remove, set_call_stmt, make_direct, ++ resolve_speculation and redirect_call_stmt_to_callee static. Change ++ return type of set_call_stmt to cgraph_edge *. ++ * auto-profile.c (afdo_indirect_call): Adjust call to ++ redirect_call_stmt_to_callee. ++ * cgraph.c (cgraph_edge::set_call_stmt): Make return cgraph-edge *, ++ make the this pointer explicit, adjust self-recursive calls and the ++ call top make_direct. Return the resulting edge. ++ (cgraph_edge::remove): Make this pointer explicit. ++ (cgraph_edge::resolve_speculation): Likewise, adjust call to remove. ++ (cgraph_edge::make_direct): Likewise, adjust call to ++ resolve_speculation. ++ (cgraph_edge::redirect_call_stmt_to_callee): Likewise, also adjust ++ call to set_call_stmt. ++ (cgraph_update_edges_for_call_stmt_node): Update call to ++ set_call_stmt and remove. ++ * cgraphclones.c (cgraph_node::set_call_stmt_including_clones): ++ Renamed edge to master_edge. Adjusted calls to set_call_stmt. ++ (cgraph_node::create_edge_including_clones): Moved "first" definition ++ of edge to the block where it was used. Adjusted calls to ++ set_call_stmt. ++ (cgraph_node::remove_symbol_and_inline_clones): Adjust call to ++ cgraph_edge::remove. ++ * cgraphunit.c (walk_polymorphic_call_targets): Adjusted calls to ++ make_direct and redirect_call_stmt_to_callee. ++ * ipa-fnsummary.c (redirect_to_unreachable): Adjust calls to ++ resolve_speculation and make_direct. ++ * ipa-inline-transform.c (inline_transform): Adjust call to ++ redirect_call_stmt_to_callee. ++ (check_speculations_1):: Adjust call to resolve_speculation. ++ * ipa-inline.c (resolve_noninline_speculation): Adjust call to ++ resolve-speculation. ++ (inline_small_functions): Adjust call to resolve_speculation. ++ (ipa_inline): Likewise. ++ * ipa-prop.c (ipa_make_edge_direct_to_target): Adjust call to ++ make_direct. ++ * ipa-visibility.c (function_and_variable_visibility): Make iteration ++ safe with regards to edge removal, adjust calls to ++ redirect_call_stmt_to_callee. ++ * ipa.c (walk_polymorphic_call_targets): Adjust calls to make_direct ++ and redirect_call_stmt_to_callee. ++ * multiple_target.c (create_dispatcher_calls): Adjust call to ++ redirect_call_stmt_to_callee ++ (redirect_to_specific_clone): Likewise. ++ * tree-cfgcleanup.c (delete_unreachable_blocks_update_callgraph): ++ Adjust calls to cgraph_edge::remove. ++ * tree-inline.c (copy_bb): Adjust call to set_call_stmt. ++ (redirect_all_calls): Adjust call to redirect_call_stmt_to_callee. ++ (expand_call_inline): Adjust call to cgraph_edge::remove. ++ ++2020-01-09 Martin Liska ++ ++ * params.opt: Set Optimization for ++ param_max_speculative_devirt_maydefs. ++ ++2020-01-09 Martin Sebor ++ ++ PR middle-end/93200 ++ PR fortran/92956 ++ * builtins.c (compute_objsize): Avoid handling MEM_REFs of vector type. ++ ++2020-01-09 Martin Liska ++ ++ * auto-profile.c (auto_profile): Use opt_for_fn ++ for a parameter. ++ * ipa-cp.c (ipcp_lattice::add_value): Likewise. ++ (propagate_vals_across_arith_jfunc): Likewise. ++ (hint_time_bonus): Likewise. ++ (incorporate_penalties): Likewise. ++ (good_cloning_opportunity_p): Likewise. ++ (perform_estimation_of_a_value): Likewise. ++ (estimate_local_effects): Likewise. ++ (ipcp_propagate_stage): Likewise. ++ * ipa-fnsummary.c (decompose_param_expr): Likewise. ++ (set_switch_stmt_execution_predicate): Likewise. ++ (analyze_function_body): Likewise. ++ * ipa-inline-analysis.c (offline_size): Likewise. ++ * ipa-inline.c (early_inliner): Likewise. ++ * ipa-prop.c (ipa_analyze_node): Likewise. ++ (ipcp_transform_function): Likewise. ++ * ipa-sra.c (process_scan_results): Likewise. ++ (ipa_sra_summarize_function): Likewise. ++ * params.opt: Rename ipcp-unit-growth to ++ ipa-cp-unit-growth. Add Optimization for various ++ IPA-related parameters. ++ ++2020-01-09 Richard Biener ++ ++ PR middle-end/93054 ++ * gimplify.c (gimplify_expr): Deal with NOP definitions. ++ ++2020-01-09 Richard Biener ++ ++ PR tree-optimization/93040 ++ * gimple-ssa-store-merging.c (find_bswap_or_nop): Raise search limit. ++ ++2020-01-09 Georg-Johann Lay ++ ++ * common/config/avr/avr-common.c (avr_option_optimization_table) ++ [OPT_LEVELS_1_PLUS]: Set -fsplit-wide-types-early. ++ ++2020-01-09 Martin Liska ++ ++ * cgraphclones.c (symbol_table::materialize_all_clones): ++ Use cgraph_node::dump_name. ++ ++2020-01-09 Jakub Jelinek ++ ++ PR inline-asm/93202 ++ * config/riscv/riscv.c (riscv_print_operand_reloc): Use ++ output_operand_lossage instead of gcc_unreachable. ++ * doc/md.texi (riscv f constraint): Fix typo. ++ ++ PR target/93141 ++ * config/i386/i386.md (subv4): Use SWIDWI iterator instead of ++ SWI. Use instead of . Use ++ CONST_SCALAR_INT_P instead of CONST_INT_P. ++ (*subv4_1): Rename to ... ++ (subv4_1): ... this. ++ (*subv4_doubleword, *addv4_doubleword_1): New ++ define_insn_and_split patterns. ++ (*subv4_overflow_1, *addv4_overflow_2): New define_insn ++ patterns. ++ ++2020-01-08 David Malcolm ++ ++ * vec.c (class selftest::count_dtor): New class. ++ (selftest::test_auto_delete_vec): New test. ++ (selftest::vec_c_tests): Call it. ++ * vec.h (class auto_delete_vec): New class template. ++ (auto_delete_vec::~auto_delete_vec): New dtor. ++ ++2020-01-08 David Malcolm ++ ++ * sbitmap.h (auto_sbitmap): Add operator const_sbitmap. ++ ++2020-01-08 Jim Wilson ++ ++ * config/riscv/riscv.c (riscv_legitimize_tls_address): Ifdef out ++ use of TLS_MODEL_LOCAL_EXEC when not pic. ++ ++2020-01-08 David Malcolm ++ ++ * hash-map-tests.c (selftest::test_map_of_strings_to_int): Fix ++ memory leak. ++ ++2020-01-08 Jakub Jelinek +=20 +-2017-01-19 Uros Bizjak ++ PR target/93187 ++ * config/i386/i386.md (*stack_protect_set_2_ peephole2, ++ *stack_protect_set_3 peephole2): Also check that the second ++ insns source is general_operand. ++ ++ PR target/93174 ++ * config/i386/i386.md (addcarry_0): Use nonimmediate_operand ++ predicate for output operand instead of register_operand. ++ (addcarry, addcarry_1): Likewise. Add alternative with ++ memory destination and non-memory operands[2]. ++ ++2020-01-08 Martin Liska ++ ++ * cgraph.c (cgraph_node::dump): Use ::dump_name or ++ ::dump_asm_name instead of (::name or ::asm_name). ++ * cgraphclones.c (symbol_table::materialize_all_clones): Likewise. ++ * cgraphunit.c (walk_polymorphic_call_targets): Likewise. ++ (analyze_functions): Likewise. ++ (expand_all_functions): Likewise. ++ * ipa-cp.c (ipcp_cloning_candidate_p): Likewise. ++ (propagate_bits_across_jump_function): Likewise. ++ (dump_profile_updates): Likewise. ++ (ipcp_store_bits_results): Likewise. ++ (ipcp_store_vr_results): Likewise. ++ * ipa-devirt.c (dump_targets): Likewise. ++ * ipa-fnsummary.c (analyze_function_body): Likewise. ++ * ipa-hsa.c (check_warn_node_versionable): Likewise. ++ (process_hsa_functions): Likewise. ++ * ipa-icf.c (sem_item_optimizer::merge_classes): Likewise. ++ (set_alias_uids): Likewise. ++ * ipa-inline-transform.c (save_inline_function_body): Likewise. ++ * ipa-inline.c (recursive_inlining): Likewise. ++ (inline_to_all_callers_1): Likewise. ++ (ipa_inline): Likewise. ++ * ipa-profile.c (ipa_propagate_frequency_1): Likewise. ++ (ipa_propagate_frequency): Likewise. ++ * ipa-prop.c (ipa_make_edge_direct_to_target): Likewise. ++ (remove_described_reference): Likewise. ++ * ipa-pure-const.c (worse_state): Likewise. ++ (check_retval_uses): Likewise. ++ (analyze_function): Likewise. ++ (propagate_pure_const): Likewise. ++ (propagate_nothrow): Likewise. ++ (dump_malloc_lattice): Likewise. ++ (propagate_malloc): Likewise. ++ (pass_local_pure_const::execute): Likewise. ++ * ipa-visibility.c (optimize_weakref): Likewise. ++ (function_and_variable_visibility): Likewise. ++ * ipa.c (symbol_table::remove_unreachable_nodes): Likewise. ++ (ipa_discover_variable_flags): Likewise. ++ * lto-streamer-out.c (output_function): Likewise. ++ (output_constructor): Likewise. ++ * tree-inline.c (copy_bb): Likewise. ++ * tree-ssa-structalias.c (ipa_pta_execute): Likewise. ++ * varpool.c (symbol_table::remove_unreferenced_decls): Likewise. ++ ++2020-01-08 Richard Biener ++ ++ PR middle-end/93199 ++ * tree-eh.c (sink_clobbers): Update virtual operands for ++ the first and last stmt only. Add a dry-run capability. ++ (pass_lower_eh_dispatch::execute): Perform clobber sinking ++ after CFG manipulations and in RPO order to catch all ++ secondary opportunities reliably. ++ ++2020-01-08 Georg-Johann Lay ++ ++ PR target/93182 ++ * doc/invoke.texi (AVR Options) <-nodevicespecs>: Document. ++ ++2019-01-08 Richard Biener ++ ++ PR middle-end/93199 ++ * gimple-fold.c (rewrite_to_defined_overflow): Mark stmt modified. ++ * tree-ssa-loop-im.c (move_computations_worker): Properly adjust ++ virtual operand, also updating SSA use. ++ * gimple-loop-interchange.cc (loop_cand::undo_simple_reduction): ++ Update stmt after resetting virtual operand. ++ (tree_loop_interchange::move_code_to_inner_loop): Likewise. ++ * gimple-iterator.c (gsi_remove): When not removing the stmt ++ permanently do not delink immediate uses or mark the stmt modified. ++ ++2020-01-08 Martin Liska ++ ++ * ipa-fnsummary.c (dump_ipa_call_summary): Use symtab_node::dump_name. ++ (ipa_call_context::estimate_size_and_time): Likewise. ++ (inline_analyze_function): Likewise. ++ ++2020-01-08 Martin Liska ++ ++ * cgraph.c (cgraph_node::dump): Use systematically ++ dump_asm_name. ++ ++2020-01-08 Georg-Johann Lay ++ ++ Add -nodevicespecs option for avr. ++ ++ PR target/93182 ++ * config/avr/avr.opt (-nodevicespecs): New driver option. ++ * config/avr/driver-avr.c (avr_devicespecs_file): Only issue ++ "-specs=3Ddevice-specs/..." if that option is not set. ++ * doc/invoke.texi (AVR Options) <-nodevicespecs>: Document. ++ ++2020-01-08 Georg-Johann Lay ++ ++ Implement 64-bit double functions for avr. ++ ++ PR target/92055 ++ * config.gcc (tm_defines) [target=3Davr]: Support --with-libf7, ++ --with-double-comparison. ++ * doc/install.texi: Document them. ++ * config/avr/avr-c.c (avr_cpu_cpp_builtins) ++ ++ : New built-in defines. ++ * doc/invoke.texi (AVR Built-in Macros): Document them. ++ * config/avr/avr-protos.h (avr_float_lib_compare_returns_bool): New. ++ * config/avr/avr.c (avr_float_lib_compare_returns_bool): New function. ++ * config/avr/avr.h (FLOAT_LIB_COMPARE_RETURNS_BOOL): New macro. ++ ++2020-01-08 Richard Earnshaw ++ ++ PR target/93188 ++ * config/arm/t-multilib (MULTILIB_MATCHES): Add rules to match ++ armv7-a{+mp,+sec,+mp+sec} to appropriate armv7 multilib variants ++ when only building rm-profile multilibs. ++ ++2020-01-08 Feng Xue ++ ++ PR ipa/93084 ++ * ipa-cp.c (self_recursively_generated_p): Find matched aggregate ++ lattice for a value to check. ++ (propagate_vals_across_arith_jfunc): Add an assertion to ensure ++ finite propagation in self-recursive scc. ++ ++2020-01-08 Luo Xiong Hu ++ ++ * ipa-inline.c (caller_growth_limits): Restore the AND. ++ ++2020-01-07 Andrew Stubbs ++ ++ * config/gcn/gcn-valu.md (VEC_1REG_INT_ALT): Delete iterator. ++ (VEC_ALLREG_ALT): New iterator. ++ (VEC_ALLREG_INT_MODE): New iterator. ++ (VCMP_MODE): New iterator. ++ (VCMP_MODE_INT): New iterator. ++ (vec_cmpudi): Use VCMP_MODE_INT. ++ (vec_cmpv64qidi): New define_expand. ++ (vec_cmpdi_exec): Use VCMP_MODE. ++ (vec_cmpudi_exec): New define_expand. ++ (vec_cmpv64qidi_exec): New define_expand. ++ (vec_cmpdi_dup): Use VCMP_MODE. ++ (vec_cmpdi_dup_exec): Use VCMP_MODE. ++ (vcond): Rename ... ++ (vcond): ... to this. ++ (vcond_exec): Rename ... ++ (vcond_exec): ... to this. ++ (vcondu): Rename ... ++ (vcondu): ... to this. ++ (vcondu_exec): Rename ... ++ (vcondu_exec): ... to ++ this. ++ * config/gcn/gcn.c (print_operand): Fix 8 and 16 bit suffixes. ++ * config/gcn/gcn.md (expander): Add sign_extend and zero_extend. ++ ++2020-01-07 Andrew Stubbs ++ ++ * config/gcn/constraints.md (DA): Update description and match. ++ (DB): Likewise. ++ (Db): New constraint. ++ * config/gcn/gcn-protos.h (gcn_inline_constant64_p): Add second ++ parameter. ++ * config/gcn/gcn.c (gcn_inline_constant64_p): Add 'mixed' parameter. ++ Implement 'Db' mixed immediate type. ++ * config/gcn/gcn-valu.md (addcv64si3): Rework constraints. ++ (addcv64si3_dup): Delete. ++ (subcv64si3): Rework constraints. ++ (addv64di3): Rework constraints. ++ (addv64di3_exec): Rework constraints. ++ (subv64di3): Rework constraints. ++ (addv64di3_dup): Delete. ++ (addv64di3_dup_exec): Delete. ++ (addv64di3_zext): Rework constraints. ++ (addv64di3_zext_exec): Rework constraints. ++ (addv64di3_zext_dup): Rework constraints. ++ (addv64di3_zext_dup_exec): Rework constraints. ++ (addv64di3_zext_dup2): Rework constraints. ++ (addv64di3_zext_dup2_exec): Rework constraints. ++ (addv64di3_sext_dup2): Rework constraints. ++ (addv64di3_sext_dup2_exec): Rework constraints. ++ ++2020-01-07 Andre Vieira ++ ++ * doc/sourcebuild.texi (arm_little_endian, arm_nothumb): Documented ++ existing target checks. ++ ++2020-01-07 Richard Biener ++ ++ * doc/install.texi: Bump minimal supported MPC version. ++ ++2020-01-07 Richard Sandiford ++ ++ * langhooks-def.h (lhd_simulate_enum_decl): Declare. ++ (LANG_HOOKS_SIMULATE_ENUM_DECL): Use it. ++ * langhooks.c: Include stor-layout.h. ++ (lhd_simulate_enum_decl): New function. ++ * config/aarch64/aarch64-sve-builtins.cc (init_builtins): Call ++ handle_arm_sve_h for the LTO frontend. ++ (register_vector_type): Cope with null returns from pushdecl. ++ ++2020-01-07 Richard Sandiford ++ ++ * config/aarch64/aarch64-protos.h (aarch64_sve::svbool_type_p) ++ (aarch64_sve::nvectors_if_data_type): Replace with... ++ (aarch64_sve::builtin_type_p): ...this. ++ * config/aarch64/aarch64-sve-builtins.cc: Include attribs.h. ++ (find_vector_type): Delete. ++ (add_sve_type_attribute): New function. ++ (lookup_sve_type_attribute): Likewise. ++ (register_builtin_types): Add an "SVE type" attribute to each type. ++ (register_tuple_type): Likewise. ++ (svbool_type_p, nvectors_if_data_type): Delete. ++ (mangle_builtin_type): Use lookup_sve_type_attribute. ++ (builtin_type_p): Likewise. Add an overload that returns the ++ number of constituent vector and predicate registers. ++ * config/aarch64/aarch64.c (aarch64_sve_argument_p): Delete. ++ (aarch64_returns_value_in_sve_regs_p): Use aarch64_sve::builtin_type_p ++ instead of aarch64_sve_argument_p. ++ (aarch64_takes_arguments_in_sve_regs_p): Likewise. ++ (aarch64_pass_by_reference): Likewise. ++ (aarch64_function_value_1): Likewise. ++ (aarch64_return_in_memory): Likewise. ++ (aarch64_layout_arg): Likewise. ++ ++2020-01-07 Jakub Jelinek ++ ++ PR tree-optimization/93156 ++ * tree-ssa-ccp.c (bit_value_binop): For x * x note that the second ++ least significant bit is always clear. ++ ++ PR tree-optimization/93118 ++ * match.pd ((x >> c) << c -> x & (-1< ++ ++ * params.opt: Add Optimization for various parameters. ++ ++2020-01-07 Martin Liska ++ ++ PR ipa/83411 ++ * doc/extend.texi: Explain cloning for target_clone ++ attribute. +=20 +- PR target/78478 +- Revert: +- 2013-11-05 Uros Bizjak ++2020-01-07 Martin Liska +=20 +- * config/i386/rtemself.h (LONG_DOUBLE_TYPE_SIZE): New define. ++ PR tree-optimization/92860 ++ * common.opt: Make in Optimization option ++ as it is affected by -O0, which is an Optimization ++ option. ++ * tree-inline.c (tree_inlinable_function_p): ++ Use opt_for_fn for warn_inline. ++ (expand_call_inline): Likewise. +=20 +-2017-01-19 Tamar Christina ++2020-01-07 Martin Liska +=20 +- * config/aarch64/aarch64.c (aarch64_simd_gen_const_vector_dup): +- Change int to HOST_WIDE_INT. +- * config/aarch64/aarch64-protos.h +- (aarch64_simd_gen_const_vector_dup): Likewise. +- * config/aarch64/aarch64-simd.md: Add copysign3. +- +-2017-01-19 David Malcolm +- +- * langhooks-def.h (lhd_type_for_size): New decl. +- (LANG_HOOKS_TYPE_FOR_SIZE): Define as lhd_type_for_size. +- * langhooks.c (lhd_type_for_size): New function, taken from +- lto_type_for_size. +- +-2017-01-19 Pat Haugen +- +- * config/rs6000/power9.md (power9-alu): Remove 'cmp' type and add +- define_bypass for CR latency. +- (power9-cracked-alu): Update bypass latency and remove power9-branch. +- (power9-alu2): Add define_bypass for CR latency. +- (power9-cmp): New. +- (power9-mul): Update insn latency. +- (power9-mul-compare): Update insn latency, bypass latency and remove +- power9-branch. +- +-2016-01-19 Kyrylo Tkachov +- +- * config/aarch64/aarch64-protos.h (aarch64_nopcrelative_literal_loads): +- Delete. +- * config/aarch64/aarch64.md +- (aarch64_reload_movcp): Delete reference to +- aarch64_nopcrelative_literal_loads. +- (aarch64_reload_movcp): Likewise. +- +-2017-01-19 Chenghua Xu +- +- * config/mips/mips.h (ISA_HAS_FUSED_MADD4): Enable for +- TARGET_LOONGSON_3A. +- (ISA_HAS_UNFUSED_MADD4): Exclude TARGET_LOONGSON_3A. +- +-2017-01-19 Doug Gilmore +- +- PR target/78176 +- * config.gcc (supported_defaults): Add lxc1-sxc1. +- (with_lxc1_sxc1): Add validation. +- (all_defaults): Add lxc1-sxc1. +- * config/mips/mips.opt (mlxc1-sxc1): New option. +- * gcc/config/mips/mips.h (OPTION_DEFAULT_SPECS): Add a default for +- mlxc1-sxc1. +- (TARGET_CPU_CPP_BUILTINS): Add builtin_define for +- __mips_no_lxc1_sxc1. +- (ISA_HAS_LXC1_SXC1): Gate with mips_lxc1_sxc1. +- * gcc/doc/invoke.texi (-mlxc1-sxc1): Document the new option. +- * doc/install.texi (--with-lxc1-sxc1): Document the new option. +- +-2017-01-19 Richard Biener +- +- PR tree-optimization/72488 +- * tree-ssa-sccvn.c (run_scc_vn): When we abort the VN make +- sure to restore SSA info. +- * tree-ssa.c (verify_ssa): Verify SSA info is not shared. +- +-2017-01-19 Richard Earnshaw +- +- PR rtl-optimization/79121 +- * expr.c (expand_expr_real_2, case LSHIFT_EXPR): Look at the signedness +- of the inner type when shifting an extended value. +- +-2017-01-17 Jan Hubicka +- +- PR lto/78407 +- * symtab.c (symtab_node::equal_address_to): Fix comparing of +- interposable aliases. +- +-2017-01-18 Peter Bergner +- +- PR target/78516 +- * config/rs6000/spe.md (mov_si_e500_subreg0): Fix constraints. +- Use the evmergelohi instruction. +- (mov_si_e500_subreg4_2_le): Likewise. +- (mov_sitf_e500_subreg8_2_be): Likewise. +- (mov_sitf_e500_subreg12_2_le): Likewise. +- (mov_si_e500_subreg0_2_le): Fix constraints. +- (mov_si_e500_subreg4_2_be): Likewise. +- (mov_sitf_e500_subreg8_2_le): Likewise. +- (mov_sitf_e500_subreg12_2_be): Likewise. +- +-2017-01-18 Bill Schmidt +- +- * config/rs6000/altivec.md (altivec_vbpermq): Change "type" +- attribute from vecsimple to vecperm. +- (altivec_vbpermq2): Likewise. +- +-2017-01-18 Bill Schmidt +- +- PR target/79040 +- * config/rs6000/altivec.h: Fix typo of vec_cntlz to vec_cnttz. +- +-2017-01-18 Aaron Sawdey +- * config/rs6000/rs6000-protos.h (expand_strn_compare): Add arg. +- * config/rs6000/rs6000.c (expand_strn_compare): Add ability to expand +- strcmp. Fix bug where comparison didn't stop with zero byte. Fix +- case where N arg is SIZE_MAX. +- * config/rs6000/rs6000.md (cmpstrnsi): Args to expand_strn_compare. +- (cmpstrsi): Add pattern. +- +-2017-01-18 Michael Meissner +- +- * config/rs6000/rs6000-c.c (altivec_overloaded_builtins): Add +- __builtin_vec_revb builtins. +- * config/rs6000/rs6000-builtins.def (P9V_BUILTIN_XXBRQ_V16QI): Add +- built-in functions to support generation of the ISA 3.0 XXBR +- vector byte reverse instructions. +- (P9V_BUILTIN_XXBRQ_V1TI): Likewise. +- (P9V_BUILTIN_XXBRD_V2DI): Likewise. +- (P9V_BUILTIN_XXBRD_V2DF): Likewise. +- (P9V_BUILTIN_XXBGW_V4SI): Likewise. +- (P9V_BUILTIN_XXBGW_V4SF): Likewise. +- (P9V_BUILTIN_XXBGH_V8HI): Likewise. +- (P9V_BUILTIN_VEC_REVB): Likewise. +- * config/rs6000/vsx.md (p9_xxbrq_v1ti): New insns/expanders to +- generate the ISA 3.0 XXBR vector byte reverse instructions. +- (p9_xxbrq_v16qi): Likewise. +- (p9_xxbrd_, VSX_D iterator): Likewise. +- (p9_xxbrw_, VSX_W iterator): Likewise. +- (p9_xxbrh_v8hi): Likewise. +- * config/rs6000/altivec.h (vec_revb): Define if ISA 3.0. +- * doc/extend.texi (RS/6000 Altivec Built-ins): Document the +- vec_revb built-in functions. +- +-2017-01-18 Uros Bizjak +- +- PR rtl-optimization/78952 +- * config/i386/i386.md (any_extract): New code iterator. +- (*insvqi_2): Use any_extract for source operand. +- (*insvqi_3): Use any_shiftrt for source operand. +- +-2017-01-18 Wilco Dijkstra +- +- * config/aarch64/aarch64.c (aarch64_sched_adjust_priority) +- New function. +- (TARGET_SCHED_ADJUST_PRIORITY): Define target hook. +- +-2017-01-18 Matthias Klose +- +- * doc/install.texi: Allow default for --with-target-bdw-gc-include. +- +-2016-01-18 Bill Schmidt +- +- * config/rs6000/altivec.h (vec_bperm): Change #define. +- * config/rs6000/altivec.md (UNSPEC_VBPERMD): New enum constant. +- (altivec_vbpermq2): New define_insn. +- (altivec_vbpermd): Likewise. +- * config/rs6000/rs6000-builtin.def (VBPERMQ2): New monomorphic +- function interface. +- (VBPERMD): Likewise. +- (VBPERM): New polymorphic function interface. +- * config/rs6000/r6000-c.c (altivec_overloaded_builtins_table): +- Add entries for P9V_BUILTIN_VEC_VBPERM. +- * doc/extend.texi: Add interfaces for vec_bperm. +- +-2017-01-18 Andreas Krebbel +- +- * config/s390/s390-c.c (s390_expand_overloaded_builtin): Downcase +- first letter of error messages. +- (s390_resolve_overloaded_builtin): Likewise. +- * config/s390/s390.c (s390_expand_builtin): Likewise. +- (s390_invalid_arg_for_unprototyped_fn): Likewise. +- (s390_valid_target_attribute_inner_p): Likewise. +- * config/s390/s390.md ("tabort"): Likewise. +- +-2017-01-18 Toma Tabacu +- +- * config/mips/mips.h (ISA_HAS_DIV3): Remove unused macro. +- (ISA_AVOID_DIV_HILO): New macro. +- (ISA_HAS_DIV): Use new ISA_AVOID_DIV_HILO macro. +- (ISA_HAS_DDIV): Likewise. +- +-2017-01-18 Markus Trippelsdorf +- +- * doc/invoke.texi (fabi-version): Correct number of occurrences. +- +-2017-01-18 Markus Trippelsdorf +- +- * doc/invoke.texi (fabi-version): Spelling fix. +- +-2017-01-18 Markus Trippelsdorf +- +- PR c++/70182 +- * doc/invoke.texi (fabi-version): Mention mangling fix for +- operator names. +- +-2017-01-18 Markus Trippelsdorf +- +- PR c++/77489 +- * doc/invoke.texi (fabi-version): Document discriminator mangling. +- +-2017-01-17 Segher Boessenkool +- +- PR target/78875 +- * config/rs6000/rs6000-opts.h (stack_protector_guard): New enum. +- * config/rs6000/rs6000.c (rs6000_option_override_internal): Handle +- the new options. +- * config/rs6000/rs6000.md (stack_protect_set): Handle the new more +- flexible settings. +- (stack_protect_test): Ditto. +- * config/rs6000/rs6000.opt (mstack-protector-guard=3D, +- mstack-protector-guard-reg=3D, mstack-protector-guard-offset=3D): New +- options. +- * doc/invoke.texi (Option Summary) [RS/6000 and PowerPC Options]: +- Add -mstack-protector-guard=3D, -mstack-protector-guard-reg=3D, and +- -mstack-protector-guard-offset=3D. +- (RS/6000 and PowerPC Options): Ditto. +- +-2017-01-17 Uros Bizjak +- +- * config/i386/i386.h (MASK_CLASS_P): New define. +- * config/i386/i386.c (inline_secondary_memory_needed): Ensure that +- there are no registers from different register sets also when +- mask registers are used. Update function comment. +- * config/i386/i386.md (*movsi_internal): Split (*k/*krm) alternative +- to (*k/*r) and (*k/*km) alternatives. +- +-2017-01-17 Wilco Dijkstra +- +- * config/aarch64/aarch64.md (eh_return): Remove pattern and splitter. +- * config/aarch64/aarch64.h (AARCH64_EH_STACKADJ_REGNUM): Remove. +- (EH_RETURN_HANDLER_RTX): New define. +- * config/aarch64/aarch64.c (aarch64_frame_pointer_required): +- Force frame pointer in EH return functions. +- (aarch64_expand_epilogue): Add barrier for eh_return. +- (aarch64_final_eh_return_addr): Remove. +- (aarch64_eh_return_handler_rtx): New function. +- * config/aarch64/aarch64-protos.h (aarch64_final_eh_return_addr): +- Remove. +- (aarch64_eh_return_handler_rtx): New prototype. +- +-2017-01-17 Bill Schmidt +- +- * config/rs6000/altivec.h (vec_rlmi): New #define. +- (vec_vrlnm): Likewise. +- (vec_rlnm): Likewise. +- * config/rs6000/altivec.md (UNSPEC_VRLMI): New UNSPEC enum value. +- (UNSPEC_VRLNM): Likewise. +- (VIlong): New mode iterator. +- (altivec_vrlmi): New define_insn. +- (altivec_vrlnm): Likewise. +- * config/rs6000/rs6000-builtin.def (VRLWNM): New monomorphic +- function entry. +- (VRLDNM): Likewise. +- (RLNM): New polymorphic function entry. +- (VRLWMI): New monomorphic function entry. +- (VRLDMI): Likewise. +- (RLMI): New polymorphic function entry. +- * config/rs6000/r6000-c.c (altivec_overloaded_builtin_table): Add +- new entries for P9V_BUILTIN_VEC_RLMI and P9V_BUILTIN_VEC_RLNM. +- * doc/extend.texi: Add description of vec_rlmi, vec_rlnm, and +- vec_vrlnm. +- +-2017-01-17 Jakub Jelinek +- +- PR debug/78839 +- * dwarf2out.c (field_byte_offset): Restore the +- PCC_BITFIELD_TYPE_MATTERS behavior for INTEGER_CST DECL_FIELD_OFFSET +- and DECL_FIELD_BIT_OFFSET. Use fold_build2 instead of build2 + fold. +- (analyze_variants_discr, gen_variant_part): Use fold_build2 instead +- of build2 + fold. +- +-2017-01-17 Eric Botcazou +- +- PR ada/67205 +- * config/aarch64/aarch64.c (TARGET_CUSTOM_FUNCTION_DESCRIPTORS): Define +- +-2017-01-17 Jakub Jelinek +- +- PR debug/71669 +- * dwarf2out.c (add_data_member_location_attribute): For constant +- offset bitfield emit for -gdwarf-5 DW_AT_data_bit_offset attribute +- instead of DW_AT_data_member_location, DW_AT_bit_offset and +- DW_AT_byte_size attributes. +- +-2017-01-17 Eric Botcazou +- +- * config/rs6000/rs6000.c (rs6000_emit_move): Also use a TOC reference +- after forcing to constant memory when the code model is medium. +- +-2017-01-17 Julia Koval +- +- PR target/76731 +- * config/i386/avx512fintrin.h +- (_mm512_i32gather_ps): Change __addr type to void const*. +- (_mm512_mask_i32gather_ps): Ditto. +- (_mm512_i32gather_pd): Ditto. +- (_mm512_mask_i32gather_pd): Ditto. +- (_mm512_i64gather_ps): Ditto. +- (_mm512_mask_i64gather_ps): Ditto. +- (_mm512_i64gather_pd): Ditto. +- (_mm512_mask_i64gather_pd): Ditto. +- (_mm512_i32gather_epi32): Ditto. +- (_mm512_mask_i32gather_epi32): Ditto. +- (_mm512_i32gather_epi64): Ditto. +- (_mm512_mask_i32gather_epi64): Ditto. +- (_mm512_i64gather_epi32): Ditto. +- (_mm512_mask_i64gather_epi32): Ditto. +- (_mm512_i64gather_epi64): Ditto. +- (_mm512_mask_i64gather_epi64): Ditto. +- (_mm512_i32scatter_ps): Change __addr type to void*. +- (_mm512_mask_i32scatter_ps): Ditto. +- (_mm512_i32scatter_pd): Ditto. +- (_mm512_mask_i32scatter_pd): Ditto. +- (_mm512_i64scatter_ps): Ditto. +- (_mm512_mask_i64scatter_ps): Ditto. +- (_mm512_i64scatter_pd): Ditto. +- (_mm512_mask_i64scatter_pd): Ditto. +- (_mm512_i32scatter_epi32): Ditto. +- (_mm512_mask_i32scatter_epi32): Ditto. +- (_mm512_i32scatter_epi64): Ditto. +- (_mm512_mask_i32scatter_epi64): Ditto. +- (_mm512_i64scatter_epi32): Ditto. +- (_mm512_mask_i64scatter_epi32): Ditto. +- (_mm512_i64scatter_epi64): Ditto. +- (_mm512_mask_i64scatter_epi64): Ditto. +- * config/i386/avx512pfintrin.h +- (_mm512_mask_prefetch_i32gather_pd): Change __addr type to void const*. +- (_mm512_mask_prefetch_i32gather_ps): Ditto. +- (_mm512_mask_prefetch_i64gather_pd): Ditto. +- (_mm512_mask_prefetch_i64gather_ps): Ditto. +- (_mm512_prefetch_i32scatter_pd): Change __addr type to void*. +- (_mm512_prefetch_i32scatter_ps): Ditto. +- (_mm512_mask_prefetch_i32scatter_pd): Ditto. +- (_mm512_mask_prefetch_i32scatter_ps): Ditto. +- (_mm512_prefetch_i64scatter_pd): Ditto. +- (_mm512_prefetch_i64scatter_ps): Ditto. +- (_mm512_mask_prefetch_i64scatter_pd): Ditto. +- (_mm512_mask_prefetch_i64scatter_ps): Ditto. +- * config/i386/avx512vlintrin.h +- (_mm256_mmask_i32gather_ps): Change __addr type to void const*. +- (_mm_mmask_i32gather_ps): Ditto. +- (_mm256_mmask_i32gather_pd): Ditto. +- (_mm_mmask_i32gather_pd): Ditto. +- (_mm256_mmask_i64gather_ps): Ditto. +- (_mm_mmask_i64gather_ps): Ditto. +- (_mm256_mmask_i64gather_pd): Ditto. +- (_mm_mmask_i64gather_pd): Ditto. +- (_mm256_mmask_i32gather_epi32): Ditto. +- (_mm_mmask_i32gather_epi32): Ditto. +- (_mm256_mmask_i32gather_epi64): Ditto. +- (_mm_mmask_i32gather_epi64): Ditto. +- (_mm256_mmask_i64gather_epi32): Ditto. +- (_mm_mmask_i64gather_epi32): Ditto. +- (_mm256_mmask_i64gather_epi64): Ditto. +- (_mm_mmask_i64gather_epi64): Ditto. +- (_mm256_i32scatter_ps): Change __addr type to void*. +- (_mm256_mask_i32scatter_ps): Ditto. +- (_mm_i32scatter_ps): Ditto. +- (_mm_mask_i32scatter_ps): Ditto. +- (_mm256_i32scatter_pd): Ditto. +- (_mm256_mask_i32scatter_pd): Ditto. +- (_mm_i32scatter_pd): Ditto. +- (_mm_mask_i32scatter_pd): Ditto. +- (_mm256_i64scatter_ps): Ditto. +- (_mm256_mask_i64scatter_ps): Ditto. +- (_mm_i64scatter_ps): Ditto. +- (_mm_mask_i64scatter_ps): Ditto. +- (_mm256_i64scatter_pd): Ditto. +- (_mm256_mask_i64scatter_pd): Ditto. +- (_mm_i64scatter_pd): Ditto. +- (_mm_mask_i64scatter_pd): Ditto. +- (_mm256_i32scatter_epi32): Ditto. +- (_mm256_mask_i32scatter_epi32): Ditto. +- (_mm_i32scatter_epi32): Ditto. +- (_mm_mask_i32scatter_epi32): Ditto. +- (_mm256_i32scatter_epi64): Ditto. +- (_mm256_mask_i32scatter_epi64): Ditto. +- (_mm_i32scatter_epi64): Ditto. +- (_mm_mask_i32scatter_epi64): Ditto. +- (_mm256_i64scatter_epi32): Ditto. +- (_mm256_mask_i64scatter_epi32): Ditto. +- (_mm_i64scatter_epi32): Ditto. +- (_mm_mask_i64scatter_epi32): Ditto. +- (_mm256_i64scatter_epi64): Ditto. +- (_mm256_mask_i64scatter_epi64): Ditto. +- (_mm_i64scatter_epi64): Ditto. +- (_mm_mask_i64scatter_epi64): Ditto. +- * config/i386/i386-builtin-types.def (V16SF_V16SF_PCFLOAT_V16SI_HI_INT) +- (V8DF_V8DF_PCDOUBLE_V8SI_QI_INT, V8SF_V8SF_PCFLOAT_V8DI_QI_INT) +- (V8DF_V8DF_PCDOUBLE_V8DI_QI_INT, V16SI_V16SI_PCINT_V16SI_HI_INT) +- (V8DI_V8DI_PCINT64_V8SI_QI_INT, V8SI_V8SI_PCINT_V8DI_QI_INT) +- (V8DI_V8DI_PCINT64_V8DI_QI_INT, V2DF_V2DF_PCDOUBLE_V4SI_QI_INT) +- (V4DF_V4DF_PCDOUBLE_V4SI_QI_INT, V2DF_V2DF_PCDOUBLE_V2DI_QI_INT) +- (V4DF_V4DF_PCDOUBLE_V4DI_QI_INT, V4SF_V4SF_PCFLOAT_V4SI_QI_INT) +- (V8SF_V8SF_PCFLOAT_V8SI_QI_INT, V4SF_V4SF_PCFLOAT_V2DI_QI_INT) +- (V4SF_V4SF_PCFLOAT_V4DI_QI_INT, V2DI_V2DI_PCINT64_V4SI_QI_INT) +- (V4DI_V4DI_PCINT64_V4SI_QI_INT, V2DI_V2DI_PCINT64_V2DI_QI_INT) +- (V4DI_V4DI_PCINT64_V4DI_QI_INT, V4SI_V4SI_PCINT_V4SI_QI_INT) +- (V8SI_V8SI_PCINT_V8SI_QI_INT, V4SI_V4SI_PCINT_V2DI_QI_INT) +- (V4SI_V4SI_PCINT_V4DI_QI_INT, VOID_PFLOAT_HI_V16SI_V16SF_INT) +- (VOID_PFLOAT_QI_V8SI_V8SF_INT, VOID_PFLOAT_QI_V4SI_V4SF_INT) +- (VOID_PDOUBLE_QI_V8SI_V8DF_INT, VOID_PDOUBLE_QI_V4SI_V4DF_INT) +- (VOID_PDOUBLE_QI_V4SI_V2DF_INT, VOID_PFLOAT_QI_V8DI_V8SF_INT) +- (VOID_PFLOAT_QI_V4DI_V4SF_INT, VOID_PFLOAT_QI_V2DI_V4SF_INT) +- (VOID_PDOUBLE_QI_V8DI_V8DF_INT, VOID_PDOUBLE_QI_V4DI_V4DF_INT) +- (VOID_PDOUBLE_QI_V2DI_V2DF_INT, VOID_PINT_HI_V16SI_V16SI_INT) +- (VOID_PINT_QI_V8SI_V8SI_INT, VOID_PINT_QI_V4SI_V4SI_INT) +- (VOID_PLONGLONG_QI_V8SI_V8DI_INT, VOID_PLONGLONG_QI_V4SI_V4DI_INT) +- (VOID_PLONGLONG_QI_V4SI_V2DI_INT, VOID_PINT_QI_V8DI_V8SI_INT) +- (VOID_PINT_QI_V4DI_V4SI_INT, VOID_PINT_QI_V2DI_V4SI_INT) +- (VOID_PLONGLONG_QI_V8DI_V8DI_INT, VOID_QI_V8SI_PCINT64_INT_INT) +- (VOID_PLONGLONG_QI_V4DI_V4DI_INT, VOID_PLONGLONG_QI_V2DI_V2DI_INT) +- (VOID_HI_V16SI_PCINT_INT_INT, VOID_QI_V8DI_PCINT64_INT_INT) +- (VOID_QI_V8DI_PCINT_INT_INT): Remove. +- (V16SF_V16SF_PCVOID_V16SI_HI_INT, V8DF_V8DF_PCVOID_V8SI_QI_INT) +- (V8SF_V8SF_PCVOID_V8DI_QI_INT, V8DF_V8DF_PCVOID_V8DI_QI_INT) +- (V16SI_V16SI_PCVOID_V16SI_HI_INT, V8DI_V8DI_PCVOID_V8SI_QI_INT) +- (V8SI_V8SI_PCVOID_V8DI_QI_INT, V8DI_V8DI_PCVOID_V8DI_QI_INT) +- (VOID_PVOID_HI_V16SI_V16SF_INT, VOID_PVOID_QI_V8SI_V8DF_INT) +- (VOID_PVOID_QI_V8DI_V8SF_INT, VOID_PVOID_QI_V8DI_V8DF_INT) +- (VOID_PVOID_HI_V16SI_V16SI_INT, VOID_PVOID_QI_V8SI_V8DI_INT) +- (VOID_PVOID_QI_V8DI_V8SI_INT, VOID_PVOID_QI_V8DI_V8DI_INT) +- (V2DF_V2DF_PCVOID_V4SI_QI_INT, V4DF_V4DF_PCVOID_V4SI_QI_INT) +- (V2DF_V2DF_PCVOID_V2DI_QI_INT, V4DF_V4DF_PCVOID_V4DI_QI_INT +- (V4SF_V4SF_PCVOID_V4SI_QI_INT, V8SF_V8SF_PCVOID_V8SI_QI_INT) +- (V4SF_V4SF_PCVOID_V2DI_QI_INT, V4SF_V4SF_PCVOID_V4DI_QI_INT) +- (V2DI_V2DI_PCVOID_V4SI_QI_INT, V4DI_V4DI_PCVOID_V4SI_QI_INT) +- (V2DI_V2DI_PCVOID_V2DI_QI_INT, V4DI_V4DI_PCVOID_V4DI_QI_INT) +- (V4SI_V4SI_PCVOID_V4SI_QI_INT, V8SI_V8SI_PCVOID_V8SI_QI_INT) +- (V4SI_V4SI_PCVOID_V2DI_QI_INT, V4SI_V4SI_PCVOID_V4DI_QI_INT) +- (VOID_PVOID_QI_V8SI_V8SF_INT, VOID_PVOID_QI_V4SI_V4SF_INT) +- (VOID_PVOID_QI_V4SI_V4DF_INT, VOID_PVOID_QI_V4SI_V2DF_INT) +- (VOID_PVOID_QI_V4DI_V4SF_INT, VOID_PVOID_QI_V2DI_V4SF_INT) +- (VOID_PVOID_QI_V4DI_V4DF_INT, VOID_PVOID_QI_V2DI_V2DF_INT) +- (VOID_PVOID_QI_V8SI_V8SI_INT, VOID_PVOID_QI_V4SI_V4SI_INT) +- (VOID_PVOID_QI_V4SI_V4DI_INT, VOID_PVOID_QI_V4SI_V2DI_INT) +- (VOID_PVOID_QI_V4DI_V4SI_INT, VOID_PVOID_QI_V2DI_V4SI_INT) +- (VOID_PVOID_QI_V4DI_V4DI_INT, VOID_PVOID_QI_V2DI_V2DI_INT) +- (VOID_QI_V8SI_PCVOID_INT_INT, VOID_HI_V16SI_PCVOID_INT_INT) +- (VOID_QI_V8DI_PCVOID_INT_INT): Add. +- * config/i386/i386.c (ix86_init_mmx_sse_builtins): Adjust builtin +- definitions accordingly. +- +-2017-01-17 Kito Cheng +- Kuan-Lin Chen +- +- PR target/79079 +- * internal-fn.c (expand_mul_overflow): Use convert_modes instead of +- gen_lowpart. +- +-2017-01-17 Vladimir Makarov +- +- PR target/79058 +- * ira-conflicts.c (ira_build_conflicts): Update total conflict +- hard regs for inner regno. +- +-2017-01-17 Martin Liska +- +- PR ipa/71207 +- * ipa-polymorphic-call.c (contains_type_p): Fix wrong +- assumption and add comment. +- +-2017-01-17 Nathan Sidwell +- +- * ipa-visibility.c (localize_node): New function, broken out of ... +- (function_and_variable_visibility): ... here. Call it. +- +-2017-01-17 Jan Hubicka +- +- PR middle-end/77445 +- * tree-ssa-threadupdate.c (remove_ctrl_stmt_and_useless_edges): +- correctly set frequency of oudgoing edge. +- (duplicate_thread_path): Fix profile updating. +- +-2017-01-17 Jakub Jelinek +- +- PR other/79046 +- * configure.ac: Add GCC_BASE_VER. +- * Makefile.in (version): Use @get_gcc_base_ver@ instead of cat to get +- version from BASE-VER file. +- (CFLAGS-gcc.o): Add -DBASEVER=3D$(BASEVER_s). +- (gcc.o): Depend on $(BASEVER). +- * common.opt (dumpfullversion): New option. +- * gcc.c (driver_handle_option): Handle OPT_dumpfullversion. +- * doc/invoke.texi: Document -dumpfullversion. +- * doc/install.texi: Document --with-gcc-major-version-only. +- * configure: Regenerated. ++ PR tree-optimization/92860 ++ * common.opt: Make flag_ree as optimization ++ attribute.=20 +=20 +-2017-01-17 Richard Biener +- +- PR tree-optimization/71433 +- * tree-vrp.c (register_new_assert_for): Merge same asserts +- on all incoming edges. +- (process_assert_insertions_for): Handle insertions at the +- beginning of BBs. ++2020-01-07 Martin Liska +=20 +-2017-01-17 Gerald Pfeifer ++ PR optimization/92860 ++ * params.opt: Mark param_min_crossjump_insns with Optimization ++ keyword. +=20 +- * config/i386/cygwin.h (LIBGCJ_SONAME): Remove. +- * config/i386/mingw32.h (LIBGCJ_SONAME): Remove. ++2020-01-07 Luo Xiong Hu +=20 +-2017-01-17 Kaz Kojima ++ * ipa-inline-analysis.c (estimate_growth): Fix typo. ++ * ipa-inline.c (caller_growth_limits): Use OR instead of AND. +=20 +- PR target/78633 +- * config/sh/sh.md (cmpeqsi_t+1): Call copy_rtx to avoid invalid +- RTL sharing. ++2020-01-06 Michael Meissner +=20 +-2017-01-17 Alan Modra ++ * config/rs6000/rs6000.c (hard_reg_and_mode_to_addr_mask): New ++ helper function to return the valid addressing formats for a given ++ hard register and mode. ++ (rs6000_adjust_vec_address): Call hard_reg_and_mode_to_addr_mask. +=20 +- PR target/79066 +- * config/rs6000/rs6000.md (elf_high, elf_low): Disable when pic. +- * config/rs6000/rs6000.c (rs6000_emit_allocate_stack): Don't allow +- symbolic stack limit when pic. ++ * config/rs6000/constraints.md (Q constraint): Update ++ documentation. ++ * doc/md.texi (RS/6000 constraints): Update 'Q' cosntraint ++ documentation. +=20 +-2017-01-16 Martin Sebor ++ * config/rs6000/vsx.md (vsx_extract__var, VSX_D iterator): ++ Use 'Q' for doing vector extract from memory. ++ (vsx_extract_v4sf_var): Use 'Q' for doing vector extract from ++ memory. ++ (vsx_extract__var, VSX_EXTRACT_I iterator): Use 'Q' for ++ doing vector extract from memory. ++ (vsx_extract__mode_var): Use 'Q' for doing vector ++ extract from memory. +=20 +- PR tree-optimization/78608 +- * gimple-ssa-sprintf.c (tree_digits): Avoid negating TYPE_MIN. ++ * config/rs6000/rs6000.c (rs6000_adjust_vec_address): Add support ++ for the offset being 34-bits when -mcpu=3Dfuture is used. +=20 +-2017-01-16 Jeff Law ++2020-01-06 John David Anglin +=20 +- Revert: +- 2016-12-02 Tadek Kijkowski +- * Makefile.in (PREPROCESSOR_DEFINES): Add a level of indirection +- for several include directories that may be relative to sysroot. +- * config/i386/x-mingw32 (gplus_includedir): Define. +- (gplus_tool_includedir, gplus_backward_include_dir): Likewise. +- (native_system_includedir): Likewise. +- * config/i386/mingw32.h (STANDARD_STARTFILE_PREFIX_1): Do not +- override if TARGET_SYSTEM_ROOT is defined. +- (NATIVE_SYSTEM_HEADER_DIR): Likewise. ++ * config/pa/pa.md: Revert change to use ordered_comparison_operator ++ instead of cmpib_comparison_operator in cmpib patterns. ++ * config/pa/predicates.md (cmpib_comparison_operator): Revert removal ++ of cmpib_comparison_operator. Revise comment. +=20 +- PR tree-optimization/79090 +- PR tree-optimization/33562 +- PR tree-optimization/61912 +- PR tree-optimization/77485 +- * tree-ssa-dse.c (compute_trims): Accept STMT argument. Dump STMT +- and computed trims into the dump file. ++2020-01-06 Richard Sandiford +=20 +-2017-01-17 Uros Bizjak ++ * tree-vect-slp.c (vect_build_slp_tree_1): Require all shifts ++ in an IFN_DIV_POW2 node to be equal. +=20 +- * config/i386/i386.h (LIMIT_RELOAD_CLASS): Remove. ++2020-01-06 Richard Sandiford +=20 +-2017-01-16 Jakub Jelinek ++ * tree-vect-stmts.c (vect_check_load_store_mask): Rename to... ++ (vect_check_scalar_mask): ...this. ++ (vectorizable_store, vectorizable_load): Update call accordingly. ++ (vectorizable_call): Use vect_check_scalar_mask to check the mask ++ argument in calls to conditional internal functions. +=20 +- PR c/79089 +- * gimplify.c (gimplify_init_constructor): If want_value and +- object =3D=3D lhs, unshare lhs to avoid invalid tree sharing. Formatting +- fix. ++2020-01-06 Andrew Stubbs +=20 +- PR target/79080 +- * loop-doloop.c (doloop_modify): Call unshare_all_rtl_in_chain on +- sequence. Formatting fixes. +- (doloop_optimize): Formatting fixes. ++ * config/gcn/gcn-valu.md (subv64di3): Use separate alternatives for ++ '0' matching inputs. ++ (subv64di3_exec): Likewise. +=20 +- PR driver/49726 +- * gcc.c (debug_level_greater_than_spec_func): New function. +- (static_spec_functions): Add debug-level-gt spec function. +- (ASM_DEBUG_SPEC, cpp_options): Use %:debug-level-gt(0) instead of +- !g0. +- * config/darwin.h (DSYMUTIL_SPEC, ASM_DEBUG_SPEC): Likewise. +- * config/darwin9.h (DSYMUTIL_SPEC, ASM_DEBUG_SPEC): Likewise. +- * common.opt (g, gcoff, gdwarf, gdwarf-, ggdb, gno-pubnames, +- gpubnames, ggnu-pubnames, gno-record-gcc-switches, +- grecord-gcc-switches, gno-strict-dwarf, gstrict-dwarf, gstabs, +- gstabs+, gtoggle, gvms, gxcoff, gxcoff+): Add Driver flag. ++2020-01-06 Bryan Stenson +=20 +-2017-01-16 Uros Bizjak ++ * config/mips/mips.c (vr4130_align_insns): Fix typo. ++ * doc/md.texi (movstr): Likewise. +=20 +- * config/i386/i386.h (HARD_REGNO_CALLER_SAVE_MODE): Apply HImode and +- QImode fixups to general and mask registers only. ++2020-01-06 Andrew Stubbs +=20 +-2017-01-16 Carl Love ++ * config/gcn/gcn-valu.md (vec_extract): Add early ++ clobber. +=20 +- * config/rs6000/rs6000-c (altivec_overloaded_builtins): Add support +- for built-in functions +- vector signed char vec_nabs (vector signed char) +- vector signed short vec_nabs (vector signed short) +- vector signed int vec_nabs (vector signed int) +- vector signed long long vec_nabs (vector signed long long) +- vector float vec_nabs (vector float) +- vector double vec_nabs (vector double) +- * config/rs6000/rs6000-builtin.def: Add definitions for NABS functions +- and NABS overload. +- * config/rs6000/altivec.md: New define_expand nabs2 types +- * config/rs6000/altivec.h: New define for vec_nabs built-in function. +- * doc/extend.texi: Update the documentation file for the new built-in +- functions. ++2020-01-06 Richard Sandiford +=20 +-2017-01-16 Martin Sebor ++ * config/aarch64/t-aarch64 ($(srcdir)/config/aarch64/aarch64-tune.md): ++ Depend on... ++ (s-aarch64-tune-md): ...this new stamp file. Pipe the new contents ++ to a temporary file and use move-if-change to update the real ++ file where necessary. +=20 +- * gimple-ssa-sprintf.c (format_directive): Correct a typo in a warning +- message. ++2020-01-06 Richard Sandiford +=20 +-2017-01-16 Bill Schmidt ++ * config/aarch64/aarch64-sve.md (@aarch64_sel_dup): Use Upl ++ rather than Upa for CPY /M. +=20 +- * config/rs6000/rs6000.c (rtx_is_swappable_p): Change +- UNSPEC_VSX__XXSPLTD to require special splat handling. ++2020-01-06 Andrew Stubbs +=20 +-2017-01-16 David Malcolm ++ * config/gcn/gcn.c (gcn_inline_constant_p): Allow 64 as an inline ++ immediate. +=20 +- PR bootstrap/78616 +- * system.h: Poison strndup. +- +-2017-01-16 Alan Modra ++2020-01-06 Martin Liska +=20 +- PR target/79098 +- * config/rs6000/rs6000.c (rs6000_legitimate_combined_insn): Don't +- use a switch. +- +-2017-01-16 Georg-Johann Lay ++ PR tree-optimization/92860 ++ * params.opt: Mark param_max_combine_insns with Optimization ++ keyword.=20 +=20 +- * config/avr/avr.h (BRANCH_COST) [reload_completed]: Increase by 4. ++2020-01-05 Jakub Jelinek +=20 +-2017-01-15 Uros Bizjak ++ PR target/93141 ++ * config/i386/i386.md (SWIDWI): New mode iterator. ++ (DWI, dwi): Add TImode variants. ++ (addv4): Use SWIDWI iterator instead of SWI. Use ++ instead of . Use ++ CONST_SCALAR_INT_P instead of CONST_INT_P. ++ (*addv4_1): Rename to ... ++ (addv4_1): ... this. ++ (QWI): New mode attribute. ++ (*addv4_doubleword, *addv4_doubleword_1): New ++ define_insn_and_split patterns. ++ (*addv4_overflow_1, *addv4_overflow_2): New define_insn ++ patterns. ++ (uaddv4): Use SWIDWI iterator instead of SWI. Use ++ instead of . ++ (*addcarry_1): New define_insn. ++ (*add3_doubleword_cc_overflow_1): New define_insn_and_split. ++ ++2020-01-03 Konstantin Kharlamov ++ ++ * gdbinit.in (pr, prl, pt, pct, pgg, pgq, pgs, pge, pmz, pdd, pbs, pbm): ++ Use "call" instead of "set". ++ ++2020-01-03 Martin Jambor +=20 +- * config/i386/i386.c (ix86_legitimate_combined_insn): Do not +- call recog here. Assert that INSN_CODE (insn) is non-negative. ++ PR ipa/92917 ++ * ipa-cp.c (print_all_lattices): Skip functions without info. ++ ++2020-01-03 Jakub Jelinek +=20 +-2017-01-15 Segher Boessenkool +- +- PR target/72749 +- * cfgrtl.c (rtl_split_edge): Also patch jump insns that jump to the +- fallthrough. +- * haifa-sched.c (dump_insn_stream): Don't crash if there is a label +- in the currently scheduled RTL fragment. +- +-2017-01-15 Segher Boessenkool +- +- PR rtl-optimization/78751 +- * ifcvt.c (find_cond_trap): If we generated a non-existing insn, +- give up. +- +-2017-01-14 Jeff Law +- +- PR tree-optimization/79090 +- * tree-ssa-dse.c (valid_ao_ref_for_dse): Reject zero length and +- variable length stores. +- (compute_trims): Delete dead assignment to *trim_tail. +- (dse_dom_walker::dse_optimize_stmt): Optimize mem* calls with +- zero length. +- +-2017-01-14 Bernd Schmidt +- +- PR rtl-optimization/78626 +- PR rtl-optimization/78727 +- * cprop.c (one_cprop_pass): Collect unconditional traps in the middle +- of a block, and split such blocks after everything else is finished. +- +-2017-01-14 Alan Modra +- +- PR target/72749 +- * combine.c (recog_for_combine_1): Set INSN_CODE before calling +- target legitimate_combined_insn. +- * config/rs6000/rs6000.c (TARGET_LEGITIMATE_COMBINED_INSN): Define. +- (rs6000_legitimate_combined_insn): New function. +- * config/rs6000/rs6000.md (UNSPEC_DOLOOP): Delete, and remove +- all uses. +- (ctr_internal3): Rename from *ctr_internal5. +- (ctr_internal4): Rename from *ctr_internal6. +- (ctr_internal1, ctr_internal2): Remove '*' from name. +- +-2017-01-14 Gerald Pfeifer +- +- * doc/frontends.texi (G++ and GCC): Remove references to Java. +- +-2017-01-13 Jeff Law +- +- PR tree-optimization/33562 +- PR tree-optimization/61912 +- PR tree-optimization/77485 +- * tree-ssa-dse.c (delete_dead_call): Accept gsi rather than +- a statement. +- (delete_dead_assignment): Likewise. +- (dse_dom_walker::dse_optimize_stmt): Pass in the gsi rather than +- statement to delete_dead_call and delete_dead_assignment. +- +-2017-01-13 David Malcolm +- +- PR c/78304 +- * substring-locations.c (format_warning_va): Strengthen case 1 so +- that both endpoints of the substring must be within the format +- range for just the substring to be printed. +- +-2017-01-13 Uros Bizjak ++ PR target/93089 ++ * config/i386/i386-options.c (ix86_simd_clone_adjust): If ++ TARGET_PREFER_AVX128, use prefer-vector-width=3D256 for 'c' and 'd' ++ simd clones. If TARGET_PREFER_AVX256, use prefer-vector-width=3D512 ++ for 'e' simd clones. +=20 +- * config/i386/i386.opt (msgx): Use ix86_isa_flags2 variable. +- * config/i386/i386.c (ix86_target_string): Add missing options +- to isa_opts and reorder options by implied ISAs. Rename isa_opts2 to +- isa2_opts, ix86_flag_opts to flag2_opts, ix86_target_other to +- flags_other and ix86_target_other to flags2_other. Display unknown +- isa2 options. +- (ix86_valid_target_attribute_inner_p): Add missing options and +- reorder options by implied ISAs, as in ix86_target_string. ++ PR target/93089 ++ * config/i386/i386.opt (x_prefer_vector_width_type): Remove TargetSave ++ entry. ++ (mprefer-vector-width=3D): Add Save. ++ * config/i386/i386-options.c (ix86_target_string): Add PVW argument, pri= nt ++ -mprefer-vector-width=3D if non-zero. Fix up -mfpmath=3D comment. ++ (ix86_debug_options, ix86_function_specific_print): Adjust ++ ix86_target_string callers. ++ (ix86_valid_target_attribute_inner_p): Handle prefer-vector-width=3D. ++ (ix86_valid_target_attribute_tree): Likewise. ++ * config/i386/i386-options.h (ix86_target_string): Add PVW argument. ++ * config/i386/i386-expand.c (ix86_expand_builtin): Adjust ++ ix86_target_string caller. +=20 +-2017-01-13 Richard Sandiford +- +- * hash-table.h (hash_table::too_empty_p): New function. +- (hash_table::expand): Use it. +- (hash_table::traverse): Likewise. +- (hash_table::empty_slot): Use sizeof (value_type) instead of +- sizeof (PTR) to convert bytes to elements. Shrink the table +- if the current size is excessive for the current number of +- elements. +- +-2017-01-13 Richard Sandiford +- +- * ira-costs.c (record_reg_classes): Break from the inner loop +- early once alt_fail is known to be true. Update outer loop +- handling accordingly. +- +-2017-01-13 Jeff Law +- +- * tree-ssa-dse.c (decrement_count): New function. +- (increment_start_addr, maybe_trim_memstar_call): Likewise. +- (dse_dom_walker::optimize_stmt): Call maybe_trim_memstar_call directly +- when we know the partially dead statement is a mem* function. +- +- PR tree-optimization/61912 +- PR tree-optimization/77485 +- * tree-ssa-dse.c: Include expr.h. +- (maybe_trim_constructor_store): New function. +- (maybe_trim_partially_dead_store): Call maybe_trim_constructor_store. +- +- PR tree-optimization/33562 +- PR tree-optimization/61912 +- PR tree-optimization/77485 +- * doc/invoke.texi: Document new dse-max-object-size param. +- * params.def (PARM_DSE_MAX_OBJECT_SIZE): New PARAM. +- * tree-ssa-dse.c: Include params.h. +- (dse_store_status): New enum. +- (initialize_ao_ref_for_dse): New, partially extracted from +- dse_optimize_stmt. +- (valid_ao_ref_for_dse, normalize_ref): New. +- (setup_live_bytes_from_ref, compute_trims): Likewise. +- (clear_bytes_written_by, maybe_trim_complex_store): Likewise. +- (maybe_trim_partially_dead_store): Likewise. +- (maybe_trim_complex_store): Likewise. +- (dse_classify_store): Renamed from dse_possibly_dead_store_p. +- Track what bytes live from the original store. Return tri-state +- for dead, partially dead or live. +- (dse_dom_walker): Add constructor, destructor and new private members. +- (delete_dead_call, delete_dead_assignment): New extracted from +- dse_optimize_stmt. +- (dse_optimize_stmt): Make a member of dse_dom_walker. +- Use initialize_ao_ref_for_dse. +- +- PR tree-optimization/33562 +- PR tree-optimization/61912 +- PR tree-optimization/77485 +- * sbitmap.h (bitmap_count_bits): Prototype. +- (bitmap_clear_range, bitmap_set_range): Likewise. +- * sbitmap.c (bitmap_clear_range): New function. +- (bitmap_set_range, sbitmap_popcount, bitmap_count_bits): Likewise. +- +-2017-01-13 Martin Liska +- +- PR ipa/79043 +- * function.c (set_cfun): Add new argument force. +- * function.h (set_cfun): Likewise. +- * ipa-inline-transform.c (inline_call): Use the function when +- strict alising from is dropped for function we inline to. +- +-2017-01-13 Richard Biener +- +- * tree-pretty-print.c (dump_generic_node): Fix inverted condition +- for dumping GIMPLE INTEGER_CSTs. +- +-2017-01-13 Rainer Orth +- +- * config/sol2.h (TARGET_OS_CPP_BUILTINS): Define __STDC_VERSION__ +- to 201112L since C++17. +- +-2017-01-13 Maxim Ostapenko +- +- PR sanitizer/78887 +- * asan.c (asan_needs_odr_indicator_p): Don't emit ODR indicators +- if -fsanitize=3Dkernel-address is present. +- +-2017-01-13 Richard Biener +- +- * tree-pretty-print.c (dump_generic_node): Dump INTEGER_CSTs +- as _Literal ( type ) number in case usual suffixes do not +- preserve all information. +- +-2017-01-13 Richard Biener +- +- PR tree-optimization/77283 +- * gimple-ssa-split-paths.c: Include gimple-ssa.h, tree-phinodes.h +- and ssa-iterators.h. +- (is_feasible_trace): Implement a cost model based on joiner +- PHI node uses. +- +-2017-01-12 Michael Meissner +- +- PR target/79004 +- * config/rs6000/rs6000.md (FP_ISA3): Do not optimize converting +- char or short to __float128/_Float128 directly. +- +-2017-01-12 Martin Sebor +- +- to -Wformat-overflow. +- * gimple-ssa-sprintf.c (pass_sprintf_length::gate): Adjust. +- (min_bytes_remaining): Same. +- (get_string_length): Same. +- (format_string): Same. +- (format_directive): Same. +- (add_bytes): Same. +- (pass_sprintf_length::handle_gimple_call): Same. +- +-2017-01-12 Jakub Jelinek +- +- * gimple-ssa-sprintf.c (try_substitute_return_value): Remove +- info.nowrite calls with no lhs that can't throw. Return bool +- whether gsi_remove has been called or not. +- (pass_sprintf_length::handle_gimple_call): Return bool whether +- try_substitute_return_value called gsi_remove. Formatting fix. +- (pass_sprintf_length::execute): Don't use gsi_remove if +- handle_gimple_call returned true. +- +- PR bootstrap/79069 +- * cfgrtl.c (rtl_tidy_fallthru_edge): For any_uncondjump_p that can't +- be removed due to side-effects, don't remove following barrier nor +- turn the successor edge into fallthru edge. +- +-2017-01-12 Bill Schmidt +- +- PR target/79044 +- * config/rs6000/rs6000.c (insn_is_swappable_p): Mark +- element-reversing loads and stores as not swappable. +- +-2017-01-12 Nathan Sidwell +- Nicolai Stange +- +- * combine.c (try_combine): Don't ignore result of overlap checking +- loop. Combine overlap & asm check into single loop. +- +-2017-01-12 Richard Biener +- +- * tree-pretty-print.c (dump_generic_node): Provide -gimple +- variant for MEM_REF. Sanitize INTEGER_CST for -gimple. +- +-2017-01-12 Richard Biener +- +- * tree.c (initialize_tree_contains_struct): Make TS_OPTIMIZATION +- and TS_TARGET_OPTION directly derive from TS_BASE. +- * tree-core.h (tree_optimization_option): Derive from tree_base. +- (tree_target_option): Likewise. +- +-2017-01-11 Uros Bizjak +- +- * config/i386/i386.c (memory_address_length): Increase len +- only when rip_relative_addr_p returns false. +- +-2017-01-11 Julia Koval +- +- * common/config/i386/i386-common.c (OPTION_MASK_ISA_SGX_UNSET): New. +- (OPTION_MASK_ISA_SGX_SET): New. +- (ix86_handle_option): Handle OPT_msgx. +- * config.gcc: Added sgxintrin.h. +- * config/i386/driver-i386.c (host_detect_local_cpu): Detect sgx. +- * config/i386/i386-c.c (ix86_target_macros_internal): Define __SGX__. +- * config/i386/i386.c (ix86_target_string): Add -msgx. +- (PTA_SGX): New. +- (ix86_option_override_internal): Handle new options. +- (ix86_valid_target_attribute_inner_p): Add sgx. +- * config/i386/i386.h (TARGET_SGX, TARGET_SGX_P): New. +- * config/i386/i386.opt: Add msgx. +- * config/i386/sgxintrin.h: New file. +- * config/i386/x86intrin.h: Add sgxintrin.h. +- +-2017-01-11 Jakub Jelinek +- +- PR c++/71537 +- * fold-const.c (maybe_nonzero_address): Return 1 for function +- local objects. +- (tree_single_nonzero_warnv_p): Don't handle function local objects +- here. +- +- PR c++/72813 +- * gcc.c (default_compilers): Don't add -o %g.s for -S -save-temps +- of c-header. +- +-2017-01-11 David Malcolm +- +- PR driver/78877 +- * opts.c: Include "spellcheck.h" +- (struct string_fragment): New struct. +- (struct edit_distance_traits): New +- struct. +- (get_closest_sanitizer_option): New function. +- (parse_sanitizer_options): Offer suggestions for unrecognized arguments. +- +-2017-01-11 Jakub Jelinek +- +- * dwarf2out.c (DWARF_COMPILE_UNIT_HEADER_SIZE): For DWARF5 decrease +- by 12. +- (DWARF_COMDAT_TYPE_UNIT_HEADER_SIZE): Always +- DWARF_COMPILE_UNIT_HEADER_SIZE plus 12. +- (DWARF_COMPILE_UNIT_SKELETON_HEADER_SIZE): Define. +- (calc_base_type_die_sizes): Use DWARF_COMPILE_UNIT_SKELETON_HEADER_SIZE +- for initial die_offset if dwarf_split_debug_info. +- (output_comp_unit): Use DWARF_COMPILE_UNIT_SKELETON_HEADER_SIZE for +- initial next_die_offset if dwo_id is non-NULL. Don't emit padding +- fields. +- (output_skeleton_debug_sections): Formatting fix. Use +- DWARF_COMPILE_UNIT_SKELETON_HEADER_SIZE instead of +- DWARF_COMPILE_UNIT_HEADER_SIZE. Don't emit padding. +- +-2017-01-11 Wilco Dijkstra +- +- * config/arm/cortex-a53.md: Add bypasses for +- cortex_a53_r2f_cvt. +- (cortex_a53_r2f): Only use for transfers. +- (cortex_a53_f2r): Likewise. +- (cortex_a53_r2f_cvt): Add reservation for conversions. +- (cortex_a53_f2r_cvt): Likewise. +- +-2017-01-11 Tamar Christina +- +- * config/arm/arm_neon.h: Add __artificial__ and gnu_inline +- to all inlined functions, change static to extern. +- +-2017-01-11 Christophe Lyon +- +- PR target/78253 +- * config/arm/arm.c (legitimize_pic_address): Handle reference to +- weak symbol. +- (arm_assemble_integer): Likewise. +- +-2017-01-11 Richard Earnshaw +- +- * config.gcc: Use new awk script to check CPU, FPU and architecture +- parameters for --with-... options. +- * config/arm/parsecpu.awk: New file +- * config/arm/arm-cpus.in: New file. +- * config/arm/arm-opts.h: Include arm-cpu.h instead of processing .def +- files. +- * config/arm/arm.c: Include arm-cpu-data.h instead of processing .def +- files. +- * config/arm/t-arm: Update dependency rules. +- * common/config/arm/arm-common.c: Include arm-cpu-cdata.h instead +- of processing .def files. +- * config/arm/genopt.sh: Deleted. +- * config/arm/gentune.sh: Deleted. +- * config/arm/arm-cores.def: Deleted. +- * config/arm/arm-arches.def: Deleted. +- * config/arm/arm-fpus.def: Deleted. +- * config/arm/arm-tune.md: Regenerated. ++ PR target/93110 ++ * config/i386/i386.md (abs2): Use expand_simple_binop instead of ++ emitting ASHIFTRT, XOR and MINUS by hand. Use gen_int_mode with QImode ++ instead of gen_int_shift_amount + convert_modes. ++ ++ PR rtl-optimization/93088 ++ * loop-iv.c (find_single_def_src): Punt after looking through ++ 128 reg copies for regs with single definitions. Move definitions ++ to first uses. ++ ++2020-01-02 Dennis Zhang ++ ++ * config/arm/arm-c.c (arm_cpu_builtins): Define ++ __ARM_FEATURE_MATMUL_INT8, __ARM_FEATURE_BF16_VECTOR_ARITHMETIC, ++ __ARM_FEATURE_BF16_SCALAR_ARITHMETIC, and ++ __ARM_BF16_FORMAT_ALTERNATIVE when enabled. ++ * config/arm/arm-cpus.in (armv8_6, i8mm, bf16): New features. + * config/arm/arm-tables.opt: Regenerated. +- * config/arm/arm-cpu.h: New generated file. +- * config/arm/arm-cpu-data.h: New generated file. +- * config/arm/arm-cpu-cdata.h: New generated file. +- +-2017-01-11 Maxim Ostapenko +- +- PR lto/79042 +- * lto-cgraph.c (lto_output_varpool_node): Pack dynamically_initialized +- bit. +- (input_varpool_node): Unpack dynamically_initialized bit. +- +-2017-01-11 Eric Botcazou +- +- PR rtl-optimization/79032 +- * lra-constraints.c (simplify_operand_subreg): In the MEM case, test +- the alignment of the adjusted memory reference against that of MODE, +- instead of the alignment of the original memory reference. +- +-2017-01-11 Martin Jambor +- +- * hsa.c (hsa_callable_function_p): Revert addition of DECL_ARTIFICIAL +- test. +- * ipa-hsa.c (process_hsa_functions): Only duplicate non-artificial +- decorated functions. +- +-2017-01-11 Richard Biener +- +- * tree-vrp.c (evrp_dom_walker::before_dom_children): Also +- set range/nonnull info for PHI results. Do not set it on +- stmts marked for removal. +- +-2017-01-10 Eric Botcazou +- +- * expr.c (store_field): In the bitfield case, fetch the return value +- from the registers before applying a single big-endian adjustment. +- Always do a final load for a BLKmode value not larger than a word. +- +-2017-01-10 David Malcolm +- +- PR c++/77949 +- * input.c (selftest::test_accessing_ordinary_linemaps): Verify +- that we correctly handle column numbers greater than +- LINE_MAP_MAX_COLUMN_NUMBER. +- +-2017-01-10 Martin Sebor +- +- PR middle-end/78245 +- * gimple-ssa-sprintf.c (get_destination_size): Call +- {init,fini}object_sizes. +- * tree-object-size.c (addr_object_size): Adjust. +- (pass_through_call): Adjust. +- (pass_object_sizes::execute): Adjust. +- * tree-object-size.h (fini_object_sizes): Declare. +- +-2017-01-10 Martin Sebor +- +- PR tree-optimization/78775 +- * builtins.c (get_size_range): Move... +- * calls.c: ...to here. +- (alloc_max_size): Accept zero argument. +- (operand_signed_p): Remove. +- (maybe_warn_alloc_args_overflow): Call get_size_range. +- * calls.h (get_size_range): Declare. +- +-2017-01-10 Joe Seymour +- +- * config/msp430/driver-msp430.c (msp430_mcu_data): Sync with data +- from TI's devices.csv file as of September 2016. +- * config/msp430/msp430.c (msp430_mcu_data): Likewise. +- +-2017-01-10 Sandra Loosemore +- +- * doc/extend.texi: Tweak formatting to fix overfull hbox warnings. +- * doc/invoke.texi: Likewise. +- * doc/md.texi: Likewise. +- * doc/objc.texi: Likewise. +- +-2017-01-10 Joshua Conner +- +- * config/arm/fuchsia-elf.h: New file. +- * config/fuchsia.h: New file. +- * config.gcc (*-*-fuchsia*): Set native_system_header_dir. +- (aarch64*-*-fuchsia*, arm*-*-fuchsia*, x86_64-*-fuchsia*): Add to +- targets. +- * config.host: (aarch64*-*-fuchsia*, arm*-*-fuchsia*): Add to hosts. +- +-2016-01-10 Richard Biener +- +- PR tree-optimization/79034 +- * tree-call-cdce.c (shrink_wrap_one_built_in_call_with_conds): +- Propagate out degenerate PHIs in the joiner. +- +-2017-01-10 Martin Liska +- +- * ipa-icf.c (sort_sem_items_by_decl_uid): New function. +- (sort_congruence_classes_by_decl_uid): Likewise. +- (sort_congruence_class_groups_by_decl_uid): Likewise. +- (sem_item_optimizer::merge_classes): Sort class, groups in these +- classes and members in the groups by DECL_UID of declarations. +- This would make merge operations stable. +- +-2017-01-10 Martin Liska +- +- * ipa-icf.c (sem_item_optimizer::sem_item_optimizer): Remove +- usage of m_classes_vec. +- (sem_item_optimizer::~sem_item_optimizer): Likewise. +- (sem_item_optimizer::get_group_by_hash): Likewise. +- (sem_item_optimizer::subdivide_classes_by_equality): Likewise. +- (sem_item_optimizer::subdivide_classes_by_sensitive_refs): Likewise. +- (sem_item_optimizer::verify_classes): Likewise. +- (sem_item_optimizer::process_cong_reduction): Likewise. +- (sem_item_optimizer::dump_cong_classes): Likewise. +- (sem_item_optimizer::merge_classes): Likewise. +- * ipa-icf.h (congruence_class_hash): Rename from +- congruence_class_group_hash. Remove declaration of m_classes_vec. +- +-2017-01-10 Andrew Senkevich +- +- * common/config/i386/i386-common.c (OPTION_MASK_ISA_AVX512VPOPCNTDQ_SET, +- OPTION_MASK_ISA_AVX512VPOPCNTDQ_UNSET): New. +- * config.gcc: Add avx512vpopcntdqintrin.h. +- * config/i386/avx512vpopcntdqintrin.h: New. +- * config/i386/cpuid.h (bit_AVX512VPOPCNTDQ): New. +- * config/i386/i386-builtin-types.def: Add new types. +- * config/i386/i386-builtin.def (__builtin_ia32_vpopcountd_v16si, +- __builtin_ia32_vpopcountd_v16si_mask, __builtin_ia32_vpopcountq_v8di, +- __builtin_ia32_vpopcountq_v8di_mask): New. +- * config/i386/i386-c.c (ix86_target_macros_internal): Define +- __AVX512VPOPCNTDQ__. +- * config/i386/i386.c (ix86_target_string): Add -mavx512vpopcntdq. +- (PTA_AVX512VPOPCNTDQ): Define. +- * config/i386/i386.h (TARGET_AVX512VPOPCNTDQ, +- TARGET_AVX512VPOPCNTDQ_P): Define. +- * config/i386/i386.opt: Add mavx512vpopcntdq. +- * config/i386/immintrin.h: Include avx512vpopcntdqintrin.h. +- * config/i386/sse.md (define_insn "vpopcount"): New. +- +-2017-01-01 Jan Hubicka +- +- PR middle-end/77484 +- * predict.def (PRED_CALL): Set to 67. +- +-2017-01-09 Eric Botcazou +- +- * expr.c (store_field): In the bitfield case, if the value comes from +- a function call and is of an aggregate type returned in registers, do +- not modify the field mode; extract the value in all cases if the mode +- is BLKmode and the size is not larger than a word. +- +-2017-01-09 Dominique d'Humieres +- +- PR target/71017 +- * config/i386/cpuid.h: Fix undefined behavior. +- +-2017-01-04 Jeff Law +- +- PR tree-optimization/79007 +- PR tree-optimization/67955 +- * tree-ssa-alias.c (same_addr_size_stores_p): Only need to be +- conservative for pt.null when flag_non_call_exceptions is on. +- +-2017-01-09 Jakub Jelinek +- +- PR translation/79019 +- PR translation/79020 +- * params.def (PARAM_INLINE_MIN_SPEEDUP, +- PARAM_IPA_CP_SINGLE_CALL_PENALTY, +- PARAM_USE_AFTER_SCOPE_DIRECT_EMISSION_THRESHOLD): Fix typos +- in descriptions. +- * config/avr/avr.opt (maccumulate-args): Likewise. +- * config/msp430/msp430.opt (mwarn-mcu): Likewise. +- * common.opt (freport-bug): Likewise. +- * cif-code.def (CIF_FINAL_ERROR): Likewise. +- * doc/invoke.texi (ipa-cp-single-call-penalty): Likewise. +- * config/s390/s390.c (s390_invalid_binary_op): Fix spelling in +- translatable string. +- * config/i386/i386.c (function_value_32): Likewise. +- * config/nios2/nios2.c (nios2_valid_target_attribute_rec): Likewise. +- * config/msp430/msp430.c (msp430_option_override, msp430_attr): +- Likewise. +- * config/msp430/driver-msp430.c (msp430_select_hwmult_lib): Likewise. +- * common/config/msp430/msp430-common.c (msp430_handle_option): +- Likewise. +- * symtab.c (symtab_node::verify_base): Likewise. +- * opts.c (set_debug_level): Likewise. +- * tree.c (verify_type_variant): Likewise. Fix typo in comment. +- * config/rs6000/rs6000-c.c (altivec_resolve_overloaded_builtin): Add +- missing whitespace to translatable strings. +- * config/avr/avr.md (bswapsi2): Fix typo in comment. +- * config/sh/superh.h: Likewise. +- * config/i386/xopintrin.h: Likewise. +- * config/i386/znver1.md: Likewise. +- * config/rs6000/rs6000.c (struct rs6000_opt_mask): Likewise. +- * ipa-inline-analysis.c (compute_inline_parameters): Likewise. +- * double-int.h (struct double_int): Likewise. +- * double-int.c (div_and_round_double): Likewise. +- * wide-int.cc: Likewise. +- * tree-ssa.c (non_rewritable_mem_ref_base): Likewise. +- * tree-ssa-sccvn.c (vn_reference_lookup_3): Likewise. +- * cfgcleanup.c (crossjumps_occured): Renamed to ... +- (crossjumps_occurred): ... this. +- (try_crossjump_bb, try_head_merge_bb, try_optimize_cfg, cleanup_cfg): +- Adjust all uses. +- +- PR tree-optimization/78899 +- * tree-if-conv.c (version_loop_for_if_conversion): Instead of +- returning bool return struct loop *, NULL for failure and the new +- loop on success. +- (versionable_outer_loop_p): Don't version outer loop if it has +- dont_vectorized bit set. +- (tree_if_conversion): When versioning outer loop, ensure +- tree_if_conversion is performed also on the inner loop of the +- non-vectorizable outer loop copy. +- * tree-vectorizer.c (set_uid_loop_bbs): Formatting fix. Fold +- LOOP_VECTORIZED in inner loop of the scalar outer loop and +- prevent vectorization of it. +- (vectorize_loops): For outer + inner LOOP_VECTORIZED, ensure +- the outer loop vectorization of the non-scalar version is attempted +- before vectorization of the inner loop in scalar version. If +- outer LOOP_VECTORIZED guarded loop is not vectorized, prevent +- vectorization of its inner loop. +- * tree-vect-loop-manip.c (rename_variables_in_bb): If outer_loop +- has 2 inner loops, rename also on edges from bb whose single pred +- is outer_loop->header. Fix typo in function comment. +- +-2017-01-09 Martin Sebor +- +- PR bootstrap/79033 +- * asan.c (asan_emit_stack_protection): Increase local buffer size +- to avoid snprintf truncation warning. +- +-2017-01-09 Andrew Pinski +- +- * config/aarch64/aarch64-cores.def: Add thunderx2t99. Change vulcan +- to reference thunderx2t99 for the tuning structure +- * config/aarch64/aarch64-cost-tables.h (vulcan_extra_costs): +- Rename to ... +- (thunderx2t99_extra_costs): This. +- * config/aarch64/aarch64-tune.md: Regenerate. +- * config/aarch64/aarch64.c (vulcan_addrcost_table): Rename to ... +- (vulcan_addrcost_table): This. +- (vulcan_regmove_cost): Rename to ... +- (thunderx2t99_regmove_cost): This. +- (vulcan_vector_cost): Rename to ... +- (thunderx2t99_vector_cost): this. +- (vulcan_branch_cost): Rename to ... +- (thunderx2t99_branch_cost): This. +- (vulcan_tunings): Rename to ... +- (thunderx2t99_tunings): This and s/vulcan/thunderx2t99 . +- * doc/invoke.texi (AARCH64/mtune): Add thunderx2t99. +- +-2017-01-09 Martin Jambor +- +- PR ipa/78365 +- PR ipa/78599 +- * ipa-prop.h (ipa_jump_func): Swap positions of vr_known and m_vr. +- * ipa-cp.c (ipa_vr_operation_and_type_effects): New function. +- (propagate_vr_accross_jump_function): Use the above function for all +- value range computations for pass-through jump functions and type +- converasion from explicit value range values. +- (ipcp_propagate_stage): Do not attempt to deduce types of formal +- parameters from TYPE_ARG_TYPES. +- * ipa-prop.c (ipa_write_jump_function): Remove trailing whitespace. +- (ipa_write_node_info): Stream type of the actual argument. +- (ipa_read_node_info): Likewise. Also remove trailing whitespace. +- +-2017-01-09 Martin Liska +- +- PR pch/78970 +- * gcc.c (driver_handle_option): Handle OPT_E and set have_E. +- (lookup_compiler): Do not show error message with have_E. +- +-2017-01-09 Jakub Jelinek +- +- PR tree-optimization/78938 +- * tree-vect-stmts.c (vectorizable_condition): For non-masked COND_EXPR +- where comp_vectype is VECTOR_BOOLEAN_TYPE_P, use +- BIT_{NOT,XOR,AND,IOR}_EXPR on the comparison operands instead of +- {EQ,NE,GE,GT,LE,LT}_EXPR directly inside of VEC_COND_EXPR. Formatting +- fixes. +- +-2017-01-09 Kyrylo Tkachov +- +- * tree-ssa-address.c (gen_addr_rtx): Don't handle index if it +- is const0_rtx. +- +-2017-01-09 Richard Biener +- +- PR tree-optimization/78997 +- * tree-vect-slp.c (vect_mask_constant_operand_p): Handle SSA +- name condition properly. +- +-2017-01-09 Richard Biener +- +- PR debug/79000 +- * dwarf2out.c (is_cxx): New overload with context. +- (is_naming_typedef_decl): Use it. +- +-2017-01-08 Sandra Loosemore +- +- * invoke.texi (Option Summary): Correct spacing in option lists +- and add line breaks to fix over-long lines. +- +-2017-01-08 Sandra Loosemore +- +- PR middle-end/17660 +- +- * extend.texi (Common Variable Attributes): Add xref to GCC +- Internals manual to explain mode attribute keywords. +- +-2017-01-08 Sandra Loosemore +- +- PR other/16519 +- * doc/invoke.texi (Option Summary): Move -pthread to Linker Options +- and Preprocessor Options. +- (Options for Linking): Document -pthread here.... +- (RS/6000 and PowerPC Options): ...not here. +- (Solaris 2 Options): ...or here. +- * doc/cppopts.texi: Document -pthread. +- +-2017-01-08 Martin Sebor +- +- PR middle-end/77708 +- * doc/invoke.texi (Warning Options): Document -Wformat-truncation. +- * gimple-ssa-sprintf.c (call_info::reval_used, call_info::warnopt): +- New member functions. +- (format_directive): Used them. +- (add_bytes): Same. +- (pass_sprintf_length::handle_gimple_call): Same. +- * graphite-sese-to-poly.c (tree_int_to_gmp): Increase buffer size +- to avoid truncation for any argument. +- (extract_affine_mul): Same. +- * tree.c (get_file_function_name): Same. +- +-2017-01-01 Jan Hubicka +- +- PR middle-end/77484 +- * predict.def (PRED_INDIR_CALL): Set to 86. +- +-2017-01-07 Sandra Loosemore +- +- PR preprocessor/54124 +- * doc/cppopts.texi: Reformat -d subtable to list the full name +- of the options. Add cross-reference to the docs for the general +- compiler -d options. +- * doc/invoke.texi (Developer Options): Add cross-reference to the +- preprocessor-specific -d option documentation. +- +-2017-01-07 Sandra Loosemore +- +- PR preprocessor/13498 +- * doc/cpp.texi (Search Path): Rewrite to remove obsolete and +- redudant material, and reflect new command-line options. +- (System Headers): Likewise. +- +-2017-01-07 Sandra Loosemore +- +- * doc/cppdiropts.texi: Merge documentation of -I, -iquote, +- -isystem, and -idirafter. Copy-edit. +- * doc/cppopts.texi: Copy-edit. Remove contradiction about +- default for -ftrack-macro-expansion. Delete obsolete and +- badly-formatted implementation details about -fdebug-cpp output. +- * doc/cppwarnopts.texi: Copy-edit. +- +-2017-01-07 David Malcolm +- +- PR c++/72803 +- * input.c (selftest::test_accessing_ordinary_linemaps): Verify +- that the transition from a max line width >=3D 1<<10 to narrower +- lines works correctly. +- +-2017-01-07 Alexandre Oliva +- +- * doc/options.texi (PerFunction): New. +- * opt-functions.awk (switch_flags): Map both Optimization and +- PerFunction to CL_OPTIMIZATION. +- * opth-gen.awk: Test for PerFunction flag along with +- Optimization. +- * optc-save-gen.awk: Likewise. Introduce var_opt_hash and set +- it only when the latter is present. Skip those that don't in +- the hash function generator. +- * common.opt (fvar-tracking): Mark as PerFunction instead of +- Optimization. +- (fvar-tracking-assignments): Likewise. +- (fvar-tracking-assignments-toggle): Likewise. +- (fvar-tracking-uninit): Likewise. +- +-2017-01-07 Jakub Jelinek +- +- PR translation/79018 +- * params.def (PARAM_MAX_STORES_TO_MERGE): Add missing space between +- the and store. +- +-2017-01-06 Mikael Pettersson +- +- PR target/57583 +- * config/m68k/m68k.opt (LONG_JUMP_TABLE_OFFSETS): New option. +- * config/m68k/linux.h (ASM_RETURN_CASE_JUMP): Handle +- TARGET_LONG_JUMP_TABLE_OFFSETS. +- * config/m68k/m68kelf.h (ASM_RETURN_CASE_JUMP): Likewise. +- * config/m68k/netbsd-elf.h (ASM_RETURN_CASE_JUMP): Likewise. +- * config/m68k/m68k.h (CASE_VECTOR_MODE): Likewise. +- (ASM_OUTPUT_ADDR_DIFF_ELF): Likewise. +- * config/m68k/m68k.md (tablejump expander): Likewise. +- (*tablejump_pcrel_hi): Renamed from unnamed insn, reject +- TARGET_LONG_JUMP_TABLE_OFFSETS. +- (*tablejump_pcrel_si): New insn, handle TARGET_LONG_JUMP_TABLE_OFFSETS. +- * doc/invoke.texi (M68K options): Add -mlong-jump-table-offsets. +- +-2017-01-06 Edgar E. Iglesias +- David Holsgrove +- +- * common/config/microblaze/microblaze-common.c +- (TARGET_EXCEPT_UNWIND_INFO): Remove. +- * config/microblaze/microblaze-protos.h (microblaze_eh_return): +- New prototype. +- * config/microblaze/microblaze.c (microblaze_must_save_register) +- (microblaze_expand_epilogue, microblaze_return_addr): Handle +- calls_eh_return. +- (microblaze_eh_return): New function. +- * config/microblaze/microblaze.h (RETURN_ADDR_OFFSET) +- (EH_RETURN_DATA_REGNO, MB_EH_STACKADJ_REGNUM) +- (EH_RETURN_STACKADJ_RTX, ASM_PREFERRED_EH_DATA_FORMAT): New macros. +- * config/microblaze/microblaze.md (eh_return): New pattern. +- +-2017-01-06 Jakub Jelinek +- +- * system.h (GCC_DIAGNOSTIC_PUSH_IGNORED, GCC_DIAGNOSTIC_POP, +- GCC_DIAGNOSTIC_STRINGIFY): Define. +- +- * read-rtl.c (rtx_reader::read_rtx_code): Avoid -Wsign-compare warning. +- +-2017-01-06 Andre Vieira +- +- * config/arm/arm.md (): New. +- (): New. +- * config/arm/arm.c (arm_arch5te): New. +- (arm_option_override): Set arm_arch5te. +- (arm_coproc_builtin_available): Add support for mcrr, mcrr2, mrrc +- and mrrc2. +- * config/arm/arm-builtins.c (MCRR_QUALIFIERS): Define to... +- (arm_mcrr_qualifiers): ... this. New. +- (MRRC_QUALIFIERS): Define to... +- (arm_mrrc_qualifiers): ... this. New. +- * config/arm/arm_acle.h (__arm_mcrr, __arm_mcrr2, __arm_mrrc, +- __arm_mrrc2): New. +- * config/arm/arm_acle_builtins.def (mcrr, mcrr2, mrrc, mrrc2): New. +- * config/arm/iterators.md (MCRRI, mcrr, MCRR): New. +- (MRRCI, mrrc, MRRC): New. +- * config/arm/unspecs.md (VUNSPEC_MCRR, VUNSPEC_MCRR2, VUNSPEC_MRRC, +- VUNSPEC_MRRC2): New. +- +-2017-01-06 Andre Vieira +- +- * config/arm/arm.md (): New. +- (): New. +- * config/arm/arm.c (arm_coproc_builtin_available): Add +- support for mcr, mrc, mcr2 and mrc2. +- * config/arm/arm-builtins.c (MCR_QUALIFIERS): Define to... +- (arm_mcr_qualifiers): ... this. New. +- (MRC_QUALIFIERS): Define to ... +- (arm_mrc_qualifiers): ... this. New. +- (MCR_QUALIFIERS): Define to ... +- (arm_mcr_qualifiers): ... this. New. +- * config/arm/arm_acle.h (__arm_mcr, __arm_mrc, __arm_mcr2, +- __arm_mrc2): New. +- * config/arm/arm_acle_builtins.def (mcr, mcr2, mrc, mrc2): New. +- * config/arm/iterators.md (MCRI, mcr, MCR, MRCI, mrc, MRC): New. +- * config/arm/unspecs.md (VUNSPEC_MCR, VUNSPEC_MCR2, VUNSPEC_MRC, +- VUNSPEC_MRC2): New. +- +-2017-01-06 Andre Vieira +- +- * config/arm/arm.md (*ldc): New. +- (*stc): New. +- (): New. +- (): New. +- * config/arm/arm.c (arm_coproc_builtin_available): Add +- support for ldc,ldcl,stc,stcl,ldc2,ldc2l,stc2 and stc2l. +- (arm_coproc_ldc_stc_legitimate_address): New. +- * config/arm/arm-builtins.c (arm_type_qualifiers): Add +- 'qualifier_const_pointer'. +- (LDC_QUALIFIERS): Define to... +- (arm_ldc_qualifiers): ... this. New. +- (STC_QUALIFIERS): Define to... +- (arm_stc_qualifiers): ... this. New. +- * config/arm/arm-protos.h +- (arm_coproc_ldc_stc_legitimate_address): New. +- * config/arm/arm_acle.h (__arm_ldc, __arm_ldcl, __arm_stc, +- __arm_stcl, __arm_ldc2, __arm_ldc2l, __arm_stc2, __arm_stc2l): New. +- * config/arm/arm_acle_builtins.def (ldc, ldc2, ldcl, ldc2l, stc, +- stc2, stcl, stc2l): New. +- * config/arm/constraints.md (Uz): New. +- * config/arm/iterators.md (LDCI, STCI, ldc, stc, LDC STC): New. +- * config/arm/unspecs.md (VUNSPEC_LDC, VUNSPEC_LDC2, VUNSPEC_LDCL, +- VUNSPEC_LDC2L, VUNSPEC_STC, VUNSPEC_STC2, VUNSPEC_STCL, +- VUNSPEC_STC2L): New. +- +-2017-01-06 Andre Vieira +- +- * config/arm/arm.md (): New. +- * config/arm/arm.c (neon_const_bounds): Rename this ... +- (arm_const_bounds): ... this. +- (arm_coproc_builtin_available): New. +- * config/arm/arm-builtins.c (SIMD_MAX_BUILTIN_ARGS): Increase. +- (arm_type_qualifiers): Add 'qualifier_unsigned_immediate'. +- (CDP_QUALIFIERS): Define to... +- (arm_cdp_qualifiers): ... this. New. +- (void_UP): Define. +- (arm_expand_builtin_args): Add case for 6 arguments. +- * config/arm/arm-protos.h (neon_const_bounds): Rename this ... +- (arm_const_bounds): ... this. +- (arm_coproc_builtin_available): New. +- * config/arm/arm_acle.h (__arm_cdp): New. +- (__arm_cdp2): New. +- * config/arm/arm_acle_builtins.def (cdp): New. +- (cdp2): New. +- * config/arm/iterators.md (CDPI,CDP,cdp): New. +- * config/arm/neon.md: Rename all 'neon_const_bounds' to +- 'arm_const_bounds'. +- * config/arm/types.md (coproc): New. +- * config/arm/unspecs.md (VUNSPEC_CDP, VUNSPEC_CDP2): New. +- * gcc/doc/extend.texi (ACLE): Add a mention of Coprocessor intrinsics. +- * gcc/doc/sourcebuild.texi (arm_coproc1_ok, arm_coproc2_ok, +- arm_coproc3_ok, arm_coproc4_ok): Document new effective targets. +- +-2017-01-06 Andre Vieira +- +- * config/arm/arm-builtins.c (arm_unsigned_binop_qualifiers): New. +- (UBINOP_QUALIFIERS): New. +- (si_UP): Define. +- (acle_builtin_data): New. Change comment. +- (arm_builtins): Remove ARM_BUILTIN_CRC32B, ARM_BUILTIN_CRC32H, +- ARM_BUILTIN_CRC32W, ARM_BUILTIN_CRC32CB, ARM_BUILTIN_CRC32CH, +- ARM_BUILTIN_CRC32CW. Add ARM_BUILTIN_ACLE_BASE and include +- arm_acle_builtins.def. +- (ARM_BUILTIN_ACLE_PATTERN_START): Define. +- (arm_init_acle_builtins): New. +- (CRC32_BUILTIN): Remove. +- (bdesc_2arg): Remove entries for crc32b, crc32h, crc32w, +- crc32cb, crc32ch and crc32cw. +- (arm_init_crc32_builtins): Remove. +- (arm_init_builtins): Use arm_init_acle_builtins rather +- than arm_init_crc32_builtins. +- (arm_expand_acle_builtin): New. +- (arm_expand_builtin): Use 'arm_expand_acle_builtin'. +- * config/arm/arm_acle_builtins.def: New. +- +-2017-01-06 Andre Vieira +- +- * config/arm/arm-builtins.c (neon_builtin_datum): Rename to .. +- (arm_builtin_datum): ... this. +- (arm_init_neon_builtin): Rename to ... +- (arm_init_builtin): ... this. Add a new parameters PREFIX +- and USE_SIG_IN_NAME. +- (arm_init_neon_builtins): Replace 'arm_init_neon_builtin' with +- 'arm_init_builtin'. Replace type 'neon_builtin_datum' with +- 'arm_builtin_datum'. +- (arm_init_vfp_builtins): Likewise. +- (builtin_arg): Rename enum's replacing 'NEON_ARG' with +- 'ARG_BUILTIN' and add a 'ARG_BUILTIN_NEON_MEMORY. +- (arm_expand_neon_args): Rename to ... +- (arm_expand_builtin_args): ... this. Rename builtin_arg +- enum values and differentiate between ARG_BUILTIN_MEMORY +- and ARG_BUILTIN_NEON_MEMORY. +- (arm_expand_neon_builtin_1): Rename to ... +- (arm_expand_builtin_1): ... this. Rename builtin_arg enum +- values, arm_expand_builtin_args and add bool parameter NEON. +- (arm_expand_neon_builtin): Use arm_expand_builtin_1. +- (arm_expand_vfp_builtin): Likewise. +- (NEON_MAX_BUILTIN_ARGS): Remove, it was unused. +- +-2017-01-01 Jan Hubicka +- +- PR middle-end/77484 +- * predict.def (PRED_POLYMORPHIC_CALL): Set to 59. +- * predict.c (tree_estimate_probability_bb): Reverse direction of +- polymorphic call predictor. +- +-2017-01-06 David Malcolm +- +- * passes.c (execute_one_pass): Split out pass-skipping logic into... +- (determine_pass_name_match): ...this new function and... +- (should_skip_pass_p): ...this new function. +- +-2017-01-06 Nathan Sidwell +- +- * ipa-visibility.c (function_and_variable_visibility): Reformat +- comments and long lines. Remove extrneous if. +- * symtab.c (symtab_node::make_decl_local): Fix code format. +- (symtab_node::set_section_for_node): Fix comment typo. +- +-2017-01-06 Martin Liska +- +- PR bootstrap/79003 +- * lra-constraints.c: Rename invariant to lra_invariant. +- * predict.c (set_even_probabilities): Initialize e to NULL. +- +-2017-01-05 Martin Sebor +- +- PR tree-optimization/78910 +- * gimple-ssa-sprintf.c (tree_digits): Add an argument. +- (format_integer): Correct off-by-one error in the handling +- of precision with negative numbers in signed conversions.. +- +-2017-01-05 Eric Botcazou +- +- * doc/invoke.texi (C Dialect Options): Adjust -fsso-struct entry. +- +-2017-01-05 Jakub Jelinek +- +- PR tree-optimization/71016 +- * tree-ssa-phiopt.c (tree_ssa_phiopt_worker): Pass cond_stmt to +- factor_out_conditional_conversion. Formatting fix. +- (factor_out_conditional_conversion): Add cond_stmt argument. +- If arg1 is INTEGER_CST, punt if new_arg0 is not any operand of +- cond_stmt and if arg0_def_stmt is not the only stmt in its bb. +- Formatting fix. +- +-2017-01-05 David Malcolm +- +- * Makefile.in (OBJS): Add read-md.o, read-rtl.o, +- read-rtl-function.o, and selftest-rtl.o. +- * config/aarch64/aarch64.c: Include selftest.h and selftest-rtl.h. +- (selftest::aarch64_test_loading_full_dump): New function. +- (selftest::aarch64_run_selftests): New function. +- (TARGET_RUN_TARGET_SELFTESTS): Wire it up to +- selftest::aarch64_run_selftests. +- * config/i386/i386.c +- (selftest::ix86_test_loading_dump_fragment_1): New function. +- (selftest::ix86_test_loading_call_insn): New function. +- (selftest::ix86_test_loading_full_dump): New function. +- (selftest::ix86_test_loading_unspec): New function. +- (selftest::ix86_run_selftests): Call the new functions. +- * emit-rtl.c (maybe_set_max_label_num): New function. +- * emit-rtl.h (maybe_set_max_label_num): New decl. +- * function.c (instantiate_decls): Guard call to +- instantiate_decls_1 with if (DECL_INITIAL (fndecl)). +- * function-tests.c (selftest::verify_three_block_rtl_cfg): Remove +- "static". +- * gensupport.c (gen_reader::gen_reader): Pass "false" +- for new "compact" param of rtx_reader. +- * print-rtl.c (rtx_writer::print_rtx_operand): Print "(nil)" +- rather than an empty string for NULL strings. +- * read-md.c: Potentially include config.h rather than bconfig.h. +- Wrap include of errors.h with #ifdef GENERATOR_FILE. +- (have_error): New global, copied from errors.c. +- (md_reader::read_name): Rename to... +- (md_reader::read_name_1): ...this, adding "out_loc" param, +- and converting "missing name or number" to returning false, rather +- than failing. +- (md_reader::read_name): Reimplement in terms of read_name_1. +- (md_reader::read_name_or_nil): New function. +- (md_reader::read_string): Handle "(nil)" by returning NULL. +- (md_reader::md_reader): Add new param "compact". +- (md_reader::read_md_files): Wrap with #ifdef GENERATOR_FILE. +- (md_reader::read_file): New method. +- * read-md.h (md_reader::md_reader): Add new param "compact". +- (md_reader::read_file): New method. +- (md_reader::is_compact): New accessor. +- (md_reader::read_name): Convert return type from void to file_location. +- (md_reader::read_name_or_nil): New decl. +- (md_reader::read_name_1): New decl. +- (md_reader::m_compact): New field. +- (noop_reader::noop_reader): Pass "false" for new "compact" param +- of rtx_reader. +- (rtx_reader::rtx_reader): Add new "compact" param. +- (rtx_reader::read_rtx_operand): Make virtual and convert return +- type from void to rtx. +- (rtx_reader::read_until): New decl. +- (rtx_reader::handle_any_trailing_information): New virtual function. +- (rtx_reader::postprocess): New virtual function. +- (rtx_reader::finalize_string): New virtual function. +- (rtx_reader::m_in_call_function_usage): New field. +- (rtx_reader::m_reuse_rtx_by_id): New field. +- * read-rtl-function.c: New file. +- * selftest-rtl.c (selftest::assert_rtx_ptr_eq_at): New function. +- * selftest-rtl.h (ASSERT_RTX_PTR_EQ): New macro. +- (selftest::verify_three_block_rtl_cfg): New decl. +- * read-rtl-function.h: New file. +- * read-rtl.c: Potentially include config.h rather than bconfig.h. +- For host, include function.h, memmodel.h, and emit-rtl.h. +- (one_time_initialization): New function. +- (struct compact_insn_name): New struct. +- (compact_insn_names): New array. +- (find_code): Handle insn codes in compact dumps. +- (apply_subst_iterator): Wrap with #ifdef GENERATOR_FILE. +- (bind_subst_iter_and_attr): Likewise. +- (add_condition_to_string): Likewise. +- (add_condition_to_rtx): Likewise. +- (apply_attribute_uses): Likewise. +- (add_current_iterators): Likewise. +- (apply_iterators): Likewise. +- (initialize_iterators): Guard usage of apply_subst_iterator with +- #ifdef GENERATOR_FILE. +- (read_conditions): Wrap with #ifdef GENERATOR_FILE. +- (md_reader::read_mapping): Likewise. +- (add_define_attr_for_define_subst): Likewise. +- (add_define_subst_attr): Likewise. +- (read_subst_mapping): Likewise. +- (check_code_iterator): Likewise. +- (rtx_reader::read_rtx): Likewise. Move one-time initialization +- logic to... +- (one_time_initialization): New function. +- (rtx_reader::read_until): New method. +- (read_flags): New function. +- (parse_reg_note_name): New function. +- (rtx_reader::read_rtx_code): Initialize "iterator" to NULL. +- Handle reuse_rtx ids. +- Wrap iterator lookup within #ifdef GENERATOR_FILE. +- Add parsing support for RTL dumps, mirroring the special-cases in +- print_rtx, by calling read_flags, reading REG_NOTE names, INSN_UID +- values, and calling handle_any_trailing_information. +- (rtx_reader::read_rtx_operand): Convert return type from void +- to rtx, returning return_rtx. Handle case 'e'. Call +- finalize_string on XSTR and XTMPL fields. +- (rtx_reader::read_nested_rtx): Handle dumps in which trailing +- "(nil)" values were omitted. Call the postprocess vfunc on the +- return_rtx. +- (rtx_reader::rtx_reader): Add new "compact" param and pass to base +- class ctor. Initialize m_in_call_function_usage. Call +- one_time_initialization. +- * rtl-tests.c (selftest::test_uncond_jump): Call +- set_new_first_and_last_insn. +- * rtl.h (read_rtx): Wrap decl with #ifdef GENERATOR_FILE. +- * selftest-rtl.c: New file. +- * selftest-rtl.h (class selftest::rtl_dump_test): New class. +- (selftest::get_insn_by_uid): New decl. +- * selftest-run-tests.c (selftest::run_tests): Call +- read_rtl_function_c_tests. +- * selftest.h (selftest::read_rtl_function_c_tests): New decl. +- * tree-dfa.c (ssa_default_def): Return NULL_TREE for rtl function +- dumps. +- +-2017-01-05 Uros Bizjak +- +- * config/i386/i386.md (*testqi_ext_3): No need to handle memory +- operands in a special way. Assert that pos+len <=3D mode precision. +- +-2017-01-05 Jakub Jelinek +- +- * common.opt (fvect-cost-model): Remove RejectNegative flag, use +- 3 argument Alias with unlimited for the negative form. +- (fno-vect-cost-model): Removed. +- +-2017-01-05 Martin Liska +- +- * hsa-gen.c (gen_hsa_divmod): New function. +- (gen_hsa_insn_for_internal_fn_call): Use the function for IFN_DIVMOD. +- +-2017-01-05 Martin Liska +- +- PR pch/78970 +- * gcc.c (lookup_compiler): Reject '-' filename for a precompiled +- header. +- +-2017-01-05 Andreas Krebbel +- +- * config/s390/s390.c (s390_expand_setmem): Unroll the loop for +- small constant length operands. +- +-2017-01-05 Andreas Krebbel +- +- * config/s390/s390.c (s390_expand_setmem): Avoid overlapping bytes +- between loop iterations. +- +-2017-01-05 Martin Liska +- +- PR sanitizer/78815 +- * gimplify.c (gimplify_decl_expr): Compare to +- asan_poisoned_variables instread of checking flags. +- (gimplify_target_expr): Likewise. +- (gimplify_expr): Likewise. +- (gimplify_function_tree): Conditionally initialize +- asan_poisoned_variables. +- +-2017-01-04 Jeff Law +- +- PR tree-optimizatin/78812 +- * rtl.h (contains_mem_rtx_p): Prototype. +- * ifcvt.c (containts_mem_rtx_p): Move from here to... +- * rtlanal.c (contains_mem_rtx_p): Here and remove static linkage. +- * gcse.c (prune_expressions): Use contains_mem_rtx_p to discover +- and prune MEMs that are not at the toplevel of a SET_SRC rtx. Look +- through ZERO_EXTEND and SIGN_EXTEND when trying to avoid pruning MEMs. +- +-2017-01-04 Alexandre Oliva +- +- * input.c (assert_char_at_range): Default-initialize actual_range. +- +-2017-01-04 Alexandre Oliva +- +- * df-scan.c (df_ref_create_structure): Make regno unsigned, +- to match the caller. +- +-2017-01-04 Alexandre Oliva +- +- * cfgexpand.c (expand_gimple_basic_block): Disregard debug +- insns after final jump in test to emit dummy move. +- +-2017-01-04 Alexandre Oliva +- +- * gimple-iterator.h (gsi_one_nondebug_before_end_p): New. +- * tree-eh.c (cleanup_empty_eh): Skip more debug stmts. +- +-2017-01-04 Alexandre Oliva +- +- * multiple_target.c (create_dispatcher_calls): Init e_next. +- * tree-ssa-loop-split.c (split_loop): Init border. +- * tree-vect-loop.c (vect_determine_vectorization_factor): Init +- scalar_type. +- +-2017-01-04 Michael Meissner +- +- PR target/71977 +- PR target/70568 +- PR target/78823 +- * config/rs6000/predicates.md (sf_subreg_operand): New predicate. +- (altivec_register_operand): Do not return true if the operand +- contains a SUBREG mixing SImode and SFmode. +- (vsx_register_operand): Likewise. +- (vsx_reg_sfsubreg_ok): New predicate. +- (vfloat_operand): Do not return true if the operand contains a +- SUBREG mixing SImode and SFmode. +- (vint_operand): Likewise. +- (vlogical_operand): Likewise. +- (gpc_reg_operand): Likewise. +- (int_reg_operand): Likewise. +- * config/rs6000/rs6000-protos.h (valid_sf_si_move): Add declaration. +- * config/rs6000/rs6000.c (valid_sf_si_move): New function to +- determine if a MOVSI or MOVSF operation contains SUBREGs that mix +- SImode and SFmode. +- (rs6000_emit_move_si_sf_subreg): New helper function. +- (rs6000_emit_move): Call rs6000_emit_move_si_sf_subreg to possbily +- fixup SUBREGs involving SImode and SFmode. +- * config/rs6000/vsx.md (SFBOOL_*): New constants that are operand +- numbers for the new peephole2 optimization. +- (peephole2 for SFmode unions): New peephole2 to optimize cases in +- the GLIBC math library that do AND/IOR/XOR operations on single +- precision floating point. +- * config/rs6000/rs6000.h (TARGET_NO_SF_SUBREG): New internal +- target macros to say whether we need to avoid SUBREGs mixing +- SImode and SFmode. +- (TARGET_ALLOW_SF_SUBREG): Likewise. +- * config/rs6000/rs6000.md (UNSPEC_SF_FROM_SI): New unspecs. +- (UNSPEC_SI_FROM_SF): Likewise. +- (iorxor): Change spacing. +- (and_ior_xor): New iterator for AND, IOR, and XOR. +- (movsi_from_sf): New insns for SImode/SFmode SUBREG support. +- (movdi_from_sf_zero_ext): Likewise. +- (mov_hardfloat, FMOVE32 iterator): Use register_operand +- instead of gpc_reg_operand. Add SImode/SFmode SUBREG support. +- (movsf_from_si): New insn for SImode/SFmode SUBREG support. +- (fma4): Use gpc_reg_operand instead of register_operand. +- (fms4): Likewise. +- (fnma4): Likewise. +- (fnms4): Likewise. +- (nfma4): Likewise. +- (nfms4): Likewise. +- +-2017-01-04 Marek Polacek +- +- PR c++/64767 +- * doc/invoke.texi: Document -Wpointer-compare. +- +-2017-01-04 Jakub Jelinek +- +- * optc-gen.awk: Emit #error for -W*/-f*/-m* Enum without +- RejectNegative. +- +- * dwarf2out.c (output_loc_list): Don't throw away 64K+ location +- descriptions for -gdwarf-5 and emit them as uleb128 instead of +- 2-byte data. +- +-2017-01-04 Kelvin Nilsen +- +- PR target/78056 +- * doc/sourcebuild.texi (PowerPC-specific attributes): Add +- documentation of the powerpc_popcntb_ok attribute. +- * config/rs6000/rs6000.c (rs6000_option_override_internal): Add +- code to issue warning messages if a requested CPU configuration is +- not supported by the binary (assembler and loader) toolchain. +- (spe_init_builtins): Add two assertions to prevent ICE if attempt is +- made to define a built-in function that has been disabled. +- (paired_init_builtins): Add assertion to prevent ICE if attempt is +- made to define a built-in function that has been disabled. +- (altivec_init_builtins): Add comment explaining why definition +- of the DST built-in functions is not preceded by an assertion +- check. Add assertions to prevent ICE if attempts are made to +- define an altivec predicate or an abs* built-in function that has +- been disabled. +- (htm_init_builtins): Add comment explaining why definition of the +- htm built-in functions is not preceded by an assertion check. +- +-2017-01-04 Jeff Law +- +- PR tree-optimizatin/67955 +- * tree-ssa-alias.c (same_addr_size_stores_p): Check offsets first. +- Allow any SSA_VAR_P as the base objects. Use integer_zerop. Verify +- the points-to solution does not include pt_null. Use DECL_PT_UID +- unconditionally. +- +-2017-01-04 Uros Bizjak +- +- * config/i386/i386.md (HI/SImode test with imm to QImode splitters): +- Use gen_int_mode instead of gen_lopwart for const_int operands. +- +-2017-01-04 Jakub Jelinek +- +- PR tree-optimization/71563 +- * match.pd: Simplify X << Y into X if Y is known to be 0 or +- out of range value - has low bits known to be zero. +- +-2017-01-04 Alan Modra +- +- * Makefile.in (aclocal_deps): Update and order as per aclocal.m4. +- * configure: Regenerate. +- * config.in: Regenerate. +- +-2017-01-04 Jakub Jelinek +- +- PR bootstrap/77569 +- * input.c (ebcdic_execution_charset::on_error): Don't use strstr for +- a substring of the message, but strcmp with the whole message. Ifdef +- ENABLE_NLS, translate the message first using dgettext. +- +-2017-01-03 Jeff Law +- +- PR tree-optimizatin/78856 +- * tree-ssa-threadupdate.c: Include tree-vectorizer.h. +- (mark_threaded_blocks): Remove code to truncate thread paths that +- cross multiple loop headers. Instead invalidate the cached loop +- iteration information and handle case of a thread path walking +- into an irreducible region. +- +-2017-01-03 Michael Meissner +- +- PR target/78900 +- * config/rs6000/rs6000.c (rs6000_split_signbit): Change some +- assertions. Add support for doing the signbit if the IEEE 128-bit +- floating point value is in a GPR. +- * config/rs6000/rs6000.md (Fsignbit): Delete. +- (signbit2_dm): Delete using and just use "wa". +- Update the length attribute if the value is in a GPR. +- (signbit2_dm_ext): Add combiner pattern to eliminate +- the sign or zero extension instruction, since the value is always 0/1. +- (signbit2_dm2): Delete using . +- +- PR target/78953 +- * config/rs6000/vsx.md (vsx_extract__store_p9): If we are +- extracting SImode to a GPR register so that we can generate a +- store, limit the vector to be in a traditional Altivec register +- for the vextuwrx instruction. +- +-2017-01-03 Ian Lance Taylor +- +- * godump.c (go_format_type): Treat ENUMERAL_TYPE like INTEGER_TYPE. +- +-2017-01-03 Martin Sebor +- +- PR tree-optimization/78696 +- * gimple-ssa-sprintf.c (format_floating): Correct handling of +- precision. Use MPFR for %f for greater fidelity. Correct handling +- of %g. +- (pass_sprintf_length::compute_format_length): Set width and precision +- specified by asrerisk to void_node for vararg functions. +- (try_substitute_return_value): Adjust dump output. +- +-2017-01-03 David Edelsohn +- +- * doc/invoke.texi (RS6000 options): LRA is enabled by default. +- +-2017-01-03 Eric Botcazou +- +- * doc/invoke.texi (SPARC options): Document -mlra as the default. +- * config/sparc/sparc.c (sparc_option_override): Force LRA unless +- -mlra/-mno-lra was passed to the compiler. +- +-2017-01-03 James Cowgill +- +- PR rtl-optimization/65618 +- * emit-rtl.c (try_split): Move initialization of "before" and +- "after" to just before the call to emit_insn_after_setloc. +- +-2017-01-03 Gerald Pfeifer +- +- * doc/md.texi (Standard Names): Remove reference to Java frontend. +- +-2017-01-03 Pierre-Marie de Rodat +- +- * dwarf2out.c (gen_enumeration_type_die): When +- -gno-strict-dwarf, add a DW_AT_encoding attribute. +- +-2017-01-03 Jakub Jelinek +- +- PR tree-optimization/78965 +- * gimple-ssa-sprintf.c (pass_sprintf_length::compute_format_length): +- Change first argument from const call_info & to call_info &. For %n +- set info.nowrite to false. +- +- PR middle-end/78901 +- * gimple-ssa-sprintf.c (try_substitute_return_value): Don't change +- possibly throwing calls. +- +- * genmatch.c (dt_node::gen_kids_1): If generic_exprs include SSA_NAME +- and exprs_len || fns_len, emit the code for SSA_NAME next to the exprs +- and fns handling, rather than in a separate case SSA_NAME. +- +-2017-01-02 Jeff Law +- +- * config/darwin-driver.c (darwin_driver_init): Const-correctness +- fixes for first_period and second_period variables. +- +-2017-01-02 Uros Bizjak +- +- PR target/78967 +- * config/i386/i386.md (UNSPEC_NOREX_MEM): New unspec. +- (*insvqi_1): New insn pattern. +- (*insvqi_1_mem_rex64): Ditto. +- (*insvqi_2): Ditto. +- (*insvqi_3): Rename from *insvqi. +- +- (*extzvqi_mem_rex64): Add UNSPEC_NOREX_MEM tag. +- +-2017-01-02 Gerald Pfeifer +- +- * doc/cfg.texi (Edges): Remove reference to Java. +- (Maintaining the CFG): Ditto. +- +-2017-01-01 Jan Hubicka +- +- PR middle-end/77674 +- * symtab.c (symtab_node::binds_to_current_def_p): Fix handling of +- transparent aliases. +- +-2017-01-01 Jan Hubicka +- +- PR middle-end/77484 +- * predict.def (PRED_CALL): Update hitrate. +- (PRED_INDIR_CALL, PRED_POLYMORPHIC_CALL): New predictors. +- * predict.c (tree_estimate_probability_bb): Split CALL predictor +- into direct/indirect/polymorphic variants. +- +-2017-01-01 Jakub Jelinek ++ * config/arm/arm.c (arm_option_reconfigure_globals): Initialize ++ arm_arch_i8mm and arm_arch_bf16 when enabled. ++ * config/arm/arm.h (TARGET_I8MM): New macro. ++ (TARGET_BF16_FP, TARGET_BF16_SIMD): Likewise. ++ * config/arm/t-aprofile: Add matching rules for -march=3Darmv8.6-a. ++ * config/arm/t-arm-elf (all_v8_archs): Add armv8.6-a. ++ * config/arm/t-multilib: Add matching rules for -march=3Darmv8.6-a. ++ (v8_6_a_simd_variants): New. ++ (v8_*_a_simd_variants): Add i8mm and bf16. ++ * doc/invoke.texi (armv8.6-a, i8mm, bf16): Document new options. ++ ++2020-01-02 Jakub Jelinek ++ ++ PR ipa/93087 ++ * predict.c (compute_function_frequency): Don't call ++ warn_function_cold on functions that already have cold attribute. ++ ++2020-01-01 John David Anglin ++ ++ PR target/67834 ++ * config/pa/pa.c (pa_elf_select_rtx_section): New. Put references to ++ COMDAT group function labels in .data.rel.ro.local section. ++ * config/pa/pa32-linux.h (TARGET_ASM_SELECT_RTX_SECTION): Define. ++ ++ PR target/93111 ++ * config/pa/pa.md (scc): Use ordered_comparison_operator instead of ++ comparison_operator in B and S integer comparisons. Likewise, use ++ ordered_comparison_operator instead of cmpib_comparison_operator in ++ cmpib patterns. ++ * config/pa/predicates.md (cmpib_comparison_operator): Remove. ++ ++2020-01-01 Jakub Jelinek +=20 + Update copyright years. +=20 +@@ -16533,8 +2527,22 @@ + * doc/gcov.texi: Ditto. + * doc/install.texi: Ditto. + * doc/invoke.texi: Ditto. ++ ++2020-01-01 Jan Hubicka ++ ++ * ipa.c (walk_polymorphic_call_targets): Fix updating of overall ++ summary. ++ ++2020-01-01 Jakub Jelinek ++ ++ PR tree-optimization/93098 ++ * match.pd (popcount): For shift amounts, use integer_onep ++ or wi::to_widest () =3D=3D cst instead of tree_to_uhwi () =3D=3D cst ++ tests. Make sure that precision is power of two larger than or equal ++ to 16. Ensure shift is never negative. Use HOST_WIDE_INT_UC macro ++ instead of ULL suffixed constants. Formatting fixes. + +-Copyright (C) 2017 Free Software Foundation, Inc. ++Copyright (C) 2020 Free Software Foundation, Inc. +=20 + Copying and distribution of this file, with or without modification, + are permitted in any medium without royalty provided the copyright +diff --git a/gcc/doc/install.texi b/gcc/doc/install.texi +index 77ba08d3f21..28cb6d88da8 100644 +--- a/gcc/doc/install.texi ++++ b/gcc/doc/install.texi +@@ -2083,6 +2083,10 @@ shorthand for + The following options only apply to building cross compilers. +=20 + @table @code ++@item --with-toolexeclibdir=3D@var{dir} ++Specify the installation directory for libraries built with a cross compi= ler. ++The default is @option{$@{gcc_tooldir@}/lib}. ++ + @item --with-sysroot + @itemx --with-sysroot=3D@var{dir} + Tells GCC to consider @var{dir} as the root of a tree that contains +diff --git a/libada/ChangeLog b/libada/ChangeLog +index 8e56d7c60ef..8eda1ebe4c1 100644 +--- a/libada/ChangeLog ++++ b/libada/ChangeLog +@@ -1,26 +1,55 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. ++ * Makefile.in (configure_deps): Add `toolexeclibdir.m4'. ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * configure: Regenerate. +=20 +-2018-12-06 Release Manager ++2020-01-01 Jakub Jelinek +=20 +- * GCC 7.4.0 released. ++ Update copyright years. +=20 +-2018-06-22 Jakub Jelinek ++2019-10-01 Maciej W. Rozycki +=20 +- Backported from mainline +- 2018-04-18 David Malcolm ++ * Makefile.in (toolexecdir, toolexeclibdir): New variables. ++ (LIBADA_FLAGS_TO_PASS): Add `toolexeclibdir'. ++ * configure.ac: Add `--enable-version-specific-runtime-libs'. ++ Update version-specific `toolexecdir' and `toolexeclibdir' from=20 ++ ADA_RTL_OBJ_DIR from gcc/ada/gcc-interface/Makefile.in. ++ * configure: Regenerate. +=20 +- PR jit/85384 ++2019-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++2018-12-11 Eric Botcazou ++ ++ PR ada/88429 ++ * configure.ac (default_gnatlib_target): Set to gnatlib instead of ++ gnatlib-plain if --disable-shared. ++ * configure: Regenerate. ++ * Makefile.in (all): Replace gnatlib prerequisite with libada. ++ (ADA_RTS_SUBDIR): Delete. ++ (libada): New target, renamed from... ++ (gnatlib): ...this. Merge with other library targets. ++ (gnatlib-plain): Delete. ++ (install-gnatlib): Rename to... ++ (install-libada): ...this. ++ (install): Replace install-gnatlib prerequisite with install-libada. ++ ++2018-10-31 Joseph Myers ++ ++ PR bootstrap/82856 ++ * configure.ac: Remove AC_PREREQ. + * configure: Regenerate. +=20 +-2018-01-25 Release Manager ++2018-04-18 David Malcolm +=20 +- * GCC 7.3.0 released. ++ PR jit/85384 ++ * configure: Regenerate. +=20 +-2017-08-14 Release Manager ++2018-01-03 Jakub Jelinek +=20 +- * GCC 7.2.0 released. ++ Update copyright years. +=20 + 2017-06-01 Eric Botcazou +=20 +@@ -29,9 +58,12 @@ + (have_getipinfo): Tweak. + * configure: Regenerate. +=20 +-2017-05-02 Release Manager ++2017-05-22 Eric Botcazou +=20 +- * GCC 7.1.0 released. ++ * configure.ac: Add check for sys/capability.h header. ++ (have_capability): New substitution. ++ * configure: Regenerate. ++ * Makefile.in (GNATLIBCFLAGS_FOR_C): Add @have_capability@. +=20 + 2017-01-17 Jakub Jelinek +=20 +@@ -199,11 +231,11 @@ +=20 + 2009-04-06 Laurent GUERBY +=20 +- * Makefile.in (ADA_RTS_DIR): Define. +- * Makefile.in (gnatlib-*): Link adainclude and adalib to it. ++ * Makefile.in (ADA_RTS_DIR): Define. ++ * Makefile.in (gnatlib-*): Link adainclude and adalib to it. +=20 + 2008-09-21 Laurent Guerby +- Paolo Bonzini ++ Paolo Bonzini +=20 + PR ada/5911 + * Makefile.in (all, install, mostlyclean, clean, distclean): Add +@@ -417,7 +449,7 @@ +=20 + * New directory, new ChangeLog. + +-Copyright (C) 2003-2017 Free Software Foundation, Inc. ++Copyright (C) 2003-2020 Free Software Foundation, Inc. +=20 + This ChangeLog is free software; the Free Software Foundation gives + unlimited permission to copy, distribute, and modify it. +diff --git a/libada/Makefile.in b/libada/Makefile.in +index 328c067c4cd..004aaf8f993 100644 +--- a/libada/Makefile.in ++++ b/libada/Makefile.in +@@ -192,6 +192,7 @@ configure_deps =3D \ + $(srcdir)/../config/multi.m4 \ + $(srcdir)/../config/override.m4 \ + $(srcdir)/../config/picflag.m4 \ ++ $(srcdir)/../config/toolexeclibdir.m4 \ + $(srcdir)/../config/unwind_ipinfo.m4 +=20 + $(srcdir)/configure: @MAINT@ $(configure_deps) +diff --git a/libada/configure b/libada/configure +index 13e267a7f4e..3135092a73b 100755 +--- a/libada/configure ++++ b/libada/configure +@@ -631,6 +631,7 @@ ac_user_opts=3D' + enable_option_checking + with_build_libsubdir + enable_maintainer_mode ++with_toolexeclibdir + enable_multilib + enable_shared + with_system_libunwind +@@ -1262,6 +1263,9 @@ Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) + --with-build-libsubdir=3DDIR Directory where to find libraries for bui= ld system ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-system-libunwind use installed libunwind + --with-gcc-major-version-only + use only GCC major number in filesystem paths +@@ -1952,6 +1956,22 @@ else + fi +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Default to --enable-multilib + # Check whether --enable-multilib was given. + if test "${enable_multilib+set}" =3D set; then : +@@ -2004,7 +2024,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libada/configure.ac b/libada/configure.ac +index 0020df9d463..a2a4a1f5049 100644 +--- a/libada/configure.ac ++++ b/libada/configure.ac +@@ -19,6 +19,7 @@ sinclude(../config/acx.m4) + sinclude(../config/multi.m4) + sinclude(../config/override.m4) + sinclude(../config/picflag.m4) ++sinclude(../config/toolexeclibdir.m4) + sinclude(../config/unwind_ipinfo.m4) +=20 + AC_INIT +@@ -53,6 +54,8 @@ AC_ARG_ENABLE([maintainer-mode], + [MAINT=3D'#']) + AC_SUBST([MAINT])dnl +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + AM_ENABLE_MULTILIB(, ..) + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir +@@ -69,7 +72,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libatomic/ChangeLog b/libatomic/ChangeLog +index 0f950731c5c..4aeaadb189c 100644 +--- a/libatomic/ChangeLog ++++ b/libatomic/ChangeLog +@@ -1,45 +1,171 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * Makefile.in: Regenerate. ++ * aclocal.m4: Regenerate. ++ * configure: Regenerate. ++ * testsuite/Makefile.in: Regenerate. ++ ++2020-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++2019-09-27 Maciej W. Rozycki ++ ++ * configure: Regenerate. ++ ++2019-09-10 Christophe Lyon ++ ++ * configure.tgt: Handle arm*-*-uclinux*. ++ * configure: Regenerate. ++ ++2019-09-03 Chung-Lin Tang ++ ++ PR other/79543 ++ * acinclude.m4 (LIBAT_CHECK_LINKER_FEATURES): Fix GNU ld --version ++ scanning to conform to the GNU Coding Standards. ++ * configure: Regenerate. ++ ++2019-06-14 Matt Thomas ++ Matthew Green ++ Nick Hudson ++ Maya Rashish ++ ++ * configure.tgt (arm*): Handle NetBSD in the same way as FreeBSD. ++ ++2019-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++2018-10-31 Joseph Myers ++ ++ PR bootstrap/82856 ++ * Makefile.am: Include multilib.am. ++ * acinclude.m4: Use AC_LANG_SOURCE. ++ * configure.ac: Remove AC_PREREQ. ++ * testsuite/Makefile.am (RUNTEST): Remove quotes. ++ * Makefile.in, aclocal.m4, configure, testsuite/Makefile.in: ++ Regenerate. ++ ++2018-06-21 Christophe Lyon ++ ++ * config/arm/arm-config.h (__ARM_ARCH__): Remove definitions, use ++ __ARM_ARCH instead. Use __ARM_FEATURE_LDREX to define HAVE_STREX ++ and HAVE_STREXBHD ++ ++2018-05-23 Florian Weimer ++ ++ PR libgcc/60790 ++ x86: Do not assume ELF constructors run before IFUNC resolvers. ++ * config/x86/host-config.h (libat_feat1_ecx, libat_feat1_edx): ++ Remove declarations. ++ (__libat_feat1, __libat_feat1_init): Declare. ++ (FEAT1_REGISTER): Define. ++ (load_feat1): New function. ++ (IFUNC_COND_1): Adjust. ++ * config/x86/init.c (libat_feat1_ecx, libat_feat1_edx) ++ (init_cpuid): Remove definitions. ++ (__libat_feat1): New variable. ++ (__libat_feat1_init): New function. ++ ++2018-05-02 Tom de Vries ++ ++ PR testsuite/85106 ++ * testsuite/lib/libatomic.exp: Include scanltranstree.exp. ++ ++2018-05-02 Tom de Vries +=20 +-2018-12-06 Release Manager ++ PR testsuite/85106 ++ * testsuite/lib/libatomic.exp: Include scanwpaipa.exp. +=20 +- * GCC 7.4.0 released. ++2018-04-24 H.J. Lu +=20 +-2018-06-22 Jakub Jelinek ++ * configure: Regenerated. ++ ++2018-04-19 Jakub Jelinek ++ ++ * configure: Regenerated. +=20 +- Backported from mainline +- 2018-04-18 David Malcolm ++2018-04-18 David Malcolm +=20 + PR jit/85384 + * configure: Regenerate. +=20 + 2018-03-09 Andreas Krebbel +=20 +- Backport from mainline +- 2018-03-09 Andreas Krebbel +- + * config/s390/exch_n.c: New file. + * configure.tgt: Add the config directory for s390. +=20 +-2018-01-25 Release Manager ++2018-02-14 Igor Tsimbalist ++ ++ PR target/84148 ++ * configure: Regenerate. ++ ++2018-01-03 Jakub Jelinek ++ ++ Update copyright years. ++ ++2017-12-14 Steve Ellcey ++ ++ * Makefile.am (IFUNC_OPTIONS): Change aarch64 ++ option from -march=3Darmv8.1-a to -march=3Darmv8-a+lse. ++ * configure.ac (*aarch64*): Check to see if ++ compiler understands -march=3Darmv8-a+lse option. ++ * configure.tgt (*aarch64*): Only set try_ifunc ++ if compiler understands -march=3Darmv8-a+lse option. ++ * Makefile.in: Regenerate. ++ * testsuite/Makefile.in: Regenerate. ++ * configure: Regenerate. ++ * aclocal.m4: Regenerate. ++ ++2017-12-04 Steve Ellcey ++ ++ * Makefile.am (ARCH_AARCH64_LINUX): Add IFUNC_OPTIONS and ++ libatomic_la_LIBADD. ++ * config/linux/aarch64/host-config.h: New file. ++ * configure.ac (IFUNC_RESOLVER_ARGS): Define. ++ (ARCH_AARCH64_LINUX): New conditional for IFUNC builds. ++ * configure.tgt (aarch64): Set ARCH and try_ifunc. ++ (aarch64*-*-linux*) Update config_path. ++ (aarch64*-*-linux*) Set IFUNC_RESOLVER_ARGS. ++ * libatomic_i.h (GEN_SELECTOR): Add IFUNC_RESOLVER_ARGS argument. ++ * Makefile.in: Regenerate. ++ * auto-config.h.in: Regenerate. ++ * configure: Regenerate. ++ ++2017-11-17 Igor Tsimbalist +=20 +- * GCC 7.3.0 released. ++ * configure.ac: Set CET_FLAGS, update XCFLAGS. ++ * acinclude.m4: Add cet.m4 and enable.m4. ++ * configure: Regenerate. ++ * Makefile.in: Likewise. ++ * testsuite/Makefile.in: Likewise. +=20 +-2017-08-14 Release Manager ++2017-10-20 Richard Earnshaw +=20 +- * GCC 7.2.0 released. ++ * Makefile.am: (IFUNC_OPTIONS): Set the architecture to ++ -march=3Darmv7-a+fp on Linux/Arm. ++ * Makefile.in: Regenerated. ++ ++2017-10-02 Martin Sebor ++ ++ PR c/81854 ++ * acinclude.m4 (LIBAT_CHECK_IFUNC): Have ifunc resolver return ++ a function pointer rather than void* to avoid GCC 8 warnings. ++ * configure: Regenerate. ++ * libatomic_i.h: Declare ifunc resolvers to return function ++ pointers rather than void*. +=20 +-2017-05-02 Release Manager ++2017-05-12 Rainer Orth +=20 +- * GCC 7.1.0 released. ++ * testsuite/lib/libatomic.exp: Load scanlang.exp. +=20 + 2017-02-06 Palmer Dabbelt +=20 + * configure.tgt: Add RISC-V tuple. +=20 + 2017-02-01 Richard Henderson +- Torvald Riegel ++ Torvald Riegel +=20 + * acinclude.m4: Add #define FAST_ATOMIC_LDST_*. + * auto-config.h.in: Regenerate. +@@ -341,7 +467,7 @@ +=20 + * Initial commit. + +-Copyright (C) 2012-2017 Free Software Foundation, Inc. ++Copyright (C) 2012-2020 Free Software Foundation, Inc. +=20 + Copying and distribution of this file, with or without modification, + are permitted in any medium without royalty provided the copyright +diff --git a/libatomic/Makefile.in b/libatomic/Makefile.in +index f6eeab312ea..86d7ba20c19 100644 +--- a/libatomic/Makefile.in ++++ b/libatomic/Makefile.in +@@ -72,6 +72,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libatomic/aclocal.m4 b/libatomic/aclocal.m4 +index 1363e7b9cbc..f1a3f1dda26 100644 +--- a/libatomic/aclocal.m4 ++++ b/libatomic/aclocal.m4 +@@ -1017,6 +1017,7 @@ m4_include([../config/lthostflags.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libatomic/configure b/libatomic/configure +index 2ae9b8d40f3..0fa531ec4a3 100755 +--- a/libatomic/configure ++++ b/libatomic/configure +@@ -755,6 +755,7 @@ enable_option_checking + enable_version_specific_runtime_libs + enable_generated_files_in_srcdir + enable_multilib ++with_toolexeclibdir + enable_dependency_tracking + enable_shared + enable_static +@@ -1414,6 +1415,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -3185,6 +3189,22 @@ fi + ac_config_commands=3D"$ac_config_commands default-1" +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -3200,7 +3220,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -11115,7 +11142,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11118 "configure" ++#line 11145 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11221,7 +11248,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11224 "configure" ++#line 11251 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libatomic/configure.ac b/libatomic/configure.ac +index 023f1727b1e..3c58801ae98 100644 +--- a/libatomic/configure.ac ++++ b/libatomic/configure.ac +@@ -85,6 +85,8 @@ target_alias=3D${target_alias-$host_alias} + AM_INIT_AUTOMAKE([1.9.0 foreign no-dist -Wall -Wno-portability -Wno-overr= ide]) + AM_ENABLE_MULTILIB(, ..) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -100,7 +102,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libatomic/testsuite/Makefile.in b/libatomic/testsuite/Makefil= e.in +index adfc231484a..a2a76e07502 100644 +--- a/libatomic/testsuite/Makefile.in ++++ b/libatomic/testsuite/Makefile.in +@@ -61,6 +61,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libffi/ChangeLog b/libffi/ChangeLog +index cc1444f53a2..47648d31abd 100644 +--- a/libffi/ChangeLog ++++ b/libffi/ChangeLog +@@ -1,30 +1,89 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. +- +-2018-12-06 Release Manager ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * Makefile.in: Regenerate. ++ * aclocal.m4: Regenerate. ++ * configure: Regenerate. ++ * include/Makefile.in: Regenerate. ++ * man/Makefile.in: Regenerate. ++ * testsuite/Makefile.in: Regenerate. +=20 +- * GCC 7.4.0 released. ++2019-09-27 Maciej W. Rozycki +=20 +-2018-06-22 Jakub Jelinek ++ * configure: Regenerate. +=20 +- Backported from mainline +- 2018-04-18 David Malcolm ++2019-09-03 Chung-Lin Tang +=20 +- PR jit/85384 ++ PR other/79543 ++ * acinclude.m4 (LIBAT_CHECK_LINKER_FEATURES): Fix GNU ld --version ++ scanning to conform to the GNU Coding Standards. + * configure: Regenerate. +=20 +-2018-01-25 Release Manager ++2018-10-31 Joseph Myers +=20 +- * GCC 7.3.0 released. ++ PR bootstrap/82856 ++ * Makefile.am: Include multilib.am. ++ (AUTOMAKE_OPTIONS): Add info-in-builddir. ++ (CLEANFILES): Remove doc/libffi.info. ++ * configure.ac: Remove AC_PREREQ. ++ * Makefile.in, aclocal.m4, configure, fficonfig.h.in, ++ include/Makefile.in, man/Makefile.in, testsuite/Makefile.in: ++ Regenerate. +=20 +-2017-08-14 Release Manager ++2018-08-15 Andreas Schwab +=20 +- * GCC 7.2.0 released. ++ Backport of RISC-V support for libffi go closures ++ * src/riscv/ffi.c (ffi_call_go, ffi_prep_go_closure): New ++ functions. ++ (ffi_call_int): Renamed from ffi_call. ++ (ffi_call_asm, ffi_closure_inner): Adjust interface. ++ * src/riscv/ffitarget.h (FFI_GO_CLOSURES): Define. ++ * src/riscv/sysv.S (ffi_go_closure_asm): New function. ++ (ffi_closure_asm, ffi_call_asm): Update for adjusted interfaces. +=20 +-2017-05-02 Release Manager ++2018-05-08 Andreas Schwab ++ ++ Backport of RISC-V support for libffi ++ * configure.host: Add RISC-V support. ++ * Makefile.am: Likewise. ++ * Makefile.in: Regenerate. ++ * src/riscv/ffi.c, src/riscv/ffitarget.h, src/riscv/sysv.S: New ++ files. ++ ++2018-05-04 Alan Modra ++ ++ Import from upstream ++ * src/powerpc/ffi_linux64.c (discover_homogeneous_aggregate): ++ Compile for ELFv1 too, handling single element aggregates. ++ (ffi_prep_cif_linux64_core): Call discover_homogeneous_aggregate ++ for ELFv1. Set FLAG_RETURNS_64BITS for FFI_TYPE_POINTER return. ++ (ffi_prep_args64): Call discover_homogeneous_aggregate for ELFv1, ++ and handle single element structs containing float or double ++ as if the element wasn't wrapped in a struct. Store floats in ++ second word of doubleword slot when big-endian. ++ (ffi_closure_helper_LINUX64): Similarly. ++ ++2018-04-18 David Malcolm ++ ++ PR jit/85384 ++ * configure: Regenerate. +=20 +- * GCC 7.1.0 released. ++2017-08-31 Tony Reix ++ ++ * src/powerpc/aix.S (ffi_call_AIX): Add debugging pseudo-op and ++ labels for EH. ++ (ffi_call_go_AIX): New function. ++ (_GLOBAL__F_libffi_src_powerpc_aix): New EH frame. ++ * src/powerpc/aix_closure.S (ffi_closure_ASM): Add debugging ++ pseudo-op and labels for EH. ++ (ffi_go_closure_ASM): New function. ++ (_GLOBAL__F_libffi_src_powerpc_aix_closure): New EH frame. ++ * src/powrpc/ffi_darwin.c (ffi_call_go): New function. ++ (ffi_prep_go_closure): New function. ++ (ffi_closure_helper_common): Rename from ffi_closure_helper_DARWIN. ++ (ffi_closure_helper_DARWIN): Call ffi_closure_helper_common. ++ (ffi_go_closure_helper_DARWIN): Call ffi_closure_helper_common. ++ * src/powerpc/ffitarget.h (FFI_GO_CLOSURES): Define. +=20 + 2017-01-21 Jakub Jelinek +=20 +@@ -435,7 +494,7 @@ + * configure: Rebuild. +=20 + 2012-10-30 James Greenhalgh +- Marcus Shawcroft ++ Marcus Shawcroft +=20 + * README: Add details of aarch64 port. + * src/aarch64/ffi.c: New. +@@ -446,7 +505,7 @@ + * Makefile.in, configure: Rebuilt. +=20 + 2012-10-30 James Greenhalgh +- Marcus Shawcroft ++ Marcus Shawcroft +=20 + * testsuite/lib/libffi.exp: Add support for aarch64. + * testsuite/libffi.call/cls_struct_va1.c: New. +diff --git a/libffi/Makefile.in b/libffi/Makefile.in +index 8a99ee58b68..032dadf4c4a 100644 +--- a/libffi/Makefile.in ++++ b/libffi/Makefile.in +@@ -72,6 +72,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/acinclude.m4 \ +diff --git a/libffi/aclocal.m4 b/libffi/aclocal.m4 +index 6d6207eb897..9cd050aaaf5 100644 +--- a/libffi/aclocal.m4 ++++ b/libffi/aclocal.m4 +@@ -1051,6 +1051,7 @@ m4_include([../config/depstand.m4]) + m4_include([../config/lead-dot.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/libffi/configure b/libffi/configure +index 790a291011f..6e37039e84c 100755 +--- a/libffi/configure ++++ b/libffi/configure +@@ -777,6 +777,7 @@ enable_debug + enable_structs + enable_raw_api + enable_purify_safety ++with_toolexeclibdir + enable_symvers + with_gcc_major_version_only + ' +@@ -1436,6 +1437,9 @@ Optional Packages: + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-gcc-major-version-only + use only GCC major number in filesystem paths +=20 +@@ -11390,7 +11394,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11393 "configure" ++#line 11397 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11496,7 +11500,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11499 "configure" ++#line 11507 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -16002,10 +16006,33 @@ $as_echo "#define USING_PURIFY 1" >>confdefs.h + fi +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libffi/configure.ac b/libffi/configure.ac +index a01d8ac16b0..f295d06ab58 100644 +--- a/libffi/configure.ac ++++ b/libffi/configure.ac +@@ -333,10 +333,19 @@ AC_ARG_ENABLE(purify-safety, + AC_DEFINE(USING_PURIFY, 1, [Define this if you are using Purify and w= ant to suppress spurious messages.]) + fi) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libffi/include/Makefile.in b/libffi/include/Makefile.in +index e0c75992327..3762e6c9b68 100644 +--- a/libffi/include/Makefile.in ++++ b/libffi/include/Makefile.in +@@ -62,6 +62,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/acinclude.m4 \ +diff --git a/libffi/man/Makefile.in b/libffi/man/Makefile.in +index 0243bdbedfa..12e61e485eb 100644 +--- a/libffi/man/Makefile.in ++++ b/libffi/man/Makefile.in +@@ -60,6 +60,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/acinclude.m4 \ +diff --git a/libffi/testsuite/Makefile.in b/libffi/testsuite/Makefile.in +index b7da4b0b3e7..469b251b17f 100644 +--- a/libffi/testsuite/Makefile.in ++++ b/libffi/testsuite/Makefile.in +@@ -60,6 +60,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/acinclude.m4 \ +diff --git a/libgcc/ChangeLog b/libgcc/ChangeLog +index 1a6f9ec681c..0920265f60a 100644 +--- a/libgcc/ChangeLog ++++ b/libgcc/ChangeLog +@@ -1,55 +1,1178 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. ++ * Makefile.in (configure_deps): Add `toolexeclibdir.m4'. ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * configure: Regenerate. ++ ++2020-01-23 Dragan Mladjenovic ++ ++ * config/mips/gnustack.h: Check for TARGET_LIBC_GNUSTACK also. ++ ++2020-01-23 Dragan Mladjenovic ++ ++ * config/mips/gnustack.h: New file. ++ * config/mips/crti.S: Include gnustack.h. ++ * config/mips/crtn.S: Likewise. ++ * config/mips/mips16.S: Likewise. ++ * config/mips/vr4120-div.S: Likewise. ++ ++2020-01-23 Martin Liska ++ ++ * libgcov-driver.c (prune_topn_counter): Remove ++ check for -1 as we only prune run-time counters ++ that do not generate an invalid state. ++ ++2020-01-22 Martin Liska ++ ++ PR tree-optimization/92924 ++ * libgcov-profiler.c (__gcov_topn_values_profiler_body): First ++ try to find an existing value, then find an empty slot ++ if not found. ++ ++2020-01-22 Martin Liska ++ ++ PR tree-optimization/92924 ++ * libgcov-driver.c (prune_topn_counter): New. ++ (prune_counters): Likewise. ++ (dump_one_gcov): Prune a run-time counter. ++ * libgcov-profiler.c (__gcov_topn_values_profiler_body): ++ For a known value, add GCOV_TOPN_VALUES to value. ++ Otherwise, decrement all counters by one. ++ ++2020-01-18 Hans-Peter Nilsson ++ ++ * config/cris/arit.c (DS): Apply attribute __fallthrough__. ++ ++2020-01-18 John David Anglin ++ ++ PR libgcc/92988 ++ * crtstuff.c (__do_global_dtors_aux): Only call __cxa_finalize if ++ DEFAULT_USE_CXA_ATEXIT is true. ++ ++2020-01-16 Mihail-Calin Ionescu ++ Thomas Preud'homme ++ ++ * config/arm/t-arm: Check return value of gcc rather than lack of ++ output. ++ ++2020-01-14 Georg-Johann Lay ++ ++ * config/avr/lib1funcs.S (skip): Simplify. ++ ++2020-01-10 Kwok Cheung Yeung ++ ++ * config/gcn/atomic.c: Remove include of stdint.h. ++ (__sync_val_compare_and_swap_##SIZE): Replace uintptr_t with ++ __UINTPTR_TYPE__. ++ ++2020-01-09 Kwok Cheung Yeung ++ ++ * config/gcn/atomic.c: New. ++ * config/gcn/t-amdgcn (LIB2ADD): Add atomic.c. ++ ++2020-01-08 Georg-Johann Lay ++ ++ Implement 64-bit double functions. ++ ++ PR target/92055 ++ * config.host (tmake_file) [target=3Davr]: Add t-libf7, ++ t-libf7-math, t-libf7-math-symbols as specified by --with-libf7=3D. ++ * config/avr/t-avrlibc: Don't copy libgcc.a if there are modules ++ depending on sizeof (double) or sizeof (long double). ++ * config/avr/libf7: New folder. ++ ++2020-01-05 Olivier Hainque ++ ++ * config/gthr-vxworks.h: Guard #include vxAtomicLib.h ++ by IN_LIBGCC2. ++ ++2020-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++2019-12-30 Olivier Hainque ++ ++ * config/gthr-vxworks.h: Use _vxworks-versions.h. ++ * config/gthr-vxworks-tls.c: Likewise. ++ ++2019-12-30 Olivier Hainque ++ ++ * config/gthr-vxworks.h (GTHREAD_ONCE_INIT): Use ++ standard zero-initializer syntax. ++ ++2019-12-30 Olivier Hainque ++ ++ * config/gthr-vxworks-tls.c (__gthread_getspecific): Fix ++ reference to the internal VX_GET_TLS_DATA interface. ++ ++2019-12-30 Olivier Hainque ++ ++ * config/vxcrtstuff.c: Fix incorrect spelling of ++ USE_INITFINI_ARRAY in guard. ++ ++2019-12-16 Jozef Lawrynowicz ++ ++ * config.host: s/msp430*-*-elf/msp430-*-elf*. ++ Override default "extra_parts" variable. ++ * configure: Regenerate. ++ * configure.ac: Disable TM clone registry by default for ++ msp430-elfbare. ++ ++2019-12-11 Jozef Lawrynowicz ++ ++ * config.host (msp430*-*-elf): Add crt{begin,end}_no_eh.o to ++ "extra_parts". ++ * config/msp430/t-msp430: Add rules to build crt{begin,end}_no_eh.o. ++ ++2019-12-11 Jozef Lawrynowicz ++ ++ * crtstuff.c: Declare __dso_handle only if DEFAULT_USE_CXA_ATEXIT is ++ true. ++ ++2019-12-09 Jozef Lawrynowicz ++ ++ * crtstuff.c (__do_global_dtors_aux): Check if USE_EH_FRAME_REGISTRY is ++ defined instead of its value. ++ ++2019-12-09 Jozef Lawrynowicz ++ ++ * crtstuff.c (__do_global_dtors_aux): Wrap in #if so it's only defined ++ if it will have contents. ++ ++2019-12-05 Georg-Johann Lay ++ ++ PR target/92055 ++ * config/avr/t-avrlibc (MULTISUBDIR): Search for double, not double64. ++ ++2019-11-18 Szabolcs Nagy ++ ++ PR libgcc/91737 ++ * config.host: Add t-gthr-noweak on *-*-musl*. ++ * config/t-gthr-noweak: New file. ++ ++2019-11-17 John David Anglin ++ ++ * config/pa/linux-atomic.c (__kernel_cmpxchg): Change argument 1 to ++ volatile void *. Remove trap check. ++ (__kernel_cmpxchg2): Likewise. ++ (FETCH_AND_OP_2): Adjust operand types. ++ (OP_AND_FETCH_2): Likewise. ++ (FETCH_AND_OP_WORD): Likewise. ++ (OP_AND_FETCH_WORD): Likewise. ++ (COMPARE_AND_SWAP_2): Likewise. ++ (__sync_val_compare_and_swap_4): Likewise. ++ (__sync_bool_compare_and_swap_4): Likewise. ++ (SYNC_LOCK_TEST_AND_SET_2): Likewise. ++ (__sync_lock_test_and_set_4): Likewise. ++ (SYNC_LOCK_RELEASE_1): Likewise. Use __kernel_cmpxchg2 for release. ++ (__sync_lock_release_4): Adjust operand types. Use __kernel_cmpxchg ++ for release. ++ (__sync_lock_release_8): Remove. ++ ++2019-11-15 Szabolcs Nagy ++ ++ * config/m68k/linux-unwind.h (struct uw_ucontext): Use sigset_t instead ++ of __sigset_t. ++ ++2019-11-14 Jerome Lambourg ++ Doug Rupp ++ Olivier Hainque ++ ++ * config.host: Collapse the arm-vxworks entries into ++ a single arm-wrs-vxworks7* one. ++ * config/arm/unwind-arm-vxworks.c: Update comments. Provide ++ __gnu_Unwind_Find_exidx and a weak dummy __cxa_type_match for ++ kernel modules, to be overriden by libstdc++ when we link with ++ it. Rely on externally provided __exidx_start/end. ++ ++2019-11-14 Doug Rupp ++ Olivier Hainque ++ ++ * config.host: Handle aarch64*-wrs-vxworks7*. ++ ++2019-11-12 Olivier Hainque ++ ++ * config/t-gthr-vxworksae: New file, add all the gthr-vxworks ++ sources except the cxx0x support to LIB2ADDEH. We don't support ++ cxx0x on AE/653. ++ * config/t-vxworksae: New file. ++ * config.host: Handle *-*-vxworksae: Add the two aforementioned ++ Makefile fragment files at their expected position in the tmake_file ++ list, in accordance with what is done for other VxWorks variants. ++ ++2019-11-12 Corentin Gay ++ Jerome Lambourg ++ Olivier Hainque ++ ++ * config/t-gthr-vxworks: New file, add all the gthr-vxworks ++ sources to LIB2ADDEH. ++ * config/t-vxworks: Remove adjustments to LIB2ADDEH. ++ * config/t-vxworks7: Likewise. ++ ++ * config.host: Append a block at the end of the file to add the ++ t-gthr files to the tmake_file list for VxWorks after everything ++ else. ++ ++ * config/vxlib.c: Rename as gthr-vxworks.c. ++ * config/vxlib-tls.c: Rename as gthr-vxworks-tls.c. ++ ++ * config/gthr-vxworks.h: Simplify a few comments. Expose a TAS ++ API and a basic error checking API, both internal. Simplify the ++ __gthread_once_t type definition and initializers. Add sections ++ for condition variables support and for the C++0x thread support, ++ conditioned against Vx653 for the latter. ++ ++ * config/gthr-vxworks.c (__gthread_once): Simplify comments and ++ implementation, leveraging the TAS internal API. ++ * config/gthr-vxworks-tls.c: Introduce an internal TLS data access ++ API, leveraging the general availability of TLS services in VxWorks7 ++ post SR6xxx. ++ (__gthread_setspecific, __gthread_setspecific): Use it. ++ (tls_delete_hook): Likewise, and simplify the enter/leave dtor logic. ++ * config/gthr-vxworks-cond.c: New file. GTHREAD_COND variable ++ support based on VxWorks primitives. ++ * config/gthr-vxworks-thread.c: New file. GTHREAD_CXX0X support ++ based on VxWorks primitives. ++ ++2019-11-06 Jerome Lambourg ++ Olivier Hainque ++ ++ * config/vxcrtstuff.c: New file. ++ * config/t-vxcrtstuff: New Makefile fragment. ++ * config.host: Append t-vxcrtstuff to the tmake_file list ++ on all VxWorks ports using dwarf for table based EH. ++ ++2019-11-07 Georg-Johann Lay ++ ++ Support 64-bit double and 64-bit long double configurations. ++ ++ PR target/92055 ++ * config/avr/t-avr (HOST_LIBGCC2_CFLAGS): Only add -DF=3DSF if ++ long double is a 32-bit type. ++ * config/avr/t-avrlibc: Copy double64 and long-double64 ++ multilib(s) from the vanilla one. ++ * config/avr/t-copy-libgcc: New Makefile snip. ++ ++2019-11-04 Jozef Lawrynowicz ++ ++ * crtstuff.c: Define USE_TM_CLONE_REGISTRY to 0 if it's undefined and ++ the target output object format is not ELF. ++ s/defined(USE_TM_CLONE_REGISTRY)/USE_TM_CLONE_REGISTRY. ++ ++2019-11-03 Oleg Endo ++ ++ PR libgcc/78804 ++ * fp-bit.h: Remove FLOAT_BIT_ORDER_MISMATCH. ++ * fp-bit.c (pack_d, unpack_d): Remove special cases for ++ FLOAT_BIT_ORDER_MISMATCH. ++ * config/arc/t-arc: Remove FLOAT_BIT_ORDER_MISMATCH. ++ ++2019-11-01 Jim Wilson ++ ++ * config/riscv/t-softfp32 (softfp_extra): Add FP divide routines ++ ++2019-10-23 Jozef Lawrynowicz ++ ++ * config/msp430/lib2hw_mul.S: Fix wrong syntax in branch instruction. ++ s/RESULT_LO/RESLO, s/RESULT_HI/RESHI, s/MPY_OP1/MPY,=20 ++ s/MPY_OP1_S/MPYS, s/MAC_OP1/MAC, s/MPY_OP2/OP2, s/MAC_OP2/OP2. ++ Define symbols for 32-bit and f5series hardware multiply ++ register addresses. ++ Replace hard-coded register addresses with symbols. ++ Fix "_mspabi*" typo. ++ Fix whitespace. ++ * config/msp430/lib2mul.c: Add comment. ++ ++2019-10-15 John David Anglin ++ ++ * config/pa/fptr.c (_dl_read_access_allowed): Change argument to ++ unsigned int. Adjust callers. ++ (__canonicalize_funcptr_for_compare): Change plabel type to volatile ++ unsigned int *. Load relocation offset before function pointer. ++ Add barrier to ensure ordering. ++ ++2019-10-12 John David Anglin ++ ++ * config/pa/lib2funcs.S (__gcc_plt_call): Load branch target to %r21. ++ Load PIC register after branch target. Fix white space. ++ * config/pa/milli64.S ($$dyncall): Separate LINUX and non LINUX ++ implementations. Load PIC register after branch target. Don't ++ clobber function pointer when it points to function descriptor. ++ Use nullification instead of branch in LINUX implementation. ++ ++2019-10-03 John David Anglin ++ ++ * config/pa/fptr.c: Disable -Warray-bounds warning. ++ ++2019-09-25 Richard Henderson ++ ++ * config.in, configure: Re-rebuild with stock autoconf 2.69, ++ not the ubuntu modified 2.69. ++ ++ PR target/91833 ++ * config/aarch64/lse-init.c: Include auto-target.h. Disable ++ initialization if !HAVE_SYS_AUXV_H. ++ * configure.ac (AC_CHECK_HEADERS): Add sys/auxv.h. ++ * config.in, configure: Rebuild. ++ ++ PR target/91834 ++ * config/aarch64/lse.S (LDNM): Ensure STXR output does not ++ overlap the inputs. ++ ++2019-09-25 Shaokun Zhang ++ ++ * config/aarch64/sync-cache.c (__aarch64_sync_cache_range): Add support = for ++ CTR_EL0.IDC and CTR_EL0.DIC. ++ ++2019-09-20 Christophe Lyon ++ ++ Revert: ++ 2019-09-10 Christophe Lyon ++ Micka=C3=ABl Gu=C3=AAn=C3=A9 ++ ++ * config/arm/unwind-arm.c (_Unwind_VRS_Set): Handle thumb-only ++ architecture. ++ ++2019-09-19 Richard Henderson ++ ++ * config/aarch64/lse-init.c: New file. ++ * config/aarch64/lse.S: New file. ++ * config/aarch64/t-lse: New file. ++ * config.host: Add t-lse to all aarch64 tuples. ++ ++2019-09-10 Christophe Lyon ++ Micka=C3=ABl Gu=C3=AAn=C3=A9 ++ ++ * config/arm/unwind-arm.c (_Unwind_VRS_Set): Handle thumb-only ++ architecture. ++ ++2019-09-10 Christophe Lyon ++ Micka=C3=ABl Gu=C3=AAn=C3=A9 ++ ++ * unwind-arm-common.inc (ARM_SET_R7_RT_SIGRETURN) ++ (THUMB2_SET_R7_RT_SIGRETURN, FDPIC_LDR_R12_WITH_FUNCDESC) ++ (FDPIC_LDR_R9_WITH_GOT, FDPIC_LDR_PC_WITH_RESTORER) ++ (FDPIC_FUNCDESC_OFFSET, ARM_NEW_RT_SIGFRAME_UCONTEXT) ++ (ARM_UCONTEXT_SIGCONTEXT, ARM_SIGCONTEXT_R0, FDPIC_T2_LDR_R12_WITH_FUNCD= ESC) ++ (FDPIC_T2_LDR_R9_WITH_GOT, FDPIC_T2_LDR_PC_WITH_RESTORER): New. ++ (__gnu_personality_sigframe_fdpic): New. ++ (get_eit_entry): Add FDPIC signal frame support. ++ ++2019-09-10 Christophe Lyon ++ Micka=C3=ABl Gu=C3=AAn=C3=A9 ++ ++ * config/arm/linux-atomic.c (__kernel_cmpxchg): Add FDPIC support. ++ (__kernel_dmb): Likewise. ++ (__fdpic_cmpxchg): New function. ++ (__fdpic_dmb): New function. ++ * config/arm/unwind-arm.h (FDPIC_REGNUM): New define. ++ (gnu_Unwind_Find_got): New function. ++ (_Unwind_decode_typeinfo_ptr): Add FDPIC support. ++ * unwind-arm-common.inc (UCB_PR_GOT): New. ++ (funcdesc_t): New struct. ++ (get_eit_entry): Add FDPIC support. ++ (unwind_phase2): Likewise. ++ (unwind_phase2_forced): Likewise. ++ (__gnu_Unwind_RaiseException): Likewise. ++ (__gnu_Unwind_Resume): Likewise. ++ (__gnu_Unwind_Backtrace): Likewise. ++ * unwind-pe.h (read_encoded_value_with_base): Likewise. ++ ++2019-09-10 Christophe Lyon ++ Micka=C3=ABl Gu=C3=AAn=C3=A9 ++ ++ * libgcc/crtstuff.c: Add support for FDPIC. ++ ++2019-09-10 Christophe Lyon ++ ++ * config.host: Handle *-*-uclinuxfdpiceabi. ++ ++2019-09-09 Jose E. Marchesi ++ ++ * config.host: Set cpu_type for bpf-*-* targets. ++ * config/bpf/t-bpf: Likewise. ++ * config/bpf/crtn.S: Likewise. ++ * config/bpf/crti.S: New file. ++ ++2019-09-06 Jim Wilson ++ ++ * config.host (riscv*-*-linux*): Add t-slibgcc-libgcc to tmake_file. ++ (riscv*-*-freebsd*): Likewise. ++ ++2019-09-03 Ulrich Weigand ++ ++ * config.host: Remove references to spu. ++ * config/spu/: Remove directory. ++ ++2019-08-23 Jozef Lawrynowicz ++ ++ PR target/91306 ++ * crtstuff.c (__CTOR_LIST__): Align to the "__alignof__" the array ++ element type, instead of "sizeof" the element type. ++ (__DTOR_LIST__): Likewise. ++ (__TMC_LIST__): Likewise. ++ (__do_global_dtors_aux_fini_array_entry): Likewise. ++ (__frame_dummy_init_array_entry): Likewise. ++ (__CTOR_END__): Likewise. ++ (__DTOR_END__): Likweise. ++ (__FRAME_END__): Likewise. ++ (__TMC_END__): Likewise. ++ ++2019-08-20 Lili Cui ++ ++ * config/i386/cpuinfo.h: Add INTEL_COREI7_TIGERLAKE and ++ INTEL_COREI7_COOPERLAKE. ++ ++2019-07-31 Matt Thomas ++ Nick Hudson ++ Matthew Green ++ Maya Rashish ++ ++ * config.host (hppa*-*-netbsd*): New case. ++ * config/pa/t-netbsd: New file. ++ ++2019-07-31 Joel Hutton ++ ++ * config/arm/cmse.c (cmse_check_address_range): Add ++ warn_unused_result attribute. ++ ++2019-07-22 Martin Liska ++ ++ * config/pa/stublib.c: Remove stub symbol __gnu_lto_v1. ++ * config/pa/t-stublib: Likewise. ++ ++2019-07-22 Stafford Horne ++ ++ PR target/90362 ++ * config/or1k/lib1funcs.S (__udivsi3): Change l.sfeqi ++ to l.sfeq and l.sfltsi to l.sflts equivalents as the immediate ++ instructions are not available on every processor. Change a ++ l.bnf to l.bf to fix logic issue. ++ ++2019-07-04 Iain Sandoe ++ ++ * config.host: Remove reference to t-darwin8. ++ ++2019-07-03 Iain Sandoe ++ ++ * config.host (powerpc-*-darwin*,powerpc64-*-darwin*): Revise crt ++ list. ++ * config/rs6000/t-darwin: Build crt3_2 for older systems. Revise ++ mmacosx-version-min for crts to run across all system versions. ++ * config/rs6000/t-darwin64 (LIB2ADD): Remove. ++ * config/t-darwin: Revise mmacosx-version-min for crts to run across ++ system versions >=3D 10.4. ++ ++2019-07-03 Martin Liska ++ ++ * Makefile.in: Use topn_values instead of one_value names. ++ * libgcov-merge.c (__gcov_merge_single): Move to ... ++ (__gcov_merge_topn): ... this. ++ (merge_single_value_set): Move to ... ++ (merge_topn_values_set): ... this. ++ * libgcov-profiler.c (__gcov_one_value_profiler_body): Move to ++ ... ++ (__gcov_topn_values_profiler_body): ... this. ++ (__gcov_one_value_profiler_v2): Move to ... ++ (__gcov_topn_values_profiler): ... this. ++ (__gcov_one_value_profiler_v2_atomic): Move to ... ++ (__gcov_topn_values_profiler_atomic): ... this. ++ (__gcov_indirect_call_profiler_v4): Remove. ++ * libgcov-util.c (__gcov_single_counter_op): Move to ... ++ (__gcov_topn_counter_op): ... this. ++ * libgcov.h (L_gcov_merge_single): Remove. ++ (L_gcov_merge_topn): New. ++ (__gcov_merge_single): Remove. ++ (__gcov_merge_topn): New. ++ (__gcov_one_value_profiler_v2): Move to .. ++ (__gcov_topn_values_profiler): ... this. ++ (__gcov_one_value_profiler_v2_atomic): Move to ... ++ (__gcov_topn_values_profiler_atomic): ... this. ++ ++2019-07-03 Martin Liska ++ ++ * libgcov-merge.c (merge_single_value_set): Support N values. ++ * libgcov-profiler.c (__gcov_one_value_profiler_body): Likewise. ++ ++2019-06-27 Ilia Diachkov ++ ++ * Makefile.in (USE_TM_CLONE_REGISTRY): New. ++ (CRTSTUFF_CFLAGS): Use USE_TM_CLONE_REGISTRY. ++ * configure.ac: Add --disable-tm-clone-registry option. ++ * configure: Regenerate. ++ ++2019-06-27 Martin Liska ++ ++ * libgcov-driver-system.c (gcov_exit_open_gcda_file): Remove obviously ++ dead assignments. ++ * libgcov-util.c: Likewise. ++ ++2019-06-27 Martin Liska ++ ++ * libgcov-util.c (gcov_profile_merge): Release allocated ++ memory. ++ (calculate_overlap): Likewise. ++ ++2019-06-25 Iain Sandoe ++ ++ * config.host: Add libef_ppc.a to the extra files for powerpc-darwin. ++ * config/rs6000/t-darwin: (PPC_ENDFILE_SRC, PPC_ENDFILE_OBJS): New. ++ Build objects for the out of line save/restore register functions ++ so that they can be used for any supported Darwin version. ++ * config/t-darwin: Default the build Darwin version to Darwin8 ++ (MacOS 10.4). ++ ++2019-06-25 Martin Liska ++ ++ * libgcov-driver-system.c (replace_filename_variables): Do not ++ call strlen with NULL argument. ++ ++2019-06-25 Andrew Stubbs ++ ++ * config/gcn/t-amdgcn (LIB2ADD): Add unwind-gcn.c. ++ * config/gcn/unwind-gcn.c: New file. ++ ++2019-06-25 Kwok Cheung Yeung ++ Andrew Stubbs ++ ++ * configure: Regenerate. ++ * config/gcn/gthr-gcn.h: New. ++ ++2019-06-18 Tom de Vries ++ ++ * config/nvptx/crt0.c (__main): Declare. ++ ++2019-06-17 Matthew Green ++ Maya Rashish ++ ++ * config.host (aarch64*-*-netbsd*): New case. ++ ++2019-06-16 Jozef Lawrynowicz ++ ++ * config/msp430/slli.S (__mspabi_sllll): New library function for ++ performing a logical left shift of a 64-bit value. ++ * config/msp430/srai.S (__mspabi_srall): New library function for ++ performing a arithmetic right shift of a 64-bit value. ++ * config/msp430/srll.S (__mspabi_srlll): New library function for ++ performing a logical right shift of a 64-bit value. ++ ++2019-06-14 Matt Thomas ++ Matthew Green ++ Nick Hudson ++ Maya Rashish ++ ++ * config.host (arm*-*-netbsdelf*): Add support for EABI configurations. ++ * config/arm/t-netbsd (LIB1ASMFUNCS): Add some additional assembler ++ functions to build. ++ * config/arm/t-netbsd-eabi: New file. ++ ++2019-06-12 Dimitar Dimitrov ++ ++ * config.host: Add PRU target. ++ * config/pru/asri.c: New file. ++ * config/pru/eqd.c: New file. ++ * config/pru/eqf.c: New file. ++ * config/pru/ged.c: New file. ++ * config/pru/gef.c: New file. ++ * config/pru/gtd.c: New file. ++ * config/pru/gtf.c: New file. ++ * config/pru/led.c: New file. ++ * config/pru/lef.c: New file. ++ * config/pru/lib2bitcountHI.c: New file. ++ * config/pru/lib2divHI.c: New file. ++ * config/pru/lib2divQI.c: New file. ++ * config/pru/lib2divSI.c: New file. ++ * config/pru/libgcc-eabi.ver: New file. ++ * config/pru/ltd.c: New file. ++ * config/pru/ltf.c: New file. ++ * config/pru/mpyll.S: New file. ++ * config/pru/pru-abi.h: New file. ++ * config/pru/pru-asm.h: New file. ++ * config/pru/pru-divmod.h: New file. ++ * config/pru/sfp-machine.h: New file. ++ * config/pru/t-pru: New file. ++ ++2019-06-11 Jakub Jelinek ++ ++ * libgcov-merge.c (__gcov_merge_single): Revert previous change. ++ ++2019-06-10 Martin Liska ++ ++ PR bootstrap/90808 ++ * libgcov.h: Add ATTRIBUTE_UNUSED. ++ ++2019-06-10 Martin Liska ++ ++ * Makefile.in: Add __gcov_one_value_profiler_v2, ++ __gcov_one_value_profiler_v2_atomic and ++ __gcov_indirect_call_profiler_v4. ++ * libgcov-merge.c (__gcov_merge_single): Change ++ function signature. ++ (merge_single_value_set): New. ++ * libgcov-profiler.c (__gcov_one_value_profiler_body): ++ Update functionality. ++ (__gcov_one_value_profiler): Remove. ++ (__gcov_one_value_profiler_v2): ... this. ++ (__gcov_one_value_profiler_atomic): Rename to ... ++ (__gcov_one_value_profiler_v2_atomic): this. ++ (__gcov_indirect_call_profiler_v3): Rename to ... ++ (__gcov_indirect_call_profiler_v4): ... this. ++ * libgcov.h (__gcov_one_value_profiler): Remove. ++ (__gcov_one_value_profiler_atomic): Remove. ++ (__gcov_one_value_profiler_v2_atomic): New. ++ (__gcov_indirect_call_profiler_v3): Remove. ++ (__gcov_one_value_profiler_v2): New. ++ (__gcov_indirect_call_profiler_v4): New. ++ (gcov_get_counter_ignore_scaling): New function. ++ ++2019-06-07 Martin Liska ++ ++ * Makefile.in: Remove usage of ++ _gcov_merge_icall_topn. ++ * libgcov-driver.c (gcov_sort_n_vals): Remove. ++ (gcov_sort_icall_topn_counter): Likewise. ++ (gcov_sort_topn_counter_arrays): Likewise. ++ (dump_one_gcov): Remove call to gcov_sort_topn_counter_arrays. ++ * libgcov-merge.c (__gcov_merge_icall_topn): Remove. ++ * libgcov-profiler.c (__gcov_topn_value_profiler_body): ++ Likewise. ++ (GCOV_ICALL_COUNTER_CLEAR_THRESHOLD): Remove. ++ (struct indirect_call_tuple): Remove. ++ (__gcov_indirect_call_topn_profiler): Remove. ++ * libgcov-util.c (__gcov_icall_topn_counter_op): Remove. ++ * libgcov.h (gcov_sort_n_vals): Remove. ++ (L_gcov_merge_icall_topn): Likewise. ++ (__gcov_merge_icall_topn): Likewise. ++ (__gcov_indirect_call_topn_profiler): Likewise. ++ ++2019-06-06 Iain Sandoe ++ ++ * config/rs6000/t-darwin: Ensure that the unwinder is built with ++ altivec enabled. ++ ++2019-06-06 Jozef Lawrynowicz ++ ++ * config/msp430/slli.S (__mspabi_slli_n): Put function in its own ++ section. ++ (__mspabi_slli): Likewise. ++ (__mspabi_slll_n): Likewise. ++ (__mspabi_slll): Likewise. ++ * config/msp430/srai.S (__mspabi_srai_n): Likewise. ++ (__mspabi_srai): Likewise. ++ (__mspabi_sral_n): Likewise. ++ (__mspabi_sral): Likewise. ++ * config/msp430/srli.S (__mspabi_srli_n): Likewise. ++ (__mspabi_srli): Likewise. ++ (__mspabi_srll_n): Likewise. ++ (__mspabi_srll): Likewise. ++ ++2019-06-05 Yoshinori Sato ++ ++ * config.host (rx-*-linux*): Add t-fdpbit to tmake_file ++ Add appropriate tm_file clause as well. ++ * config/rx/t-rx (HOST_LIBGCC2_CFLAGS): Remove. ++ ++2019-06-05 James Clarke ++ ++ * config/ia64/crtbegin.S (__dso_handle): Put in .sdata/.sbss ++ rather than .data/.bss so it can be accessed via gp-relative ++ addressing. ++ ++2019-06-05 David Edelsohn ++ ++ * config/rs6000/aix-unwind.h (LR_REGNO): Rename to R_LR. ++ (CR2_REGNO): Rename to R_CR2. ++ (XER_REGNO): Rename to R_XER. ++ (FIRST_ALTIVEC_REGNO): Rename to R_FIRST_ALTIVEC. ++ (VRSAVE_REGNO): Rename to R_VRSAVE. ++ (VSCR_REGNO): R_VSCR. ++ ++2019-05-29 Yoshinori Sato ++ ++ * config.host (rx-*-linux*): Add new case. ++ * config/rx/t-rx (HOST_LIBGCC2_CFLAGS): Force DFmode to SFmode. ++ ++2019-05-29 Sam Tebbs ++ ++ * config/aarch64/aarch64-unwind.h (aarch64_cie_signed_with_b_key): New ++ function. ++ * config/aarch64/aarch64-unwind.h (aarch64_post_extract_frame_addr, ++ aarch64_post_frob_eh_handler_addr): Add check for b-key. ++ * config/aarch64/aarch64-unwind-h (aarch64_post_extract_frame_addr, ++ aarch64_post_frob_eh_handler_addr, aarch64_post_frob_update_context): ++ Rename RA_A_SIGNED_BIT to RA_SIGNED_BIT. ++ * unwind-dw2-fde.c (get_cie_encoding): Add check for 'B' in augmentation ++ string. ++ * unwind-dw2.c (extract_cie_info): Add check for 'B' in augmentation ++ string. ++ (RA_A_SIGNED_BIT): Rename to RA_SIGNED_BIT. ++ ++2019-05-28 Rainer Orth ++ ++ * config/sparc/sol2-unwind.h [__arch64__] (sparc64_is_sighandler): ++ Remove Solaris 9 and 10 support. ++ (sparc_is_sighandler): Likewise. ++ ++2019-05-26 John David Anglin ++ ++ * config/pa/linux-unwind.h (pa32_fallback_frame_state): Add cast. ++ ++2019-05-17 H.J. Lu ++ ++ * soft-fp/extenddftf2.c: Use "_FP_W_TYPE_SIZE < 64" to check if ++ 4_FP_W_TYPEs are used for IEEE quad precision. ++ * soft-fp/extendhftf2.c: Likewise. ++ * soft-fp/extendsftf2.c: Likewise. ++ * soft-fp/extendxftf2.c: Likewise. ++ * soft-fp/trunctfdf2.c: Likewise. ++ * soft-fp/trunctfhf2.c: Likewise. ++ * soft-fp/trunctfsf2.c: Likewise. ++ * soft-fp/trunctfxf2.c: Likewise. ++ * config/rs6000/ibm-ldouble.c: Likewise. ++ ++2019-05-14 Rainer Orth ++ ++ * config.host: Simplify various *-*-solaris2.1[0-9]* to ++ *-*-solaris2*. ++ * configure.ac: Likewise. ++ * configure: Regenerate. ++ ++ * config/i386/sol2-unwind.h (x86_fallback_frame_state): Remove ++ Solaris 10 and Solaris 11 < snv_125 handling. ++ ++2019-05-12 Iain Sandoe ++ ++ * config/rs6000/darwin-vecsave.S: Set .machine appropriately. ++ ++2019-05-07 Hongtao Liu ++ ++ * config/i386/cpuinfo.c (get_available_features): Detect BF16. ++ * config/i386/cpuinfo.h (enum processor_features): Add ++ FEATURE_AVX512BF16. ++ ++2019-04-23 Ramana Radhakrishnan ++ Bernd Edlinger ++ Jakub Jelinek ++ ++ PR target/89093 ++ * config/arm/pr-support.c: Add #pragma GCC target("general-regs-only"). ++ * config/arm/unwind-arm.c: Likewise. ++ * unwind-c.c (PERSONALITY_FUNCTION): Add general-regs-only target ++ attribute for ARM. ++ ++2019-04-15 Monk Chiang ++ ++ * config/nds32/linux-unwind.h (SIGRETURN): Remove. ++ (RT_SIGRETURN): Update. ++ (nds32_fallback_frame_state): Update. ++ ++2019-02-21 Martin Sebor ++ ++ * libgcc2.h (__clear_cache): Correct signature. ++ * libgcc2.c (__clear_cache): Same. ++ ++2019-02-20 Uro=C5=A1 Bizjak ++ ++ * config/alpha/linux-unwind.h (alpha_fallback_frame_state): ++ Cast 'mcontext_t *' &rt_->uc.uc_mcontext to 'struct sigcontext *'. ++ ++2019-02-19 Uro=C5=A1 Bizjak ++ ++ * unwind-dw2.c (_Unwind_GetGR) [DWARF_ZERO_REG]: Compare ++ regno instead of index to DWARF_ZERO_REG. ++ ++2019-02-15 Eric Botcazou ++ ++ * config/visium/lib2funcs.c (__set_trampoline_parity): Replace ++ TRAMPOLINE_SIZE with __LIBGCC_TRAMPOLINE_SIZE__. ++ ++2019-01-31 Uro=C5=A1 Bizjak ++ ++ * config/alpha/t-linux: Add -mfp-rounding-mode=3Dd ++ to HOST_LIBGCC2_CFLAGS. ++ ++2019-01-23 Joseph Myers ++ ++ PR libgcc/88931 ++ * libgcc2.c (FSTYPE FUNC (DWtype u)): Correct no leading bits case. ++ ++2019-01-18 Martin Liska ++ ++ * libgcov-profiler.c (__gcov_indirect_call_profiler_v2): Rename ++ to ... ++ (__gcov_indirect_call_profiler_v3): ... this. ++ * libgcov.h (__gcov_indirect_call_profiler_v2): Likewise. ++ (__gcov_indirect_call_profiler_v3): Likewise. ++ * Makefile.in: Bump function name. ++ ++2019-01-18 Martin Liska ++ ++ * libgcov-driver.c (GCOV_PROF_PREFIX): Define. ++ (gcov_version): Use in gcov_error. ++ (merge_one_data): Likewise. ++ (dump_one_gcov): Likewise. ++ ++2019-01-18 Martin Liska ++ ++ * libgcov-driver.c (gcov_version_string): New function. ++ (gcov_version): Convert version integer into string. ++ ++2019-01-17 Andrew Stubbs ++ Kwok Cheung Yeung ++ Julian Brown ++ Tom de Vries ++ ++ * config.host: Recognize amdgcn*-*-amdhsa. ++ * config/gcn/crt0.c: New file. ++ * config/gcn/lib2-divmod-hi.c: New file. ++ * config/gcn/lib2-divmod.c: New file. ++ * config/gcn/lib2-gcn.h: New file. ++ * config/gcn/sfp-machine.h: New file. ++ * config/gcn/t-amdgcn: New file. ++ ++2019-01-09 Sandra Loosemore ++ ++ PR other/16615 ++ ++ * config/c6x/libunwind.S: Mechanically replace "can not" with ++ "cannot". ++ * config/tilepro/atomic.h: Likewise. ++ * config/vxlib-tls.c: Likewise. ++ * generic-morestack-thread.c: Likewise. ++ * generic-morestack.c: Likewise. ++ * mkmap-symver.awk: Likewise. ++ ++2019-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++2018-12-20 H.J. Lu ++ ++ * unwind-pe.h (read_encoded_value_with_base): Add GCC pragma ++ to ignore -Waddress-of-packed-member. ++ ++2018-12-19 Thomas Preud'homme ++ ++ * /config/arm/lib1funcs.S (FUNC_START): Remove unused sp_section ++ parameter and corresponding code. ++ (ARM_FUNC_START): Likewise in both definitions. ++ Also update footer comment about condition that need to match with ++ gcc/config/arm/elf.h to also include libgcc/config/arm/t-arm. ++ * config/arm/ieee754-df.S (muldf3): Also build it if L_arm_muldf3 is ++ defined. Weakly define it in this case. ++ * config/arm/ieee754-sf.S (mulsf3): Likewise with L_arm_mulsf3. ++ * config/arm/t-elf (LIB1ASMFUNCS): Build _arm_muldf3.o and ++ _arm_mulsf3.o before muldiv versions if targeting Thumb-1 only. Add ++ comment to keep condition in sync with the one in ++ libgcc/config/arm/lib1funcs.S and gcc/config/arm/elf.h. ++ ++2018-12-18 Wei Xiao ++ ++ * config/i386/cpuinfo.c (get_intel_cpu): Handle cascadelake. ++ * config/i386/cpuinfo.h: Add INTEL_COREI7_CASCADELAKE. ++ ++2018-12-12 Rasmus Villemoes ++ ++ * config/rs6000/tramp.S (__trampoline_setup): Also emit .size ++ and .cfi_endproc directives for VxWorks targets. ++ ++2018-12-05 Paul Koning ++ ++ * udivmodhi4.c (__udivmodhi4): Fix loop end check. ++ ++2018-11-27 Alan Modra ++ ++ * config/rs6000/morestack.S (__stack_split_initialize), ++ (__morestack_get_guard, __morestack_set_guard), ++ (__morestack_make_guard): Provide CFI covering these functions. ++ * config/rs6000/tramp.S (__trampoline_setup): Likewise. ++ ++2018-11-15 Xianmiao Qu ++ ++ * config/csky/linux-unwind.h (sc_pt_regs): Update for kernel. ++ (sc_pt_regs_lr): Update for kernel. ++ (sc_pt_regs_tls): Update for kernel. ++ ++2018-11-15 Xianmiao Qu ++ ++ * config/csky/linux-unwind.h: Fix coding style. ++ ++2018-11-13 Xianmiao Qu ++ ++ * config/csky/linux-unwind.h (_sig_ucontext_t): Remove. ++ (csky_fallback_frame_state): Modify the check of the ++ instructions to adapt to changes in the kernel ++ ++2018-11-09 Stafford Horne ++ Richard Henderson ++ ++ * config.host: Add OpenRISC support. ++ * config/or1k/*: New. ++ ++2018-11-08 Kito Cheng ++ ++ * soft-fp/adddf3.c: Update from glibc. ++ * soft-fp/addsf3.c: Likewise. ++ * soft-fp/addtf3.c: Likewise. ++ * soft-fp/divdf3.c: Likewise. ++ * soft-fp/divsf3.c: Likewise. ++ * soft-fp/divtf3.c: Likewise. ++ * soft-fp/double.h: Likewise. ++ * soft-fp/eqdf2.c: Likewise. ++ * soft-fp/eqsf2.c: Likewise. ++ * soft-fp/eqtf2.c: Likewise. ++ * soft-fp/extenddftf2.c: Likewise. ++ * soft-fp/extended.h: Likewise. ++ * soft-fp/extendhftf2.c: Likewise. ++ * soft-fp/extendsfdf2.c: Likewise. ++ * soft-fp/extendsftf2.c: Likewise. ++ * soft-fp/extendxftf2.c: Likewise. ++ * soft-fp/fixdfdi.c: Likewise. ++ * soft-fp/fixdfsi.c: Likewise. ++ * soft-fp/fixdfti.c: Likewise. ++ * soft-fp/fixhfti.c: Likewise. ++ * soft-fp/fixsfdi.c: Likewise. ++ * soft-fp/fixsfsi.c: Likewise. ++ * soft-fp/fixsfti.c: Likewise. ++ * soft-fp/fixtfdi.c: Likewise. ++ * soft-fp/fixtfsi.c: Likewise. ++ * soft-fp/fixtfti.c: Likewise. ++ * soft-fp/fixunsdfdi.c: Likewise. ++ * soft-fp/fixunsdfsi.c: Likewise. ++ * soft-fp/fixunsdfti.c: Likewise. ++ * soft-fp/fixunshfti.c: Likewise. ++ * soft-fp/fixunssfdi.c: Likewise. ++ * soft-fp/fixunssfsi.c: Likewise. ++ * soft-fp/fixunssfti.c: Likewise. ++ * soft-fp/fixunstfdi.c: Likewise. ++ * soft-fp/fixunstfsi.c: Likewise. ++ * soft-fp/fixunstfti.c: Likewise. ++ * soft-fp/floatdidf.c: Likewise. ++ * soft-fp/floatdisf.c: Likewise. ++ * soft-fp/floatditf.c: Likewise. ++ * soft-fp/floatsidf.c: Likewise. ++ * soft-fp/floatsisf.c: Likewise. ++ * soft-fp/floatsitf.c: Likewise. ++ * soft-fp/floattidf.c: Likewise. ++ * soft-fp/floattihf.c: Likewise. ++ * soft-fp/floattisf.c: Likewise. ++ * soft-fp/floattitf.c: Likewise. ++ * soft-fp/floatundidf.c: Likewise. ++ * soft-fp/floatundisf.c: Likewise. ++ * soft-fp/floatunditf.c: Likewise. ++ * soft-fp/floatunsidf.c: Likewise. ++ * soft-fp/floatunsisf.c: Likewise. ++ * soft-fp/floatunsitf.c: Likewise. ++ * soft-fp/floatuntidf.c: Likewise. ++ * soft-fp/floatuntihf.c: Likewise. ++ * soft-fp/floatuntisf.c: Likewise. ++ * soft-fp/floatuntitf.c: Likewise. ++ * soft-fp/gedf2.c: Likewise. ++ * soft-fp/gesf2.c: Likewise. ++ * soft-fp/getf2.c: Likewise. ++ * soft-fp/half.h: Likewise. ++ * soft-fp/ledf2.c: Likewise. ++ * soft-fp/lesf2.c: Likewise. ++ * soft-fp/letf2.c: Likewise. ++ * soft-fp/muldf3.c: Likewise. ++ * soft-fp/mulsf3.c: Likewise. ++ * soft-fp/multf3.c: Likewise. ++ * soft-fp/negdf2.c: Likewise. ++ * soft-fp/negsf2.c: Likewise. ++ * soft-fp/negtf2.c: Likewise. ++ * soft-fp/op-1.h: Likewise. ++ * soft-fp/op-2.h: Likewise. ++ * soft-fp/op-4.h: Likewise. ++ * soft-fp/op-8.h: Likewise. ++ * soft-fp/op-common.h: Likewise. ++ * soft-fp/quad.h: Likewise. ++ * soft-fp/single.h: Likewise. ++ * soft-fp/soft-fp.h: Likewise. ++ * soft-fp/subdf3.c: Likewise. ++ * soft-fp/subsf3.c: Likewise. ++ * soft-fp/subtf3.c: Likewise. ++ * soft-fp/truncdfsf2.c: Likewise. ++ * soft-fp/trunctfdf2.c: Likewise. ++ * soft-fp/trunctfhf2.c: Likewise. ++ * soft-fp/trunctfsf2.c: Likewise. ++ * soft-fp/trunctfxf2.c: Likewise. ++ * soft-fp/unorddf2.c: Likewise. ++ * soft-fp/unordsf2.c: Likewise. ++ * soft-fp/unordtf2.c: Likewise. +=20 +-2019-11-01 Iain Sandoe ++2018-11-04 Venkataramanan Kumar +=20 +- Backport from mainline. +- 2019-07-03 Iain Sandoe ++ * config/i386/cpuinfo.c: (get_amd_cpu): Add znver2. ++ * config/i386/cpuinfo.h (processor_types): Add znver2. +=20 +- * config.host (powerpc-*-darwin*,powerpc64-*-darwin*): Revise crt +- list. +- * config/rs6000/t-darwin: Build crt3_2 for older systems. Revise +- mmacosx-version-min for crts to run across all system versions. +- * config/rs6000/t-darwin64 (LIB2ADD): Remove. +- * config/t-darwin: Revise mmacosx-version-min for crts to run across +- system versions >=3D 10.4. ++2018-11-01 Paul Koning +=20 +-2019-11-01 Iain Sandoe ++ * config/pdp11/t-pdp11 (LIB2ADD): Add divmod.c. ++ (HOST_LIBGCC2_CFLAGS): Change to optimize for size. +=20 +- Backport from mainline. +- 2019-06-25 Iain Sandoe ++2018-10-31 Joseph Myers +=20 +- * config.host: Add libef_ppc.a to the extra files for powerpc-darwin. +- * config/rs6000/t-darwin: (PPC_ENDFILE_SRC, PPC_ENDFILE_OBJS): New. +- Build objects for the out of line save/restore register functions +- so that they can be used for any supported Darwin version. +- * config/t-darwin: Default the build Darwin version to Darwin8 +- (MacOS 10.4). ++ PR bootstrap/82856 ++ * configure.ac: Remove AC_PREREQ. Use AC_LANG_SOURCE. ++ * configure: Regenerate. +=20 +-2019-09-04 Iain Sandoe ++2018-10-31 Claudiu Zissulescu +=20 +- Backport from mainline. +- 2019-06-06 Iain Sandoe ++ * config/arc/lib1funcs.S (_muldi3): New function. ++ * config/arc/t-arc (LIB1ASMFUNCS): Add _muldi3. +=20 +- * config/rs6000/t-darwin: Ensure that the unwinder is built with +- altivec enabled. ++2018-10-30 Rasmus Villemoes +=20 +-2019-09-03 Iain Sandoe ++ * config/gthr-vxworks.h (__gthread_mutex_destroy): Call semDelete. +=20 +- Backport from mainline. +- 2019-05-12 Iain Sandoe ++2018-10-25 Martin Liska +=20 +- * config/rs6000/darwin-vecsave.S: Set .machine appropriately. ++ PR other/87735 ++ * libgcov-profiler.c: Revert. ++ ++2018-10-24 Martin Liska ++ ++ * libgcov-profiler.c: Start from 1 in order to distinguish ++ functions which were seen and these that were not. ++ ++2018-10-18 Paul Koning ++ ++ * udivmodsi4.c (__udivmodsi4): Rename to conform to coding ++ standard. ++ * divmod.c: Update references to __udivmodsi4. ++ * udivmod.c: Ditto. ++ * udivhi3.c: New file. ++ * udivmodhi4.c: New file. ++ * config/pdp11/t-pdp11 (LIB2ADD): Add the new files. ++ ++2018-10-17 Rasmus Villemoes ++ ++ * Makefile.in (LIB2FUNCS_ST): Filter out LIB2FUNCS_EXCLUDE. ++ ++2018-10-12 Olivier Hainque ++ ++ * config/rs6000/ibm-ldouble.c: Augment the toplevel guard with ++ defined (__FLOAT128_TYPE__) || defined (__LONG_DOUBLE_128__). ++ ++2018-10-08 Paul Koning ++ ++ * config/pdp11/t-pdp11: Remove -mfloat32 switch. ++ ++2018-10-04 Martin Liska ++ ++ PR gcov-profile/84107 ++ * libgcov-profiler.c (__gcov_indirect_call): ++ Change type to indirect_call_tuple. ++ (struct indirect_call_tuple): New struct. ++ (__gcov_indirect_call_topn_profiler): Change type. ++ (__gcov_indirect_call_profiler_v2): Use the new ++ variables. ++ * libgcov.h (struct indirect_call_tuple): New struct ++ definition. ++ ++2018-10-03 Uros Bizjak ++ ++ * libgcc2.c (isnan): Use __builtin_isnan. ++ (isfinite): Use __builtin_isfinite. ++ (isinf): Use __builtin_isinf. ++ ++2018-09-26 Uros Bizjak ++ ++ * config/i386/crtprec.c (set_precision): Use fnstcw instead of fstcw. ++ ++2018-09-21 Alexandre Oliva ++ ++ * config/vxcache.c: New file. Provide __clear_cache, based on ++ the cacheTextUpdate VxWorks service. ++ * config/t-vxworks (LIB2ADD): Add vxcache.c. ++ (LIB2FUNCS_EXCLUDE): Add _clear_cache. ++ * config/t-vxwoks7: Likewise. ++ ++2018-09-21 Martin Liska ++ ++ * libgcov-driver.c (crc32_unsigned): Remove. ++ (gcov_histogram_insert): Likewise. ++ (gcov_compute_histogram): Likewise. ++ (compute_summary): Simplify rapidly. ++ (merge_one_data): Do not handle PROGRAM_SUMMARY tag. ++ (merge_summary): Rapidly simplify. ++ (dump_one_gcov): Ignore gcov_summary. ++ (gcov_do_dump): Do not handle program summary, it's not ++ used. ++ * libgcov-util.c (tag_summary): Remove. ++ (read_gcda_finalize): Fix coding style. ++ (read_gcda_file): Initialize curr_object_summary. ++ (compute_summary): Remove. ++ (calculate_overlap): Remove settings of run_max. ++ ++2018-09-21 Monk Chiang ++ ++ * config/nds32/linux-unwind.h (struct _rt_sigframe): Use struct ++ ucontext_t type instead. ++ (nds32_fallback_frame_state): Remove struct _sigframe statement. ++ ++2018-09-21 Kito Cheng ++ ++ * config/nds32/t-nds32-glibc: New file. ++ ++2018-09-18 Rainer Orth ++ ++ * configure.ac (solaris_ld_v2_maps): New test. ++ * configure: Regenerate. ++ * Makefile.in (solaris_ld_v2_maps): New variable. ++ * config/t-slibgcc-sld (libgcc-unwind.map): Emit v2 mapfile syntax ++ if supported. ++ ++2018-08-23 Richard Earnshaw ++ ++ PR target/86951 ++ * config/arm/lib1funcs.asm (speculation_barrier): New function. ++ * config/arm/t-arm (LIB1ASMFUNCS): Add it to list of functions ++ to build. ++ ++2018-08-22 Iain Sandoe ++ ++ * config/unwind-dw2-fde-darwin.c ++ (_darwin10_Unwind_FindEnclosingFunction): move from here ... ++ * config/darwin10-unwind-find-enc-func.c: =E2=80=A6 to here. ++ * config/t-darwin: Build Darwin10 unwinder shim crt. ++ * libgcc/config.host: Add the Darwin10 unwinder shim. ++ ++2018-08-21 Rasmus Villemoes ++ ++ * config.host: Add crtbegin.o and crtend.o for ++ powerpc-wrs-vxworks target. ++ ++2018-08-17 Jojo ++ Huibin Wang ++ Sandra Loosemore ++ Chung-Lin Tang ++ ++ C-SKY port: libgcc +=20 +-2018-12-06 Release Manager ++ * config.host: Add C-SKY support. ++ * config/csky/*: New. +=20 +- * GCC 7.4.0 released. ++2018-08-12 Chung-Ju Wu +=20 +-2018-08-17 John David Anglin ++ * config/nds32/t-nds32-isr: Rearrange object dependency. ++ * config/nds32/initfini.c: Add dwarf2 unwinding support. ++ * config/nds32/isr-library/adj_intr_lvl.inc: Consider new extensions ++ and registers usage. ++ * config/nds32/isr-library/excp_isr.S: Ditto. ++ * config/nds32/isr-library/intr_isr.S: Ditto. ++ * config/nds32/isr-library/reset.S: Ditto. ++ * config/nds32/isr-library/restore_all.inc: Ditto. ++ * config/nds32/isr-library/restore_mac_regs.inc: Ditto. ++ * config/nds32/isr-library/restore_partial.inc: Ditto. ++ * config/nds32/isr-library/restore_usr_regs.inc: Ditto. ++ * config/nds32/isr-library/save_all.inc: Ditto. ++ * config/nds32/isr-library/save_mac_regs.inc: Ditto. ++ * config/nds32/isr-library/save_partial.inc: Ditto. ++ * config/nds32/isr-library/save_usr_regs.inc: Ditto. ++ * config/nds32/isr-library/vec_vid*.S: Consider 4-byte vector size. +=20 +- Backport from mainline +- 2018-08-11 John David Anglin ++2018-08-11 John David Anglin +=20 + * config/pa/linux-atomic.c: Update comment. + (FETCH_AND_OP_2, OP_AND_FETCH_2, FETCH_AND_OP_WORD, OP_AND_FETCH_WORD, +@@ -60,27 +1183,269 @@ + unordered store to release lock. + (__sync_lock_release_8): Likewise. + (SYNC_LOCK_RELEASE_2): Remove define. +-=09=20 +-2018-06-22 Jakub Jelinek +=20 +- Backported from mainline +- 2018-04-18 David Malcolm ++2018-08-02 Nicolas Pitre +=20 +- PR jit/85384 ++ PR libgcc/86512 ++ * config/arm/ieee754-df.S: Don't shortcut denormal handling when ++ exponent goes negative. Update my email address. ++ * config/arm/ieee754-sf.S: Likewise. ++ ++2018-08-01 Martin Liska ++ ++ * libgcov-profiler.c (__gcov_indirect_call_profiler_v2): Do not ++ check that __gcov_indirect_call_callee is non-null. ++ ++2018-07-30 Christophe Lyon ++ ++ * config/arm/ieee754-df.S: Fix comment for code working on ++ architectures >=3D 4. ++ * config/arm/ieee754-sf.S: Likewise. ++ ++2018-07-27 H.J. Lu ++ ++ PR libgcc/85334 ++ * config/i386/shadow-stack-unwind.h (_Unwind_Frames_Increment): ++ Removed. ++ ++2018-07-05 James Clarke ++ ++ * configure: Regenerated. ++ ++2018-06-27 Rainer Orth ++ ++ * Makefile.in (install_leaf): Use enable_gcov instead of ++ enable_libgcov. ++ ++2018-06-27 Rasmus Villemoes ++ ++ * configure.ac: Add --disable-gcov option. + * configure: Regenerate. ++ * Makefile.in: Honour @enable_gcov@. ++ ++2018-06-21 Christophe Lyon ++ ++ * config/arm/lib1funcs.S (__ARM_ARCH__): Remove definitions, use ++ __ARM_ARCH and __ARM_FEATURE_CLZ instead. ++ (HAVE_ARM_CLZ): Remove definition, use __ARM_FEATURE_CLZ instead. ++ * config/arm/ieee754-df.S: Use __ARM_FEATURE_CLZ instead of ++ __ARM_ARCH__. ++ * config/arm/ieee754-sf.S: Likewise. ++ * config/arm/libunwind.S: Use __ARM_ARCH instead of __ARM_ARCH__. ++ ++2018-06-21 Christophe Lyon ++ ++ * config/arm/ieee754-df.S: Remove code for __ARM_ARCH__ < 4, no ++ longer supported. ++ * config/arm/ieee754-sf.S: Likewise. ++ ++2018-06-20 Than McIntosh ++ ++ PR libgcc/86213 ++ * generic-morestack.c (allocate_segment): Move calls to getenv and ++ getpagesize to __morestack_load_mmap. ++ (__morestack_load_mmap) Initialize static_pagesize and ++ use_guard_page here so as to avoid clobbering SSE regs during a ++ __morestack call. ++ ++2018-06-18 Michael Meissner ++ ++ * config/rs6000/t-float128 (FP128_CFLAGS_SW): Compile float128 ++ support modules with -mno-gnu-attribute. ++ * config/rs6000/t-float128-hw (FP128_CFLAGS_HW): Likewise. +=20 +-2018-06-22 Andre Vieira ++2018-06-07 Olivier Hainque +=20 +- Backport from mainline +- 2018-05-17 Jerome Lambourg ++ * config/t-vxworks (LIBGCC_INCLUDES): Add ++ -I$(MULTIBUILDTOP)../../gcc/include. ++ * config/t-vxworks7: Likewise. Reformat a bit to match ++ the t-vxworks layout. ++ ++2018-06-07 Olga Makhotina ++ ++ * config/i386/cpuinfo.h (processor_types): Add INTEL_TREMONT. ++ ++2018-06-07 Martin Liska ++ ++ * libgcov-driver.c: Rename cs_all to all and assign it from ++ all_prg. ++ ++2018-06-07 Martin Liska ++ ++ PR bootstrap/86057 ++ * libgcov-driver-system.c (replace_filename_variables): Use ++ memcpy instead of mempcpy. ++ (allocate_filename_struct): Do not allocate filename, allocate ++ prefix and set it. ++ (gcov_exit_open_gcda_file): Allocate memory for gf->filename ++ here and properly copy content into it. ++ * libgcov-driver.c (struct gcov_filename): Remove max_length ++ field, change prefix from size_t into char *. ++ (compute_summary): Do not calculate longest filename. ++ (gcov_do_dump): Release memory of gf.filename after each file. ++ * libgcov-util.c (compute_summary): Use new signature of ++ compute_summary. ++ (calculate_overlap): Likewise. ++ ++2018-06-05 Martin Liska ++ ++ PR gcov-profile/47618 ++ * libgcov-driver-system.c (replace_filename_variables): New ++ function. ++ (gcov_exit_open_gcda_file): Use it. ++ ++2018-06-05 Martin Liska ++ ++ * libgcov-driver.c (gcov_compute_histogram): Remove usage ++ of gcov_ctr_summary. ++ (compute_summary): Do it just for a single summary. ++ (merge_one_data): Likewise. ++ (merge_summary): Simplify as we read just single summary. ++ (dump_one_gcov): Pass proper argument. ++ * libgcov-util.c (compute_one_gcov): Simplify as we have just ++ single summary. ++ (gcov_info_count_all_cold): Likewise. ++ (calculate_overlap): Likewise. ++ ++2018-06-02 Chung-Ju Wu ++ Monk Chiang ++ ++ * config.host (nds32*-linux*): New. ++ * config/nds32/linux-atomic.c: New file. ++ * config/nds32/linux-unwind.h: New file. ++ ++2018-05-31 Uros Bizjak ++ ++ PR target/85591 ++ * config/i386/cpuinfo.c (get_amd_cpu): Return ++ AMDFAM15H_BDVER2 for AMDFAM15H model 0x2. ++ ++2018-05-30 Rasmus Villemoes ++ ++ * crtstuff.c: Remove declaration of _Jv_RegisterClasses. ++ ++2018-05-29 Martin Liska ++ ++ PR gcov-profile/85759 ++ * libgcov-driver-system.c (gcov_error): Introduce usage of ++ GCOV_EXIT_AT_ERROR env. variable. ++ * libgcov-driver.c (merge_one_data): Print error that we ++ overwrite a gcov file with a different timestamp. ++ ++2018-05-23 Kalamatee ++ ++ * config/m68k/lb1sf68.S (Laddsf$nf): Fix sign bit handling in ++ path to Lf$finfty. ++ ++2018-05-18 Kito Cheng ++ Monk Chiang ++ Jim Wilson ++ ++ * config/riscv/save-restore.S: Add support for rv32e. ++ ++2018-05-18 Kyrylo Tkachov ++ ++ * config/arm/libunwind.S: Update comment relating to armv5. ++ ++2018-05-17 Jerome Lambourg +=20 + * config/arm/cmse.c (cmse_check_address_range): Replace + UINTPTR_MAX with __UINTPTR_MAX__ and uintptr_t with __UINTPTR_TYPE__. +=20 +-2018-04-02 H.J. Lu ++2018-05-17 Olga Makhotina ++ ++ * config/i386/cpuinfo.h (processor_types): Add INTEL_GOLDMONT_PLUS. ++ * config/i386/cpuinfo.c (get_intel_cpu): Detect Goldmont Plus. ++ ++2018-05-08 Olga Makhotina ++ ++ * config/i386/cpuinfo.h (processor_types): Add INTEL_GOLDMONT. ++ * config/i386/cpuinfo.c (get_intel_cpu): Detect Goldmont. ++ ++2018-05-07 Amaan Cheval ++ ++ * config.host (x86_64-*-rtems*): Build crti.o and crtn.o. ++ ++2018-04-27 Andreas Tobler ++ Maryse Levavasseur ++ ++ PR libgcc/84292 ++ * config/arm/freebsd-atomic.c (SYNC_OP_AND_FETCH_N): Fix the ++ op_and_fetch to return the right result. ++ ++2018-04-27 Alan Modra +=20 +- Backport from mainline +- 2018-03-29 H.J. Lu ++ PR libgcc/85532 ++ * config/rs6000/t-crtstuff (CRTSTUFF_T_CFLAGS): Add ++ -fno-asynchronous-unwind-tables. ++ ++2018-04-25 Chung-Ju Wu ++ ++ * config/nds32/sfp-machine.h: Fix settings for NDS32_ABI_2FP_PLUS. ++ * config/nds32/t-nds32-newlib (HOST_LIBGCC2_CFLAGS): Use -fwrapv. ++ ++2018-04-24 H.J. Lu ++ ++ * config/i386/linux-unwind.h: Add (__CET__ & 2) !=3D 0 check ++ when including "config/i386/shadow-stack-unwind.h". ++ ++2018-04-24 H.J. Lu ++ ++ * configure: Regenerated. ++ ++2018-04-20 Michael Meissner ++ ++ PR target/85456 ++ * config/rs6000/_powikf2.c: New file. Add support for the ++ __builtin_powil function when long double is IEEE 128-bit floating ++ point. ++ * config/rs6000/float128-ifunc.c (__powikf2_resolve): Add ++ __powikf2 support. ++ (__powikf2): Likewise. ++ * config/rs6000/quad-float128.h (__powikf2_sw): Likewise. ++ (__powikf2_hw): Likewise. ++ (__powikf2): Likewise. ++ * config/rs6000/t-float128 (fp128_ppc_funcs): Likewise. ++ * config/rs6000/t-float128-hw (fp128_hw_func): Likewise. ++ (_powikf2-hw.c): Likewise. ++ ++2018-04-19 H.J. Lu ++ ++ PR libgcc/85334 ++ * unwind-generic.h (_Unwind_Frames_Increment): New. ++ * config/i386/shadow-stack-unwind.h (_Unwind_Frames_Increment): ++ Likewise. ++ * unwind.inc (_Unwind_RaiseException_Phase2): Increment frame ++ count with _Unwind_Frames_Increment. ++ (_Unwind_ForcedUnwind_Phase2): Likewise. ++ ++2018-04-19 H.J. Lu ++ ++ PR libgcc/85379 ++ * config/i386/morestack.S (__stack_split_initialize): Add ++ _CET_ENDBR. ++ ++2018-04-19 Jakub Jelinek ++ ++ * configure: Regenerated. ++ ++2018-04-18 David Malcolm ++ ++ PR jit/85384 ++ * configure: Regenerate. ++ ++2018-04-16 Jakub Jelinek ++ ++ PR target/84945 ++ * config/i386/cpuinfo.c (set_feature): Wrap into do while (0) to avoid ++ -Wdangling-else warnings. Mask shift counts to avoid ++ -Wshift-count-negative and -Wshift-count-overflow false positives. ++ ++2018-04-06 Ruslan Bukin ++ ++ * config.host (riscv*-*-freebsd*): Add RISC-V FreeBSD support. ++ ++2018-03-29 H.J. Lu +=20 + PR target/85100 + * config/i386/cpuinfo.c (XCR_XFEATURE_ENABLED_MASK): New. +@@ -95,49 +1460,336 @@ + (get_available_features): Enable AVX and AVX512 features only + if their states are supported by OSXSAVE. +=20 +-2018-03-11 John David Anglin ++2018-03-22 Igor Tsimbalist ++ ++ PR target/85025 ++ * config/i386/shadow-stack-unwind.h (_Unwind_Frames_Extra): ++ Fix a typo, tmp =3D> 255. +=20 +- Backport from mainline +- 2018-03-06 John David Anglin ++2018-03-20 Jakub Jelinek ++ ++ PR target/84945 ++ * config/i386/cpuinfo.h (__cpu_features2): Declare. ++ * config/i386/cpuinfo.c (__cpu_features2): New variable for ++ ifndef SHARED only. ++ (set_feature): Define. ++ (get_available_features): Use set_feature macro. Set __cpu_features2 ++ to the second word of features ifndef SHARED. ++ ++2018-03-15 Julia Koval ++ ++ * config/i386/cpuinfo.c (get_available_features): Add ++ FEATURE_AVX512VBMI2, FEATURE_GFNI, FEATURE_VPCLMULQDQ, ++ FEATURE_AVX512VNNI, FEATURE_AVX512BITALG. ++ * config/i386/cpuinfo.h (processor_features): Add FEATURE_AVX512VBMI2, ++ FEATURE_GFNI, FEATURE_VPCLMULQDQ, FEATURE_AVX512VNNI, ++ FEATURE_AVX512BITALG. ++ ++2018-03-14 Julia Koval ++ ++ * config/i386/cpuinfo.h (processor_subtypes): Split up icelake on ++ icelake client and icelake server. ++ ++2018-03-06 John David Anglin +=20 + * config/pa/fptr.c (_dl_read_access_allowed): New. + (__canonicalize_funcptr_for_compare): Use it. +-=09 +-2018-02-20 Max Filippov +=20 +- Backport from mainline +- 2018-02-20 Max Filippov ++2018-02-28 Jakub Jelinek ++ ++ PR debug/83917 ++ * configure.ac (AS_HIDDEN_DIRECTIVE): AC_DEFINE_UNQUOTED this to ++ $asm_hidden_op if visibility ("hidden") attribute works. ++ (HAVE_AS_CFI_SECTIONS): New AC_DEFINE. ++ * config/i386/i386-asm.h: Don't include auto-host.h. ++ (PACKAGE_VERSION, PACKAGE_NAME, PACKAGE_STRING, PACKAGE_TARNAME, ++ PACKAGE_URL): Don't undefine. ++ (USE_GAS_CFI_DIRECTIVES): Don't use nor define this macro, instead ++ guard cfi_startproc only on ifdef __GCC_HAVE_DWARF2_CFI_ASM. ++ (FN_HIDDEN): Change guard from #ifdef HAVE_GAS_HIDDEN to ++ #ifdef AS_HIDDEN_DIRECTIVE, use AS_HIDDEN_DIRECTIVE macro in the ++ definition instead of hardcoded .hidden. ++ * config/i386/cygwin.S: Include i386-asm.h first before .cfi_sections ++ directive. Use #ifdef HAVE_AS_CFI_SECTIONS rather than ++ #ifdef HAVE_GAS_CFI_SECTIONS_DIRECTIVE to guard .cfi_sections. ++ (USE_GAS_CFI_DIRECTIVES): Don't define. ++ * configure: Regenerated. ++ * config.in: Likewise. ++ ++2018-02-26 Jakub Jelinek ++ ++ PR debug/83917 ++ * config/i386/i386-asm.h (PACKAGE_VERSION, PACKAGE_NAME, ++ PACKAGE_STRING, PACKAGE_TARNAME, PACKAGE_URL): Undefine between ++ inclusion of auto-target.h and auto-host.h. ++ (USE_GAS_CFI_DIRECTIVES): Define if not defined already based on ++ __GCC_HAVE_DWARF2_CFI_ASM. ++ (cfi_startproc, cfi_endproc, cfi_adjust_cfa_offset, ++ cfi_def_cfa_register, cfi_def_cfa, cfi_register, cfi_offset, cfi_push, ++ cfi_pop): Define. ++ * config/i386/cygwin.S: Don't include auto-host.h here, just ++ define USE_GAS_CFI_DIRECTIVES to 1 or 0 and include i386-asm.h. ++ (cfi_startproc, cfi_endproc, cfi_adjust_cfa_offset, ++ cfi_def_cfa_register, cfi_register, cfi_push, cfi_pop): Remove. ++ * config/i386/resms64fx.h: Add cfi_* directives. ++ * config/i386/resms64x.h: Likewise. ++ ++2018-02-20 Max Filippov +=20 + * config/xtensa/ieee754-df.S (__adddf3_aux): Add + .literal_position directive. + * config/xtensa/ieee754-sf.S (__addsf3_aux): Likewise. +=20 +-2018-01-25 Release Manager ++2018-02-14 Igor Tsimbalist +=20 +- * GCC 7.3.0 released. ++ PR target/84148 ++ * configure: Regenerate. +=20 +-2018-01-23 Max Filippov ++2018-02-16 Igor Tsimbalist ++ ++ PR target/84239 ++ * config/i386/shadow-stack-unwind.h (_Unwind_Frames_Extra): ++ Include cetintrin.h not x86intrin.h. ++ ++2018-02-08 Igor Tsimbalist ++ ++ PR target/84239 ++ * config/i386/shadow-stack-unwind.h (_Unwind_Frames_Extra): ++ Use new _get_ssp and _inc_ssp intrinsics. ++ ++2018-02-02 Julia Koval +=20 +- Backport from mainline +- 2018-01-23 Max Filippov ++ * config/i386/cpuinfo.h (processor_subtypes): Add INTEL_COREI7_ICELAKE. ++ ++2018-01-26 Claudiu Zissulescu ++ ++ * config/arc/lib1funcs.S (__udivmodsi4): Use safe version for RF16 ++ option. ++ (__divsi3): Use RF16 safe registers. ++ (__modsi3): Likewise. ++ ++2018-01-23 Max Filippov +=20 + * config/xtensa/ieee754-df.S (__addsf3, __subsf3, __mulsf3) + (__divsf3): Make NaN return value quiet. + * config/xtensa/ieee754-sf.S (__adddf3, __subdf3, __muldf3) + (__divdf3): Make NaN return value quiet. +=20 +-2018-01-08 Sebastian Huber ++2018-01-22 Sebastian Perta ++ ++ * config/rl78/anddi3.S: New assembly file. ++ * config/rl78/t-rl78: Added anddi3.S to LIB2ADD. ++ ++2018-01-22 Sebastian Perta ++ ++ * config/rl78/umindi3.S: New assembly file. ++ * config/rl78/t-rl78: Added umindi3.S to LIB2ADD. ++ ++2018-01-22 Sebastian Perta +=20 +- Backport from mainline +- 2018-01-05 Sebastian Huber ++ * config/rl78/smindi3.S: New assembly file. ++ * config/rl78/t-rl78: Added smindi3.S to LIB2ADD. ++ ++2018-01-22 Sebastian Perta ++ ++ * config/rl78/smaxdi3.S: New assembly file. ++ * config/rl78/t-rl78: Added smaxdi3.S to LIB2ADD. ++ ++2018-01-22 Sebastian Perta ++ ++ * config/rl78/umaxdi3.S: New assembly file. ++ * config/rl78/t-rl78: Added umaxdi3.S to LIB2ADD. ++ ++2018-01-21 John David Anglin ++ ++ PR lto/83452 ++ * config/pa/stublib.c (L_gnu_lto_v1): New stub definition. ++ * config/pa/t-stublib (gnu_lto_v1-stub.o): Add make fragment. ++ ++2018-01-13 Richard Sandiford ++ ++ * config/aarch64/value-unwind.h (aarch64_vg): New function. ++ (DWARF_LAZY_REGISTER_VALUE): Define. ++ * unwind-dw2.c (_Unwind_GetGR): Use DWARF_LAZY_REGISTER_VALUE ++ to provide a fallback register value. ++ ++2018-01-08 Michael Meissner ++ ++ * config/rs6000/quad-float128.h (IBM128_TYPE): Explicitly use ++ __ibm128, instead of trying to use long double. ++ (CVT_FLOAT128_TO_IBM128): Use TFtype instead of __float128 to ++ accomidate -mabi=3Dieeelongdouble multilibs. ++ (CVT_IBM128_TO_FLOAT128): Likewise. ++ * config/rs6000/ibm-ldouble.c (IBM128_TYPE): New macro to define ++ the appropriate IBM extended double type. ++ (__gcc_qadd): Change all occurances of long double to IBM128_TYPE. ++ (__gcc_qsub): Likewise. ++ (__gcc_qmul): Likewise. ++ (__gcc_qdiv): Likewise. ++ (pack_ldouble): Likewise. ++ (__gcc_qneg): Likewise. ++ (__gcc_qeq): Likewise. ++ (__gcc_qne): Likewise. ++ (__gcc_qge): Likewise. ++ (__gcc_qle): Likewise. ++ (__gcc_stoq): Likewise. ++ (__gcc_dtoq): Likewise. ++ (__gcc_itoq): Likewise. ++ (__gcc_utoq): Likewise. ++ (__gcc_qunord): Likewise. ++ * config/rs6000/_mulkc3.c (toplevel): Include soft-fp.h and ++ quad-float128.h for the definitions. ++ (COPYSIGN): Use the f128 version instead of the q version. ++ (INFINITY): Likewise. ++ (__mulkc3): Use TFmode/TCmode for float128 scalar/complex types. ++ * config/rs6000/_divkc3.c (toplevel): Include soft-fp.h and ++ quad-float128.h for the definitions. ++ (COPYSIGN): Use the f128 version instead of the q version. ++ (INFINITY): Likewise. ++ (FABS): Likewise. ++ (__divkc3): Use TFmode/TCmode for float128 scalar/complex types. ++ * config/rs6000/extendkftf2-sw.c (__extendkftf2_sw): Likewise. ++ * config/rs6000/trunctfkf2-sw.c (__trunctfkf2_sw): Likewise. ++ ++2018-01-05 Sebastian Huber +=20 + * config.host (epiphany-*-elf*): Add (epiphany-*-rtems*) + configuration. +=20 +-2017-11-21 Rainer Orth ++2018-01-03 Jakub Jelinek ++ ++ Update copyright years. ++ ++2017-12-12 Kito Cheng ++ ++ * config/riscv/t-elf: Use multi3.c instead of multi3.S. ++ * config/riscv/multi3.c: New file. ++ * config/riscv/multi3.S: Remove. ++ ++2017-12-08 Jim Wilson ++ ++ * config/riscv/div.S: Use FUNC_* macros. ++ * config/riscv/muldi3.S, config/riscv/multi3.S: Likewise ++ * config/riscv/save-restore.S: Likewise. ++ * config/riscv/riscv-asm.h: New. ++ ++2017-11-30 Michael Meissner ++ ++ * config/rs6000/_mulkc3.c (__mulkc3): Add forward declaration. ++ * config/rs6000/_divkc3.c (__divkc3): Likewise. ++ ++ PR libgcc/83112 ++ * config/rs6000/float128-ifunc.c (__addkf3_resolve): Use the ++ correct type for all ifunc resolvers to silence -Wattribute-alias ++ warnings. Eliminate the forward declaration of the resolver ++ functions which is no longer needed. ++ (__subkf3_resolve): Likewise. ++ (__mulkf3_resolve): Likewise. ++ (__divkf3_resolve): Likewise. ++ (__negkf2_resolve): Likewise. ++ (__eqkf2_resolve): Likewise. ++ (__nekf2_resolve): Likewise. ++ (__gekf2_resolve): Likewise. ++ (__gtkf2_resolve): Likewise. ++ (__lekf2_resolve): Likewise. ++ (__ltkf2_resolve): Likewise. ++ (__unordkf2_resolve): Likewise. ++ (__extendsfkf2_resolve): Likewise. ++ (__extenddfkf2_resolve): Likewise. ++ (__trunckfsf2_resolve): Likewise. ++ (__trunckfdf2_resolve): Likewise. ++ (__fixkfsi_resolve): Likewise. ++ (__fixkfdi_resolve): Likewise. ++ (__fixunskfsi_resolve): Likewise. ++ (__fixunskfdi_resolve): Likewise. ++ (__floatsikf_resolve): Likewise. ++ (__floatdikf_resolve): Likewise. ++ (__floatunsikf_resolve): Likewise. ++ (__floatundikf_resolve): Likewise. ++ (__extendkftf2_resolve): Likewise. ++ (__trunctfkf2_resolve): Likewise. ++ ++ PR libgcc/83103 ++ * config/rs6000/quad-float128.h (TF): Don't define if long double ++ is IEEE 128-bit floating point. ++ (TCtype): Define as either TCmode or KCmode, depending on whether ++ long double is IEEE 128-bit floating point. ++ (__mulkc3_sw): Add declarations for software/hardware versions of ++ complex multiply/divide. ++ (__divkc3_sw): Likewise. ++ (__mulkc3_hw): Likewise. ++ (__divkc3_hw): Likewise. ++ * config/rs6000/_mulkc3.c (_mulkc3): If we are building ifunc ++ handlers to switch between using software emulation and hardware ++ float128 instructions, build the complex multiply/divide functions ++ for both software and hardware support. ++ * config/rs6000/_divkc3.c (_divkc3): Likewise. ++ * config/rs6000/float128-ifunc.c (__mulkc3_resolve): Likewise. ++ (__divkc3_resolve): Likewise. ++ (__mulkc3): Likewise. ++ (__divkc3): Likewise. ++ * config/rs6000/t-float128-hw (fp128_hardfp_src): Likewise. ++ (fp128_hw_src): Likewise. ++ (fp128_hw_static_obj): Likewise. ++ (fp128_hw_shared_obj): Likewise. ++ (_mulkc3-hw.c): Create _mulkc3-hw.c and _divkc3-hw.c from ++ _mulkc3.c and _divkc3.c, changing the function name. ++ (_divkc3-hw.c): Likewise. ++ * config/rs6000/t-float128 (clean-float128): Delete _mulkc3-hw.c ++ and _divkc3-hw.c. ++ ++2017-11-26 Julia Koval ++ ++ * config/i386/cpuinfo.c (get_intel_cpu): Handle cannonlake. ++ * config/i386/cpuinfo.h (processor_subtypes): Add ++ INTEL_COREI7_CANNONLAKE. ++ ++2017-11-20 Igor Tsimbalist ++ ++ PR bootstrap/83015 ++ * config/cr16/unwind-cr16.c (uw_install_context): Add FRAMES ++ parameter. ++ * config/xtensa/unwind-dw2-xtensa.c: Likewise ++ * config/ia64/unwind-ia64.c: Add frames parameter. ++ * unwind-sjlj.c: Likewise. ++ ++2017-11-17 Igor Tsimbalist ++ ++ * config/i386/linux-unwind.h: Include ++ config/i386/shadow-stack-unwind.h. ++ * config/i386/shadow-stack-unwind.h: New file. ++ * unwind-dw2.c: (uw_install_context): Add a frame parameter and ++ pass it to _Unwind_Frames_Extra. ++ * unwind-generic.h (_Unwind_Frames_Extra): New. ++ * unwind.inc (_Unwind_RaiseException_Phase2): Add frames_p ++ parameter. Add local variable frames to count number of frames. ++ (_Unwind_ForcedUnwind_Phase2): Likewise. ++ (_Unwind_RaiseException): Add local variable frames to count ++ number of frames, pass it to _Unwind_RaiseException_Phase2 and ++ uw_install_context. ++ (_Unwind_ForcedUnwind): Likewise. ++ (_Unwind_Resume): Likewise. ++ (_Unwind_Resume_or_Rethrow): Likewise. ++ ++2017-11-17 Igor Tsimbalist ++ ++ * Makefile.in (configure_deps): Add $(srcdir)/../config/cet.m4. ++ (CET_FLAGS): New. ++ * config/i386/morestack.S: Include . ++ (__morestack_large_model): Add _CET_ENDBR at function entrance. ++ * config/i386/resms64.h: Include . ++ * config/i386/resms64f.h: Likewise. ++ * config/i386/resms64fx.h: Likewise. ++ * config/i386/resms64x.h: Likewise. ++ * config/i386/savms64.h: Likewise. ++ * config/i386/savms64f.h: Likewise. ++ * config/i386/t-linux (HOST_LIBGCC2_CFLAGS): Add $(CET_FLAGS). ++ (CRTSTUFF_T_CFLAGS): Likewise. ++ * configure.ac: Include ../config/cet.m4. ++ Set and substitute CET_FLAGS. ++ * configure: Regenerated. +=20 +- Backport from mainline +- 2017-11-14 Rainer Orth ++2017-11-14 Rainer Orth +=20 + * config.host (*-*-solaris2*): Adapt comment for Solaris 12 + renaming. +@@ -145,14 +1797,22 @@ + * configure.ac (libgcc_cv_solaris_crts): Likewise. + * configure: Regenerate. +=20 +-2017-11-17 Vineet Gupta ++2017-11-07 Tom de Vries +=20 +- * config.host: Remove uclibc from arc target spec. ++ * config/rs6000/aix-unwind.h (REGISTER_CFA_OFFSET_FOR): Remove semicolon ++ after "do {} while (0)". +=20 +-2017-11-05 Andreas Tobler ++2017-11-07 Tom de Vries +=20 +- Backport from mainline +- 2017-11-04 Andreas Tobler ++ PR other/82784 ++ * config/aarch64/sfp-machine.h (FP_HANDLE_EXCEPTIONS): Remove ++ semicolon after "do {} while (0)". ++ * config/i386/sfp-machine.h (FP_HANDLE_EXCEPTIONS): Same. ++ * config/ia64/sfp-machine.h (FP_HANDLE_EXCEPTIONS): Same. ++ * config/mips/sfp-machine.h (FP_HANDLE_EXCEPTIONS): Same. ++ * config/rs6000/sfp-machine.h (FP_HANDLE_EXCEPTIONS): Same. ++ ++2017-11-04 Andreas Tobler +=20 + PR libgcc/82635 + * config/i386/freebsd-unwind.h (MD_FALLBACK_FRAME_STATE_FOR): Use a +@@ -160,6 +1820,23 @@ + Keep the pattern matching method for systems without + KERN_PROC_SIGTRAMP sysctl. +=20 ++2017-11-03 Cupertino Miranda ++ Vineet Gupta ++ ++ * config.host (arc*-*-linux*): Set md_unwind_header variable. ++ * config/arc/linux-unwind-reg.def: New file. ++ * config/arc/linux-unwind-reg.h: Likewise. ++ ++2017-10-23 Sebastian Perta ++ ++ * config/rl78/subdi3.S: New assembly file. ++ * config/rl78/t-rl78: Added subdi3.S to LIB2ADD. ++ ++2017-10-13 Sebastian Perta ++ ++ * config/rl78/adddi3.S: New assembly file. ++ * config/rl78/t-rl78: Added adddi3.S to LIB2ADD. ++ + 2017-10-13 Jakub Jelinek +=20 + PR target/82274 +@@ -167,39 +1844,156 @@ + the same highpart of -1 and the topmost bit of lowpart is 0, + multiplication overflows even if both lowparts are 0. +=20 +-2017-09-28 Krister Walfridsson ++2017-09-28 James Bowman +=20 +- Backport from mainline +- 2017-05-14 Krister Walfridsson ++ * config/ft32/crti-hw.S: Add watchdog vector, FT930 IRQ support. +=20 +- PR target/80600 +- * config.host (*-*-netbsd*): Add t-slibgcc-libgcc to tmake_file. ++2017-09-26 Joseph Myers +=20 +-2017-08-14 Release Manager ++ * config/microblaze/crti.S, config/microblaze/crtn.S, ++ config/microblaze/divsi3.S, config/microblaze/moddi3.S, ++ config/microblaze/modsi3.S, config/microblaze/muldi3_hard.S, ++ config/microblaze/mulsi3.S, ++ config/microblaze/stack_overflow_exit.S, ++ config/microblaze/udivsi3.S, config/microblaze/umodsi3.S, ++ config/pa/milli64.S: Add .note.GNU-stack section. +=20 +- * GCC 7.2.0 released. ++2017-09-23 Daniel Santos +=20 +-2017-07-28 Sebastian Huber ++ * configure.ac: Add Check for HAVE_AS_AVX. ++ * config.in: Regenerate. ++ * configure: Likewise. ++ * config/i386/i386-asm.h: Include auto-target.h from libgcc. ++ (SSE_SAVE, SSE_RESTORE): Emit .byte sequence for !HAVE_AS_AVX. ++ Correct out-of-date comments. ++ ++2017-09-20 Sebastian Peryt ++ ++ * config/i386/cpuinfo.h (processor_types): Add INTEL_KNM. ++ * config/i386/cpuinfo.c (get_intel_cpu): Detect Knights Mill. ++ ++2017-09-17 Daniel Santos ++ ++ * config/i386/i386-asm.h (PASTE2): New macro. ++ (ASMNAME): Modify to use PASTE2. ++ (MS2SYSV_STUB_PREFIX): New macro for isa prefix. ++ (MS2SYSV_STUB_BEGIN, MS2SYSV_STUB_END): New macros for stub headers. ++ * config/i386/resms64.S: Rename to a header file, use MS2SYSV_STUB_BEGIN ++ instead of HIDDEN_FUNC and MS2SYSV_STUB_END instead of FUNC_END. ++ * config/i386/resms64f.S: Likewise. ++ * config/i386/resms64fx.S: Likewise. ++ * config/i386/resms64x.S: Likewise. ++ * config/i386/savms64.S: Likewise. ++ * config/i386/savms64f.S: Likewise. ++ * config/i386/avx_resms64.S: New file that only defines a macro and ++ includes it's corresponding header file. ++ * config/i386/avx_resms64f.S: Likewise. ++ * config/i386/avx_resms64fx.S: Likewise. ++ * config/i386/avx_resms64x.S: Likewise. ++ * config/i386/avx_savms64.S: Likewise. ++ * config/i386/avx_savms64f.S: Likewise. ++ * config/i386/sse_resms64.S: Likewise. ++ * config/i386/sse_resms64f.S: Likewise. ++ * config/i386/sse_resms64fx.S: Likewise. ++ * config/i386/sse_resms64x.S: Likewise. ++ * config/i386/sse_savms64.S: Likewise. ++ * config/i386/sse_savms64f.S: Likewise. ++ * config/i386/t-msabi: Modified to add avx and sse versions of stubs. ++ ++2017-09-01 Olivier Hainque ++ * config.host (*-*-vxworks7): Widen scope to vxworks7*. ++ ++2017-08-31 Olivier Hainque ++ ++ * config.host (powerpc-wrs-vxworks|vxworksae|vxworksmils): Now ++ match as powerpc-wrs-vxworks*. ++ ++2017-08-07 Jonathan Yong <10walls@gmail.com> ++ ++ * config.host (*-cygwin): Include file from mingw ++ config/i386/enable-execute-stack-mingw32.c ++ ++2017-08-01 Jerome Lambourg ++ Doug Rupp ++ Olivier Hainque ++ ++ * config.host (arm-wrs-vxworks*): Rework to handle arm-wrs-vxworks7 ++ as well as arm-wrs-vxworks. ++ * config/arm/t-vxworks7: New file. Add unwind-arm-vxworks.c to ++ LIB2ADDEH. ++ * config/arm/unwind-arm-vxworks.c: New file. Provide dummy ++ __exidx_start and __exidx_end for downloadable modules. ++ ++2017-08-01 Olivier Hainque ++ ++ * config/t-vxworks (LIBGCC2_INCLUDES): Start with -I. after -nostdinc. ++ * config/t-vxworks7: Likewise. ++ ++2017-08-01 Olivier Hainque ++ ++ * config/t-vxworks: Instead of redefining LIB2ADD, ++ augment LIB2ADDEH with vxlib.c and vxlib-tls.c. +=20 +- Backport from mainline +- 2017-07-28 Sebastian Huber ++2017-07-28 Sebastian Huber +=20 + * config/rs6000/ibm-ldouble.c: Disable if defined __rtems__. +=20 +-2017-07-20 Peter Bergner ++2017-07-24 Daniel Santos ++ ++ PR testsuite/80759 ++ * config.host: include i386/t-msabi for darwin and solaris. ++ * config/i386/i386-asm.h ++ (ELFFN): Rename to FN_TYPE. ++ (FN_SIZE): New macro. ++ (FN_HIDDEN): Likewise. ++ (ASMNAME): Likewise. ++ (FUNC_START): Rename to FUNC_BEGIN, use ASMNAME, replace .global with ++ .globl. ++ (HIDDEN_FUNC): Use ASMNAME and .globl instead of .global. ++ (SSE_SAVE): Convert to cpp macro, hard-code offset (always 0x60). ++ * config/i386/resms64.S: Use SSE_SAVE as cpp macro instead of gas ++ .macro. ++ * config/i386/resms64f.S: Likewise. ++ * config/i386/resms64fx.S: Likewise. ++ * config/i386/resms64x.S: Likewise. ++ * config/i386/savms64.S: Likewise. ++ * config/i386/savms64f.S: Likewise. ++ ++2017-07-19 John Marino ++ ++ * config/i386/dragonfly-unwind.h: Handle sigtramp relocation. ++ ++2017-07-12 Michael Meissner ++ ++ PR target/81193 ++ * configure.ac (PowerPC float128 hardware support): Test whether ++ we can use __builtin_cpu_supports before enabling the ifunc ++ handler. ++ * configure: Regenerate. ++ ++2017-07-10 Vineet Gupta +=20 +- Backport from mainline +- 2017-07-07 Peter Bergner ++ * config.host: Remove uclibc from arc target spec. ++ ++2017-07-09 Krister Walfridsson ++ ++ * config.host (*-*-netbsd*): Remove check for aout NetBSD releases. ++ ++2017-07-07 Peter Bergner +=20 + * config/rs6000/float128-ifunc.c: Don't include auxv.h. + (have_ieee_hw_p): Delete function. + (SW_OR_HW) Use __builtin_cpu_supports(). +=20 +-2017-07-19 John Marino ++2017-07-06 Thomas Preud'homme +=20 +- * config/i386/dragonfly-unwind.h: Handle sigtramp relocation. ++ * config/arm/lib1funcs.S: Defined __ARM_ARCH__ to 8 for ARMv8-R. ++ ++2017-07-03 Olivier Hainque ++ ++ * config/t-vxworks7: New file, really. +=20 +-2017-07-04 Joseph Myers ++2017-06-28 Joseph Myers +=20 + * config/aarch64/linux-unwind.h (aarch64_fallback_frame_state), + config/alpha/linux-unwind.h (alpha_fallback_frame_state), +@@ -214,10 +2008,22 @@ + config/xtensa/linux-unwind.h (xtensa_fallback_frame_state): Use + ucontext_t instead of struct ucontext. +=20 +-2017-06-28 Richard Biener ++2017-06-27 Jerome Lambourg +=20 +- Backport from mainline +- 2017-06-21 Richard Biener ++ * config.host (i*86-wrs-vxworks7): Handle new acceptable triplet. ++ (x86_64-wrs-vxworks7): Likewise. ++ ++2017-06-27 Olivier Hainque ++ ++ * config/t-vxworks7: New file. ++ * config.host (*-*-vxworks7): Use it. ++ ++2017-06-22 Matt Turner ++ ++ * config/i386/cpuinfo.c (get_intel_cpu): Add Kaby Lake models to ++ skylake case. ++ ++2017-06-21 Richard Biener +=20 + PR gcov-profile/81080 + * configure.ac: Add AC_SYS_LARGEFILE. +@@ -226,15 +2032,46 @@ + * config.in: Regenerate. + * configure: Likewise. +=20 ++2017-06-16 Richard Earnshaw ++ ++ * config/arm/cmse_nonsecure_call.S: Explicitly set the FPU. ++ ++2017-06-09 Martin Liska ++ ++ * libgcov-profiler.c (__gcov_indirect_call_profiler_v2): ++ Reset __gcov_indirect_call_callee to NULL. ++ ++2017-06-08 Olivier Hainque ++ ++ * config/t-vxworks (LIBGCC2_INCLUDES): Add path to wrn/coreip to ++ the set of -I options, support for direct inclusions of net/uio.h ++ by VxWorks header files via ioLib.h. ++ ++2017-06-07 Tony Reix ++ Matthieu Sarter ++ David Edelsohn ++ ++ * config/rs6000/aix-unwind.h (MD_FALLBACK_FRAME_STATE_FOR): Define ++ unconditionally. ++ (ucontext_for): Add 64-bit AIX 6.1, 7.1, 7.2 support. Add 32-bit ++ AIX 7.2 support. ++ ++2017-06-02 Olivier Hainque ++ ++ * config/vxlib.c (__gthread_once): Add missing value to ++ return statement. ++ ++2017-05-30 Olivier Hainque ++ ++ * config/t-vxworks (LIBGCC2_INCLUDES): Remove extraneous ++ dollar sign before $(MULTIDIR). ++ + 2017-05-26 Richard Henderson +=20 + PR libgcc/80037 + * config/alpha/t-alpha (CRTSTUFF_T_CFLAGS): New. +=20 +-2017-05-19 Andreas Tobler +- +- Backport from mainline +- 2017-05-17 Andreas Tobler ++2017-05-17 Andreas Tobler +=20 + * config/arm/unwind-arm.h: Make _Unwind_GetIP, _Unwind_GetIPInfo and + _Unwind_SetIP available as functions for arm*-*-freebsd*. +@@ -245,17 +2082,35 @@ + * config/sparc/lb1spc.S [__ELF__ && __linux__]: Emit .note.GNU-stack + section for a non-executable stack. +=20 +-2017-05-10 Andreas Tobler ++2017-05-14 Krister Walfridsson ++ ++ PR target/80600 ++ * config.host (*-*-netbsd*): Add t-slibgcc-libgcc to tmake_file. ++ ++2017-05-14 Daniel Santos ++ ++ * config.host: Add i386/t-msabi to i386/t-linux file list. ++ * config/i386/i386-asm.h: New file. ++ * config/i386/resms64.S: New file. ++ * config/i386/resms64f.S: New file. ++ * config/i386/resms64fx.S: New file. ++ * config/i386/resms64x.S: New file. ++ * config/i386/savms64.S: New file. ++ * config/i386/savms64f.S: New file. ++ * config/i386/t-msabi: New file. +=20 +- Backport from mainline +- 2017-05-09 Andreas Tobler ++2017-05-09 Andreas Tobler +=20 + * config.host: Use the generic FreeBSD t-slibgcc-elf-ver for + arm*-*-freebsd* instead of the t-slibgcc-libgcc. +=20 +-2017-05-02 Release Manager ++2017-05-05 Joshua Conner +=20 +- * GCC 7.1.0 released. ++ * config/arm/unwind-arm.h (_Unwind_decode_typeinfo_ptr): Use ++ pc-relative indirect handling for fuchsia. ++ * config/t-slibgcc-fuchsia: New file. ++ * config.host (*-*-fuchsia*, aarch64*-*-fuchsia*, arm*-*-fuchsia*, ++ x86_64-*-fuchsia*): Add definitions. +=20 + 2017-04-19 Martin Liska +=20 +@@ -8675,7 +10530,7 @@ + shared-object.mk, siditi-object.mk, static-object.mk: New files. + * configure: Generated. + +-Copyright (C) 2007-2017 Free Software Foundation, Inc. ++Copyright (C) 2007-2020 Free Software Foundation, Inc. +=20 + Copying and distribution of this file, with or without modification, + are permitted in any medium without royalty provided the copyright +diff --git a/libgcc/Makefile.in b/libgcc/Makefile.in +index a1a392de88d..3a94dab2fdd 100644 +--- a/libgcc/Makefile.in ++++ b/libgcc/Makefile.in +@@ -163,6 +163,7 @@ AUTOCONF =3D autoconf + configure_deps =3D \ + $(srcdir)/../config/enable.m4 \ + $(srcdir)/../config/tls.m4 \ ++ $(srcdir)/../config/toolexeclibdir.m4 \ + $(srcdir)/../config/acx.m4 \ + $(srcdir)/../config/no-executables.m4 \ + $(srcdir)/../config/lib-ld.m4 \ +diff --git a/libgcc/configure b/libgcc/configure +index 441601a1f76..976827dc57e 100644 +--- a/libgcc/configure ++++ b/libgcc/configure +@@ -669,6 +669,7 @@ enable_shared + enable_vtable_verify + with_aix_soname + enable_version_specific_runtime_libs ++with_toolexeclibdir + with_slibdir + enable_maintainer_mode + with_build_libsubdir +@@ -1329,6 +1330,9 @@ Optional Packages: + --with-aix-soname=3Daix|svr4|both + shared library versioning (aka "SONAME") varian= t to + provide on AIX ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-slibdir=3DDIR shared libraries in DIR LIBDIR + --with-build-libsubdir=3DDIR Directory where to find libraries for bui= ld system + --with-system-libunwind use installed libunwind +@@ -2403,6 +2407,22 @@ fi + $as_echo "$version_specific_libs" >&6; } +=20 +=20 ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ ++ + # Check whether --with-slibdir was given. + if test "${with_slibdir+set}" =3D set; then : + withval=3D$with_slibdir; slibdir=3D"$with_slibdir" +@@ -2410,7 +2430,14 @@ else + if test "${version_specific_libs}" =3D yes; then + slibdir=3D'$(libsubdir)' + elif test -n "$with_cross_host" && test x"$with_cross_host" !=3D x"no"; t= hen +- slibdir=3D'$(exec_prefix)/$(host_noncanonical)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ slibdir=3D'$(exec_prefix)/$(host_noncanonical)/lib' ++ ;; ++ *) ++ slibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + slibdir=3D'$(libdir)' + fi +@@ -2640,7 +2667,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_noncanonical)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_noncanonical)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libgcc/configure.ac b/libgcc/configure.ac +index 99b8e15562f..ca833fdc5c1 100644 +--- a/libgcc/configure.ac ++++ b/libgcc/configure.ac +@@ -2,6 +2,7 @@ dnl Process this file with autoconf to produce a configure= script. +=20 + sinclude(../config/enable.m4) + sinclude(../config/tls.m4) ++sinclude(../config/toolexeclibdir.m4) + sinclude(../config/acx.m4) + sinclude(../config/no-executables.m4) + sinclude(../config/lib-ld.m4) +@@ -108,16 +109,25 @@ AC_ARG_ENABLE(version-specific-runtime-libs, + [version_specific_libs=3Dno]) + AC_MSG_RESULT($version_specific_libs) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + AC_ARG_WITH(slibdir, + [ --with-slibdir=3DDIR shared libraries in DIR [LIBDIR]], + slibdir=3D"$with_slibdir", +-if test "${version_specific_libs}" =3D yes; then ++[if test "${version_specific_libs}" =3D yes; then + slibdir=3D'$(libsubdir)' + elif test -n "$with_cross_host" && test x"$with_cross_host" !=3D x"no"; t= hen +- slibdir=3D'$(exec_prefix)/$(host_noncanonical)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ slibdir=3D'$(exec_prefix)/$(host_noncanonical)/lib' ++ ;; ++ *) ++ slibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + slibdir=3D'$(libdir)' +-fi) ++fi]) + AC_SUBST(slibdir) +=20 + # Command-line options. +@@ -163,7 +173,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_noncanonical)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_noncanonical)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libgfortran/ChangeLog b/libgfortran/ChangeLog +index 1de15a0c710..fe7e48040cd 100644 +--- a/libgfortran/ChangeLog ++++ b/libgfortran/ChangeLog +@@ -1,709 +1,46 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. +- +-2019-04-16 John David Anglin +- +- Backport from mainline +- 2019-03-25 John David Anglin +- +- PR libgfortran/79540 +- * io/write_float.def (build_float_string): Don't copy digits when +- ndigits is negative. +- +-2019-02-03 Uro=C5=A1 Bizjak +- +- PR libfortran/88678 +- Revert: +- 2016-11-16 Szabolcs Nagy +- +- PR libfortran/78314 +- * config/fpu-glibc.h (support_fpu_trap): Use feenableexcept. +- +-2019-02-03 Uro=C5=A1 Bizjak +- +- PR libfortran/88678 +- * config/fpu-glibc.h (set_fpu_trap_exceptions): Clear stalled +- exception flags before changing trap mode. Optimize to call +- feenableexcept and fedisableexcept only once. +- +-2019-01-13 Jerry DeLisle +- +- PR libfortran/88776 +- * io/list_read.c (namelist_read): Use nml_err_ret path on read error +- not based on stdin_unit. +- * io/open.c (newunit): Free format buffer if the unit specified is for +- stdin, stdout, or stderr. +- +-2018-12-06 Janne Blomqvist +- +- Backport from trunk +- PR libfortran/88137 +- * runtime/backtrace.c (show_backtrace): Store backtrace state in a +- static variable, initialize once. +- +-2018-12-06 Release Manager +- +- * GCC 7.4.0 released. +- +-2018-10-13 Gerald Pfeifer +- +- Backport from trunk +- * io/close.c [!HAVE_UNLINK_OPEN_FILE]: Include . +- +-2018-09-18 Kyrylo Tkachov +- +- Backport from trunk +- 2018-09-14 Kyrylo Tkachov +- +- * io/unix.c (fallback_access): Avoid calling close on +- uninitialized file descriptor. +- +-2018-06-22 Jakub Jelinek +- +- Backported from mainline +- 2018-04-18 David Malcolm +- +- PR jit/85384 ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * Makefile.in: Regenerate. ++ * aclocal.m4: Regenerate. + * configure: Regenerate. +=20 +-2018-06-09 Jerry DeLisle +- +- Backport from trunk. +- PR libgfortran/86070 +- * io/write_float.def (build_float_string): Initialize *len. +- +-2018-06-01 Jerry DeLisle +- +- Backport from trunk. +- PR libgfortran/85840 +- * io/write.c (write_float_0, write_real, write_real_g0, +- write_complex): Use separate local variables for the float +- string length. +- +-2018-02-18 Jerry DeLisle +- +- Backport from trunk +- PR libgfortran/84412 +- * io/transfer.c (finalize_transfer): After completng an internal unit +- I/O operation, clear internal_unit_kind. +- +-2018-01-25 Release Manager +- +- * GCC 7.3.0 released. +- +-2018-01-14 Jerry DeLisle +- +- Backport from trunk +- PR libgfortran/83811 +- * write.c (select_buffer): Adjust buffer size up by 1. +- +-2018-01-03 Janne Blomqvist +- +- Backport from trunk +- PR libgfortran/83649 +- * io/unix.c (MAX_CHUNK): New define. +- (raw_read): For reads larger than MAX_CHUNK, loop. +- (raw_write): Write no more than MAX_CHUNK bytes per iteration. +- +-2017-12-29 Jerry DeLisle +- +- Backport from trunk +- PR libgfortran/83613 +- * io/unit.c (init_units): Don't forget to unlock the unit locks +- after being inserted. +- +-2017-12-16 Jerry DeLisle +- +- Backport from trunk +- PR libgfortran/81937 +- * io/list_read.c (next_char_internal): Don't attempt to read +- from the internal unit stream if no bytes are left. Decrement +- bytes_left in the right place. +- +-2017-12-16 Jerry DeLisle +- +- Backport from trunk +- PR libgfortran/78549 +- * io/inquire.c (inquire_via_unit): Adjust test for existence for +- pre-connected internal units. +- * io/transfer.c (finalize_transfer): When done with a transfer +- to internal units, free the format buffer and close the stream. +- (st_read_done): Delete freeing the stream, now handled using +- sclose in finalize_transfer. (st_write_done): Likewise. +- * io/unit.c (get_unit): Return NULL for special reserved unit +- numbers, signifying not accessible to the user. +- (init_units): Insert the two special internal units into the +- unit treap. This makes these unit structures available without +- further allocations for later use by internal unit I/O. These +- units are automatically deleted by normal program termination. +- * io/unix.c (mem_close): Add a guard check to protect from double free. +- +-2017-12-03 Jerry DeLisle +- +- Backport from trunk +- PR libgfortran/83168 +- * io/write.c (select_string): Bump size by one to avoid +- overrun. +- +-2017-12-03 Jerry DeLisle +- Dominique d'Humieres +- +- Backport from trunk +- PR libgfortran/83191 +- * io/transfer.c (list_formatted_read_scalar): Do not set +- namelist_mode bit here. (namelist_read): Likewise. +- (data_transfer_init): Clear the mode bit here. +- (finalize_transfer): Do set the mode bit just before any calls +- to namelist_read or namelist_write. It can now be referred to +- in complex_write. +- * io/write.c (write_complex): Suppress the leading blanks when +- namelist_mode bit is not set to 1. +- +-2017-12-02 Jerry DeLisle +- +- Backport from trunk +- PR libgfortran/83225 +- * io/io.h (is_internal_unit): Use the unit_is_internal bit. +- * io/transfer.c (data_transfer_init): Set the bit to true for +- internal units. Use that bit for checks for internal unit +- initializations. +- * io/unit.c (insert_unit): As a precaution, set the +- internal_unit_kind to zero when a unit structure is first created. +- +-2017-11-23 Jerry DeLisle +- +- Backport from trunk +- PR libgfortran/78549 +- * io/io.h (newunit_free): Add declaration. Clean some whitespace. +- * io/transfer.c (st_read_done, st_write_done): Call newunit_free. +- * io/unit.c (newunit_free): Change type from static void to void. +- +-2017-10-27 Jerry DeLisle +- Rimvydas (RJ) +- +- Backport from trunk +- PR libgfortran/81938 +- io/format.c (free_format_data): Don't try to free vlist +- descriptors past the end of the fnode array. +- +-2017-10-19 Thomas Koenig +- +- Backport from trunk +- PR libfortran/82233 +- * intrinsics/execute_command_line.c (execute_command_line): +- No call to runtime_error if cmdstat is present. +- +-2017-09-19 Jerry DeLisle +- +- Backport from trunk +- PR libgfortran/78387 +- * io/list_read.c (nml_read_obj): Remove use of stash. +- * io/transfer.c (st_read_done, st_write_done): Likewise. +- * io/unit.c (stash_internal_unit): Delete function. +- (get_unit): Remove use of stash. +- (init_units): Likewise. +- (close_units): Likewise. +- * io/write.c (nml_write_obj): Likewise: +- +-2017-08-14 Release Manager +- +- * GCC 7.2.0 released. +- +-2017-06-27 Jerry DeLisle +- +- Backport from trunk +- PR libgfortran/53029 +- * io/list_read.c(list_formatted_read_scalar: Set the err return +- value to the common.flags error values. +- +-2017-06-26 Jim Wilson +- +- Backport from trunk +- PR libfortran/81195 +- * io/unit.c (get_unit): Call __gthread_mutex_lock before newunit_stack +- and newunit_tos references. Call __gthread_mutex_unlock afterward. +- +-2017-06-06 Thomas Koenig +- +- Backport from trunk +- PR fortran/80975 +- * m4/matmul_internal.m4: Move zeroing before early return. +- * generated/matmul_c10.c: Regenerated. +- * generated/matmul_c16.c: Regenerated. +- * generated/matmul_c4.c: Regenerated. +- * generated/matmul_c8.c: Regenerated. +- * generated/matmul_i1.c: Regenerated. +- * generated/matmul_i16.c: Regenerated. +- * generated/matmul_i2.c: Regenerated. +- * generated/matmul_i4.c: Regenerated. +- * generated/matmul_i8.c: Regenerated. +- * generated/matmul_r10.c: Regenerated. +- * generated/matmul_r16.c: Regenerated. +- * generated/matmul_r4.c: Regenerated. +- * generated/matmul_r8.c: Regenerated. +- +-2017-05-23 Jerry DeLisle +- +- Backport from trunk +- PR libgfortran/80741 +- * transfer.c (finalize_transfer): Reset last_char to 'empty'. +- * file_pos.c (formatted_backspace): Likewise. +- (st_endfile): Likewise. +- (st_rewind): Likewise. +- (st_flush): Likewise. +- +-2017-05-23 Paul Thomas +- Jerry DeLisle +- +- Backport from trunk +- PR fortran/80333 +- * list_read.c (nml_read_obj): Compute pointer into class/type +- arrays from the nl->dim information. Update it for each iteration +- of the loop for the given object. +- +-2017-05-19 Janne Blomqvist +- +- Backport from trunk +- * libgfortran.h: HAVE_SECURE_GETENV: Don't check +- HAVE___SECURE_GETENV. +- * environ/runtime.c (secure_getenv): Use __secure_getenv via a +- weak reference. +- +-2017-05-17 Jerry DeLisle +- +- Backport from trunk +- PR libgfortran/80727 +- * transfer.c (read_sf_internal): Remove bogus code to detect EOR. +- (read_block_form): For internal units, generate EOR if no more +- bytes left in unit and we are trying to read with ADVANCE=3D'NO'. +- +-2017-05-02 Release Manager +- +- * GCC 7.1.0 released. +- +-2017-04-11 Jerry DeLisle +- +- * close.c: Fix white space in pointer declarations and comment +- formats where applicable. +- * fbuf.c: Likewise. +- * fbuf.h: Likewise. +- * format.c: Likewise. +- * inquire.c: Likewise. +- * intrinsics.c: Likewise. +- * list_read.c: Likewise. +- * lock.c: Likewise. +- * open.c: Likewise. +- * read.c: Likewise. +- * transfer.c: Likewise. +- * unit.c: Likewise. +- * unix.c: Likewise. +- * unix.h: Likewise. +- * write.c: Likewise. +- +-2017-03-29 Jerry DeLisle +- +- PR libgfortran/78670 +- * io/list_read.c (nml_get_obj_data): Delete code which calls the +- child read procedure. (nml_read_obj): Insert the code which +- calls the child procedure. Don't need to touch nodes if using +- dtio since parent will not be traversing the components. +- +-2017-03-28 Janus Weil +- +- PR fortran/78661 +- * io/write.c (nml_write_obj): Build a class container only if necessary. +- +-2017-03-27 Dominique d'Humieres +- +- * io/list_read.c: Insert /* Fall through. */ in the macro +- CASE_SEPARATORS in order to silence warnings. +- +-2017-03-25 Jerry DeLisle +- +- PR libgfortran/78881 +- * io/io.h (st_parameter_dt): Rename unused component last_char to +- child_saved_iostat. Move comment to gfc_unit. +- * io/list_read.c (list_formatted_read_scalar): After call to +- child READ procedure, save the returned iostat value for later +- check. (finish_list_read): Only finish READ if child_saved_iostat +- was OK. +- * io/transfer.c (read_sf_internal): If there is a saved character +- in last character, seek back one. Add a new check for EOR +- condition. (read_sf): If there is a saved character +- in last character, seek back one. (formatted_transfer_scalar_read): +- Initialize last character before invoking child procedure. +- (data_transfer_init): If child dtio, set advance +- status to nonadvancing. Move update of size and check for EOR +- condition to before child dtio return. +- +-2017-03-17 Thomas Koenig +- +- PR libfortran/79956 +- * m4/reshape.m4 (reshape_'rtype_ccode`): Correct use +- of GFC_ASSERT. +- * generated/reshape_c10.c: Regenerated. +- * generated/reshape_c16.c: Regenerated. +- * generated/reshape_c4.c: Regenerated. +- * generated/reshape_c8.c: Regenerated. +- * generated/reshape_i16.c: Regenerated. +- * generated/reshape_i4.c: Regenerated. +- * generated/reshape_i8.c: Regenerated. +- * generated/reshape_r10.c: Regenerated. +- * generated/reshape_r16.c: Regenerated. +- * generated/reshape_r4.c: Regenerated. +- * generated/reshape_r8.c: Regenerated. +- +-2017-03-15 NightStrike +- Janne Blomqvist +- +- * intrinsics/random.c (getosrandom): Remove check for __CYGWIN__ +- preprocessor flag. +- * intrinsics/system_clock.c: Likewise. +- (system_clock_4): Likewise. +- (system_clock_8): Likewise. +- * intrinsics/time_1.h: Don't include windows.h if __CYGWIN__ is +- defined. +- +-2017-03-10 Thomas Koenig +- +- PR libfortran/79956 +- * libgfortran.h (GFC_ASSERT): New macro. +- * m4/reshape.m4 (reshape_'rtype_ccode`): Use GFC_ASSERT +- to specify that sdim > 0 and rdim > 0. +- * intrinsic/reshape_generic.c (reshape_internal): Likweise. +- * generated/reshape_c10.c: Regenerated. +- * generated/reshape_c16.c: Regenerated. +- * generated/reshape_c4.c: Regenerated. +- * generated/reshape_c8.c: Regenerated. +- * generated/reshape_i16.c: Regenerated. +- * generated/reshape_i4.c: Regenerated. +- * generated/reshape_i8.c: Regenerated. +- * generated/reshape_r10.c: Regenerated. +- * generated/reshape_r16.c: Regenerated. +- * generated/reshape_r4.c: Regenerated. +- * generated/reshape_r8.c: Regenerated. +- +-2017-03-11 Jerry DeLisle +- +- PR libgfortran/78854 +- * io/list_read.c (nml_get_obj_data): Stash internal unit for +- later use by child procedures. +- * io/write.c (nml_write_obj): Likewise. +- * io/tranfer.c (data_transfer_init): Minor whitespace. +- * io/unit.c (set_internal_uit): Look for the stashed internal +- unit and use it if found. +- +-2017-03-10 Thomas Koenig +- +- PR libfortran/79956 +- * m4/iforeach.m4: Change exit condition from loop for +- increasing dimension to >=3D. Fix type in comment. +- * m4/ifunction.m4: Likewise. +- * m4/ifunction_logical.m4: Likewise. +- * generated/all_l1.c: Regenerated. +- * generated/all_l16.c: Regenerated. +- * generated/all_l2.c: Regenerated. +- * generated/all_l4.c: Regenerated. +- * generated/all_l8.c: Regenerated. +- * generated/any_l1.c: Regenerated. +- * generated/any_l16.c: Regenerated. +- * generated/any_l2.c: Regenerated. +- * generated/any_l4.c: Regenerated. +- * generated/any_l8.c: Regenerated. +- * generated/count_16_l.c: Regenerated. +- * generated/count_1_l.c: Regenerated. +- * generated/count_2_l.c: Regenerated. +- * generated/count_4_l.c: Regenerated. +- * generated/count_8_l.c: Regenerated. +- * generated/iall_i1.c: Regenerated. +- * generated/iall_i16.c: Regenerated. +- * generated/iall_i2.c: Regenerated. +- * generated/iall_i4.c: Regenerated. +- * generated/iall_i8.c: Regenerated. +- * generated/iany_i1.c: Regenerated. +- * generated/iany_i16.c: Regenerated. +- * generated/iany_i2.c: Regenerated. +- * generated/iany_i4.c: Regenerated. +- * generated/iany_i8.c: Regenerated. +- * generated/iparity_i1.c: Regenerated. +- * generated/iparity_i16.c: Regenerated. +- * generated/iparity_i2.c: Regenerated. +- * generated/iparity_i4.c: Regenerated. +- * generated/iparity_i8.c: Regenerated. +- * generated/maxloc0_16_i1.c: Regenerated. +- * generated/maxloc0_16_i16.c: Regenerated. +- * generated/maxloc0_16_i2.c: Regenerated. +- * generated/maxloc0_16_i4.c: Regenerated. +- * generated/maxloc0_16_i8.c: Regenerated. +- * generated/maxloc0_16_r10.c: Regenerated. +- * generated/maxloc0_16_r16.c: Regenerated. +- * generated/maxloc0_16_r4.c: Regenerated. +- * generated/maxloc0_16_r8.c: Regenerated. +- * generated/maxloc0_4_i1.c: Regenerated. +- * generated/maxloc0_4_i16.c: Regenerated. +- * generated/maxloc0_4_i2.c: Regenerated. +- * generated/maxloc0_4_i4.c: Regenerated. +- * generated/maxloc0_4_i8.c: Regenerated. +- * generated/maxloc0_4_r10.c: Regenerated. +- * generated/maxloc0_4_r16.c: Regenerated. +- * generated/maxloc0_4_r4.c: Regenerated. +- * generated/maxloc0_4_r8.c: Regenerated. +- * generated/maxloc0_8_i1.c: Regenerated. +- * generated/maxloc0_8_i16.c: Regenerated. +- * generated/maxloc0_8_i2.c: Regenerated. +- * generated/maxloc0_8_i4.c: Regenerated. +- * generated/maxloc0_8_i8.c: Regenerated. +- * generated/maxloc0_8_r10.c: Regenerated. +- * generated/maxloc0_8_r16.c: Regenerated. +- * generated/maxloc0_8_r4.c: Regenerated. +- * generated/maxloc0_8_r8.c: Regenerated. +- * generated/maxloc1_16_i1.c: Regenerated. +- * generated/maxloc1_16_i16.c: Regenerated. +- * generated/maxloc1_16_i2.c: Regenerated. +- * generated/maxloc1_16_i4.c: Regenerated. +- * generated/maxloc1_16_i8.c: Regenerated. +- * generated/maxloc1_16_r10.c: Regenerated. +- * generated/maxloc1_16_r16.c: Regenerated. +- * generated/maxloc1_16_r4.c: Regenerated. +- * generated/maxloc1_16_r8.c: Regenerated. +- * generated/maxloc1_4_i1.c: Regenerated. +- * generated/maxloc1_4_i16.c: Regenerated. +- * generated/maxloc1_4_i2.c: Regenerated. +- * generated/maxloc1_4_i4.c: Regenerated. +- * generated/maxloc1_4_i8.c: Regenerated. +- * generated/maxloc1_4_r10.c: Regenerated. +- * generated/maxloc1_4_r16.c: Regenerated. +- * generated/maxloc1_4_r4.c: Regenerated. +- * generated/maxloc1_4_r8.c: Regenerated. +- * generated/maxloc1_8_i1.c: Regenerated. +- * generated/maxloc1_8_i16.c: Regenerated. +- * generated/maxloc1_8_i2.c: Regenerated. +- * generated/maxloc1_8_i4.c: Regenerated. +- * generated/maxloc1_8_i8.c: Regenerated. +- * generated/maxloc1_8_r10.c: Regenerated. +- * generated/maxloc1_8_r16.c: Regenerated. +- * generated/maxloc1_8_r4.c: Regenerated. +- * generated/maxloc1_8_r8.c: Regenerated. +- * generated/maxval_i1.c: Regenerated. +- * generated/maxval_i16.c: Regenerated. +- * generated/maxval_i2.c: Regenerated. +- * generated/maxval_i4.c: Regenerated. +- * generated/maxval_i8.c: Regenerated. +- * generated/maxval_r10.c: Regenerated. +- * generated/maxval_r16.c: Regenerated. +- * generated/maxval_r4.c: Regenerated. +- * generated/maxval_r8.c: Regenerated. +- * generated/minloc0_16_i1.c: Regenerated. +- * generated/minloc0_16_i16.c: Regenerated. +- * generated/minloc0_16_i2.c: Regenerated. +- * generated/minloc0_16_i4.c: Regenerated. +- * generated/minloc0_16_i8.c: Regenerated. +- * generated/minloc0_16_r10.c: Regenerated. +- * generated/minloc0_16_r16.c: Regenerated. +- * generated/minloc0_16_r4.c: Regenerated. +- * generated/minloc0_16_r8.c: Regenerated. +- * generated/minloc0_4_i1.c: Regenerated. +- * generated/minloc0_4_i16.c: Regenerated. +- * generated/minloc0_4_i2.c: Regenerated. +- * generated/minloc0_4_i4.c: Regenerated. +- * generated/minloc0_4_i8.c: Regenerated. +- * generated/minloc0_4_r10.c: Regenerated. +- * generated/minloc0_4_r16.c: Regenerated. +- * generated/minloc0_4_r4.c: Regenerated. +- * generated/minloc0_4_r8.c: Regenerated. +- * generated/minloc0_8_i1.c: Regenerated. +- * generated/minloc0_8_i16.c: Regenerated. +- * generated/minloc0_8_i2.c: Regenerated. +- * generated/minloc0_8_i4.c: Regenerated. +- * generated/minloc0_8_i8.c: Regenerated. +- * generated/minloc0_8_r10.c: Regenerated. +- * generated/minloc0_8_r16.c: Regenerated. +- * generated/minloc0_8_r4.c: Regenerated. +- * generated/minloc0_8_r8.c: Regenerated. +- * generated/minloc1_16_i1.c: Regenerated. +- * generated/minloc1_16_i16.c: Regenerated. +- * generated/minloc1_16_i2.c: Regenerated. +- * generated/minloc1_16_i4.c: Regenerated. +- * generated/minloc1_16_i8.c: Regenerated. +- * generated/minloc1_16_r10.c: Regenerated. +- * generated/minloc1_16_r16.c: Regenerated. +- * generated/minloc1_16_r4.c: Regenerated. +- * generated/minloc1_16_r8.c: Regenerated. +- * generated/minloc1_4_i1.c: Regenerated. +- * generated/minloc1_4_i16.c: Regenerated. +- * generated/minloc1_4_i2.c: Regenerated. +- * generated/minloc1_4_i4.c: Regenerated. +- * generated/minloc1_4_i8.c: Regenerated. +- * generated/minloc1_4_r10.c: Regenerated. +- * generated/minloc1_4_r16.c: Regenerated. +- * generated/minloc1_4_r4.c: Regenerated. +- * generated/minloc1_4_r8.c: Regenerated. +- * generated/minloc1_8_i1.c: Regenerated. +- * generated/minloc1_8_i16.c: Regenerated. +- * generated/minloc1_8_i2.c: Regenerated. +- * generated/minloc1_8_i4.c: Regenerated. +- * generated/minloc1_8_i8.c: Regenerated. +- * generated/minloc1_8_r10.c: Regenerated. +- * generated/minloc1_8_r16.c: Regenerated. +- * generated/minloc1_8_r4.c: Regenerated. +- * generated/minloc1_8_r8.c: Regenerated. +- * generated/minval_i1.c: Regenerated. +- * generated/minval_i16.c: Regenerated. +- * generated/minval_i2.c: Regenerated. +- * generated/minval_i4.c: Regenerated. +- * generated/minval_i8.c: Regenerated. +- * generated/minval_r10.c: Regenerated. +- * generated/minval_r16.c: Regenerated. +- * generated/minval_r4.c: Regenerated. +- * generated/minval_r8.c: Regenerated. +- * generated/norm2_r10.c: Regenerated. +- * generated/norm2_r16.c: Regenerated. +- * generated/norm2_r4.c: Regenerated. +- * generated/norm2_r8.c: Regenerated. +- * generated/parity_l1.c: Regenerated. +- * generated/parity_l16.c: Regenerated. +- * generated/parity_l2.c: Regenerated. +- * generated/parity_l4.c: Regenerated. +- * generated/parity_l8.c: Regenerated. +- * generated/product_c10.c: Regenerated. +- * generated/product_c16.c: Regenerated. +- * generated/product_c4.c: Regenerated. +- * generated/product_c8.c: Regenerated. +- * generated/product_i1.c: Regenerated. +- * generated/product_i16.c: Regenerated. +- * generated/product_i2.c: Regenerated. +- * generated/product_i4.c: Regenerated. +- * generated/product_i8.c: Regenerated. +- * generated/product_r10.c: Regenerated. +- * generated/product_r16.c: Regenerated. +- * generated/product_r4.c: Regenerated. +- * generated/product_r8.c: Regenerated. +- * generated/sum_c10.c: Regenerated. +- * generated/sum_c16.c: Regenerated. +- * generated/sum_c4.c: Regenerated. +- * generated/sum_c8.c: Regenerated. +- * generated/sum_i1.c: Regenerated. +- * generated/sum_i16.c: Regenerated. +- * generated/sum_i2.c: Regenerated. +- * generated/sum_i4.c: Regenerated. +- * generated/sum_i8.c: Regenerated. +- * generated/sum_r10.c: Regenerated. +- * generated/sum_r16.c: Regenerated. +- * generated/sum_r4.c: Regenerated. +- * generated/sum_r8.c: Regenerated. +- +-2017-03-05 Andre Vehreschild +- Alessandro Fanfarillo +- +- * caf/libcaf.h: Added prototypes and stat codes for failed and stopped +- images. +- * caf/single.c (void _gfortran_caf_fail_image): Add the routine. +- (int _gfortran_caf_image_status): Same. +- (_gfortran_caf_failed_images): Same. +- (_gfortran_caf_stopped_images): Same. +- +-2017-03-02 Thomas Koenig +- Jakub Jelinek +- +- * m4/matmul.m4 (matmul_'rtype_code`): Avoid +- race condition on storing function pointer. +- * generated/matmul_c10.c: Regenerated. +- * generated/matmul_c16.c: Regenerated. +- * generated/matmul_c4.c: Regenerated. +- * generated/matmul_c8.c: Regenerated. +- * generated/matmul_i1.c: Regenerated. +- * generated/matmul_i16.c: Regenerated. +- * generated/matmul_i2.c: Regenerated. +- * generated/matmul_i4.c: Regenerated. +- * generated/matmul_i8.c: Regenerated. +- * generated/matmul_r10.c: Regenerated. +- * generated/matmul_r16.c: Regenerated. +- * generated/matmul_r4.c: Regenerated. +- * generated/matmul_r8.c: Regenerated. +- +-2017-03-02 Thomas Koenig +- +- PR fortran/78379 +- * m4/matmul.m4: (matmul_'rtype_code`_avx2): Also generate for +- reals. Add fma to target options. +- (matmul_'rtype_code`): Call AVX2 only if FMA is available. +- * generated/matmul_c10.c: Regenerated. +- * generated/matmul_c16.c: Regenerated. +- * generated/matmul_c4.c: Regenerated. +- * generated/matmul_c8.c: Regenerated. +- * generated/matmul_i1.c: Regenerated. +- * generated/matmul_i16.c: Regenerated. +- * generated/matmul_i2.c: Regenerated. +- * generated/matmul_i4.c: Regenerated. +- * generated/matmul_i8.c: Regenerated. +- * generated/matmul_r10.c: Regenerated. +- * generated/matmul_r16.c: Regenerated. +- * generated/matmul_r4.c: Regenerated. +- * generated/matmul_r8.c: Regenerated. +- +-2017-02-27 Janne Blomqvist +- +- * intrinsics/random.c (getosrandom): Don't try to use rand_s on +- CYGWIN. +- +-2017-02-16 Paul Thomas +- +- PR fortran/79382 +- * io/transfer.c (check_dtio_proc): New function. +- (formatted_transfer_scalar_read): Use it. +- (formatted_transfer_scalar_write): ditto. +- +-2017-01-31 Steven G. Kargl +- +- PR fortran/79305 +- * c99_protos.h: Spell HAVE_EXPL correctly. +- * intrinsics/c99_functions.c: Ditto. +- +-2017-01-19 Uros Bizjak +- +- PR target/78478 +- * acinclude.m4: Include ../config/ax_check_define.m4 +- * configure.ac: Check if _SOFT_FLOAT is defined. +- * configure.host (i?86 | x86_64): Use fpu-generic when +- have_soft_float is set. +- * configure: Regenerate. +- +-2017-01-19 Jakub Jelinek +- +- PR target/79127 +- * acinclude.m4 (LIBGFOR_CHECK_AVX512F): Ensure the test clobbers +- some zmm16+ registers to verify they are handled by unwind info +- properly if needed. +- * configure: Regenerated. +- +-2017-01-17 Jakub Jelinek ++2020-01-17 Jerry DeLisle +=20 +- PR other/79046 +- * configure.ac: Add GCC_BASE_VER. +- * Makefile.am (gcc_version): Use @get_gcc_base_ver@ instead of cat to +- get version from BASE-VER file. +- * configure: Regenerated. +- * Makefile.in: Regenerated. ++ PR libfortran/93234 ++ * io/unit.c (set_internal_unit): Set round and sign flags ++ correctly. +=20 +-2017-01-13 Andre Vehreschild ++2020-01-17 Jerry DeLisle +=20 +- PR fortran/70696 +- * caf/single.c (_gfortran_caf_register): Allocate enough memory for +- the event counter. ++ PR libfortran/90374 ++ * io/format.c (parse_format_list): Zero width not allowed with ++ FMT_D. ++ * io/write_float.def (build_float_string): Include range of ++ higher exponent values that require wider width. +=20 +-2017-01-07 Andre Vehreschild ++2020-01-01 Jerry DeLisle +=20 +- PR fortran/78781 +- PR fortran/78935 +- * caf/single.c (send_by_ref): Fix addressing of non-allocatable scalar +- destination components. ++ PR libfortran/90374 ++ * io/format.c (parse_format_list): Implement the E0 exponent ++ width to provide smallest possible width for exponent fields. ++ Refactor code for correct parsing and better readability of the ++ code. ++ * io/io.h (write_real_w0): Change interface to pass in pointer ++ to fnode. ++ * io/transfer.c: Update all calls to write_real_w0 to use the ++ new interface. ++ * io/write.c ((write_real_w0): Use the new interface with fnode ++ to access both the decimal precision and exponent widths used in ++ build_float_string. ++ * io/write_float.def (build_float_string): Use the passed in ++ exponent width to calculate the used width in the case of E0. +=20 +-2017-01-01 Jakub Jelinek ++2020-01-01 Jakub Jelinek +=20 + Update copyright years. + +-Copyright (C) 2017 Free Software Foundation, Inc. ++Copyright (C) 2020 Free Software Foundation, Inc. +=20 + Copying and distribution of this file, with or without modification, + are permitted in any medium without royalty provided the copyright +diff --git a/libgfortran/Makefile.in b/libgfortran/Makefile.in +index 4914a6f323f..ba700a8002c 100644 +--- a/libgfortran/Makefile.in ++++ b/libgfortran/Makefile.in +@@ -133,6 +133,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/depsta= nd.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../config/acx.m4 \ +diff --git a/libgfortran/aclocal.m4 b/libgfortran/aclocal.m4 +index 015537ef197..58f0687d7a5 100644 +--- a/libgfortran/aclocal.m4 ++++ b/libgfortran/aclocal.m4 +@@ -1030,6 +1030,7 @@ m4_include([../config/lthostflags.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libgfortran/configure b/libgfortran/configure +index 1db8f5f5224..e28fa82d8d5 100755 +--- a/libgfortran/configure ++++ b/libgfortran/configure +@@ -771,6 +771,7 @@ enable_intermodule + enable_maintainer_mode + enable_multilib + enable_dependency_tracking ++with_toolexeclibdir + enable_symvers + with_gnu_ld + enable_shared +@@ -1436,6 +1437,9 @@ Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) + --with-build-libsubdir=3DDIR Directory where to find libraries for bui= ld system ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] +@@ -4927,6 +4931,22 @@ $as_echo "$ac_cv_safe_to_define___extensions__" >&6= ; } +=20 +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -4942,7 +4962,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -12421,7 +12448,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 12424 "configure" ++#line 12451 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -12527,7 +12554,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 12530 "configure" ++#line 12557 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libgfortran/configure.ac b/libgfortran/configure.ac +index 37b12d2998f..6dee8ef15b0 100644 +--- a/libgfortran/configure.ac ++++ b/libgfortran/configure.ac +@@ -87,6 +87,8 @@ fi +=20 + AC_USE_SYSTEM_EXTENSIONS +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -102,7 +104,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libgomp/ChangeLog b/libgomp/ChangeLog +index c34a9284081..b8fa7d457d8 100644 +--- a/libgomp/ChangeLog ++++ b/libgomp/ChangeLog +@@ -1,155 +1,4375 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * Makefile.in: Regenerate. ++ * aclocal.m4: Regenerate. ++ * configure: Regenerate. ++ * testsuite/Makefile.in: Regenerate. ++ ++2020-01-24 Frederik Harwath ++ ++ * testsuite/libgomp.oacc-c-c++-common/acc_get_property-aux.c ++ (expect_device_properties): Remove "expected_free_mem" argument, ++ change "expected_total_mem" argument type to size_t; ++ change types of acc_get_property results to size_t, ++ adapt format strings. ++ * testsuite/libgomp.oacc-c-c++-common/acc_get_property.c: ++ Use %zu instead of %zd to print size_t values. ++ * testsuite/libgomp.oacc-c-c++-common/acc_get_property-2.c: Adapt and ++ rename to ... ++ * testsuite/libgomp.oacc-c-c++-common/acc_get_property-nvptx.c: ... this. ++ * testsuite/libgomp.oacc-c-c++-common/acc_get_property-3.c: Adapt and ++ rename to ... ++ * testsuite/libgomp.oacc-c-c++-common/acc_get_property-host.c: ... this. ++ ++2020-01-23 Andrew Stubbs ++ ++ * plugin/plugin-gcn.c (parse_target_attributes): Use correct mask for ++ the device id. ++ ++2020-01-20 Andrew Stubbs ++ ++ * testsuite/libgomp.oacc-c-c++-common/loop-auto-1.c: Skip test on gcn. ++ * testsuite/libgomp.oacc-c-c++-common/loop-dim-default.c (main): ++ Adjust test dimensions for amdgcn. ++ * testsuite/libgomp.oacc-c-c++-common/loop-gwv-1.c (main): Adjust ++ gang/worker/vector expectations dynamically. ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-gwv-1.c ++ (main): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-v-1.c (main): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-v-2.c (main): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-w-1.c (main): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-w-2.c (main): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-wv-1.c (main): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/loop-v-1.c (main): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/loop-w-1.c (main): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/loop-wv-1.c (main): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/parallel-dims.c ++ (acc_gang): Recognise acc_device_radeon. ++ (acc_worker): Likewise. ++ (acc_vector): Likewise. ++ (main): Set expectations for amdgcn. ++ * testsuite/libgomp.oacc-c-c++-common/routine-gwv-1.c ++ (main): Adjust gang/worker/vector expectations dynamically. ++ * testsuite/libgomp.oacc-c-c++-common/routine-v-1.c (main): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/routine-w-1.c (main): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/routine-wv-1.c (main): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/routine-wv-2.c: Set expectations ++ for amdgcn. ++ ++2020-01-17 Andrew Stubbs ++ ++ * config/accel/openacc.f90 (openacc_kinds): Rename acc_device_gcn to ++ acc_device_radeon. ++ (openacc): Likewise. ++ * openacc.f90 (openacc_kinds): Likewise. ++ (openacc): Likewise. ++ * openacc.h (acc_device_t): Likewise. ++ * openacc_lib.h: Likewise. ++ * testsuite/lib/libgomp.exp ++ (check_effective_target_openacc_amdgcn_accel_present): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_prof-init-1.c ++ (cb_compute_construct_end): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_prof-kernels-1.c ++ (cb_enqueue_launch_start): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_prof-parallel-1.c ++ (cb_enter_data_end): Likewise. ++ (cb_exit_data_start): Likewise. ++ (cb_exit_data_end): Likewise. ++ (cb_compute_construct_end): Likewise. ++ (cb_enqueue_launch_start): Likewise. ++ (cb_enqueue_launch_end): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/asyncwait-nop-1.c ++ (main): Likewise. ++ ++2020-01-10 Thomas Schwinge ++ ++ * libgomp-plugin.h (enum goacc_property): New. Adjust all users ++ to use this instead of 'enum gomp_device_property'. ++ (GOMP_OFFLOAD_get_property): Rename to... ++ (GOMP_OFFLOAD_openacc_get_property): ... this. Adjust all users. ++ * libgomp.h (struct gomp_device_descr): Move ++ 'GOMP_OFFLOAD_openacc_get_property'... ++ (struct acc_dispatch_t): ... here. Adjust all users. ++ * plugin/plugin-hsa.c (GOMP_OFFLOAD_get_property): Remove. ++ ++ * target.c (gomp_map_vars_internal) ++ : Clean up/elaborate code ++ paths. ++ ++2020-01-10 Jakub Jelinek ++ ++ PR libgomp/93219 ++ * libgomp.h (gomp_print_string): Change return type from void to int. ++ * affinity-fmt.c (gomp_print_string): Likewise. Return true if ++ not all characters have been written. ++ ++2020-01-08 Tobias Burnus ++ ++ * libgomp.texi: Fix typos, use https. ++ ++2020-01-03 Tobias Burnus ++ ++ * testsuite/libgomp.fortran/optional-map.f90: Add test for ++ unallocated/disassociated actual arguments to nonallocatable/nonpointer ++ dummy arguments; those are/shall be regarded as absent arguments. ++ * testsuite/libgomp.fortran/use_device_ptr-optional-2.f90: Ditto. ++ * testsuite/libgomp.fortran/use_device_ptr-optional-3.f90: New. ++ ++2020-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++ * libgomp.texi: Bump @copying's copyright year. ++ ++2019-12-31 Ayush Mittal ++ ++ PR libgomp/93065 ++ * oacc-init.c (goacc_runtime_deinitialize): New function. ++ ++2019-12-28 Jakub Jelinek ++ ++ PR bootstrap/93074 ++ * plugin/cuda/cuda.h (cuDeviceGetName, cuDriverGetVersion): Declare. ++ (cuDeviceTotalMem, cuMemGetInfo): Likewise. Define to *_v2. ++ ++2019-12-22 Maciej W. Rozycki ++ Frederik Harwath ++ Thomas Schwinge ++ ++ * libgomp.h (gomp_device_descr): Add `get_property_func' member. ++ * libgomp-plugin.h (gomp_device_property_value): New union. ++ (gomp_device_property_value): New prototype. ++ * openacc.h (acc_device_t): Add `acc_device_current' enumeration ++ constant. ++ (acc_device_property_t): New enum. ++ (acc_get_property, acc_get_property_string): New prototypes. ++ * oacc-init.c (acc_get_device_type): Also assert that result ++ is not `acc_device_current'. ++ (get_property_any, acc_get_property, acc_get_property_string): ++ New functions. ++ * openacc.f90 (openacc_kinds): Add `acc_device_current' and ++ `acc_property_memory', `acc_property_free_memory', ++ `acc_property_name', `acc_property_vendor' and ++ `acc_property_driver' constants. Add `acc_device_property' data ++ type. ++ (openacc_internal): Add `acc_get_property' and ++ `acc_get_property_string' interfaces. Add `acc_get_property_h', ++ `acc_get_property_string_h', `acc_get_property_l' and ++ `acc_get_property_string_l'. ++ * oacc-host.c (host_get_property): New function. ++ (host_dispatch): Wire it. ++ * target.c (gomp_load_plugin_for_device): Handle `get_property'. ++ * libgomp.map (OACC_2.6): Add `acc_get_property', `acc_get_property_h_', ++ `acc_get_property_string' and `acc_get_property_string_h_' symbols. ++ * libgomp.texi (OpenACC Runtime Library Routines): Add ++ `acc_get_property'. ++ (acc_get_property): New node. ++ * plugin/plugin-gcn.c (GOMP_OFFLOAD_get_property): New ++ function (stub). ++ * plugin/plugin-hsa.c (GOMP_OFFLOAD_get_property): New function. ++ * plugin/plugin-nvptx.c (CUDA_CALLS): Add `cuDeviceGetName', ++ `cuDeviceTotalMem', `cuDriverGetVersion' and `cuMemGetInfo' ++ calls. ++ (GOMP_OFFLOAD_get_property): New function. ++ (struct ptx_device): Add new field "name". ++ (cuda_driver_version_s): Add new static variable ... ++ (nvptx_init): ... and init from here. ++ ++ * testsuite/libgomp.oacc-c-c++-common/acc_get_property.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/acc_get_property-2.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/acc_get_property-3.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/acc_get_property-aux.c: New file ++ with test helper functions. ++ ++ * testsuite/libgomp.oacc-fortran/acc_get_property.f90: New test. ++ ++2019-12-22 Maciej W. Rozycki ++ ++ * testsuite/libgomp-test-support.exp.in (GCC_UNDER_TEST): New ++ variable. ++ ++2019-12-21 Thomas Schwinge ++ ++ * target.c (gomp_map_vars_internal): Restore 'omp declare target ++ link' handling. ++ ++2019-12-19 Julian Brown ++ ++ * testsuite/libgomp.oacc-fortran/class-ptr-param.f95: New test. ++ * testsuite/libgomp.oacc-fortran/classtypes-1.f95: New test. ++ * testsuite/libgomp.oacc-fortran/classtypes-2.f95: New test. ++ ++2019-12-19 Julian Brown ++ Cesar Philippidis ++ ++ * testsuite/libgomp.oacc-fortran/deep-copy-1.f90: New test. ++ * testsuite/libgomp.oacc-fortran/deep-copy-2.f90: New test. ++ * testsuite/libgomp.oacc-fortran/deep-copy-3.f90: New test. ++ * testsuite/libgomp.oacc-fortran/deep-copy-4.f90: New test. ++ * testsuite/libgomp.oacc-fortran/deep-copy-5.f90: New test. ++ * testsuite/libgomp.oacc-fortran/deep-copy-6.f90: New test. ++ * testsuite/libgomp.oacc-fortran/deep-copy-7.f90: New test. ++ * testsuite/libgomp.oacc-fortran/deep-copy-8.f90: New test. ++ * testsuite/libgomp.oacc-fortran/derived-type-1.f90: New test. ++ * testsuite/libgomp.oacc-fortran/derivedtype-1.f95: New test. ++ * testsuite/libgomp.oacc-fortran/derivedtype-2.f95: New test. ++ * testsuite/libgomp.oacc-fortran/multidim-slice.f95: New test. ++ * testsuite/libgomp.oacc-fortran/update-2.f90: New test. ++ ++2019-12-19 Julian Brown ++ ++ * testsuite/libgomp.oacc-c-c++-common/deep-copy-1.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/deep-copy-2.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/deep-copy-4.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/deep-copy-6.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/deep-copy-7.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/deep-copy-8.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/deep-copy-9.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/deep-copy-10.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/deep-copy-11.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/deep-copy-14.c: New test. ++ * testsuite/libgomp.oacc-c++/deep-copy-12.C: New test. ++ * testsuite/libgomp.oacc-c++/deep-copy-13.C: New test. ++ ++2019-12-19 Julian Brown ++ ++ * libgomp.h (struct target_var_desc): Add do_detach flag. ++ * oacc-init.c (acc_shutdown_1): Free aux block if present. ++ * oacc-mem.c (find_group_last): Add SIZES parameter. Support ++ struct components. Tidy up and add some new checks. ++ (goacc_enter_data_internal): Update call to find_group_last. ++ (goacc_exit_data_internal): Support detach operations and ++ GOMP_MAP_STRUCT. ++ (GOACC_enter_exit_data): Handle initial GOMP_MAP_STRUCT or ++ GOMP_MAP_FORCE_PRESENT in finalization detection code. Handle ++ attach/detach in enter/exit data detection code. ++ * target.c (gomp_map_vars_existing): Initialise do_detach field of ++ tgt_var_desc. ++ (gomp_map_vars_internal): Support attach. ++ (gomp_unmap_vars_internal): Support detach. ++ ++2019-12-19 Julian Brown ++ Thomas Schwinge ++ ++ * libgomp.h (struct splay_tree_aux): Add attach_count field. ++ (gomp_attach_pointer, gomp_detach_pointer): Add prototypes. ++ * libgomp.map (OACC_2.6): New section. Add acc_attach, ++ acc_attach_async, acc_detach, acc_detach_async, acc_detach_finalize, ++ acc_detach_finalize_async. ++ * oacc-mem.c (acc_attach_async, acc_attach, goacc_detach_internal, ++ acc_detach, acc_detach_async, acc_detach_finalize, ++ acc_detach_finalize_async): New functions. ++ * openacc.h (acc_attach, acc_attach_async, acc_detach, ++ (acc_detach_async, acc_detach_finalize, acc_detach_finalize_async): Add ++ prototypes. ++ * target.c (gomp_attach_pointer, gomp_detach_pointer): New functions. ++ (gomp_remove_var_internal): Free attachment counts if present. ++ * testsuite/libgomp.oacc-c-c++-common/deep-copy-3.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/deep-copy-5.c: New test. ++ ++2019-12-19 Julian Brown ++ Cesar Philippidis ++ ++ * libgomp.h (gomp_map_val): Add prototype. ++ * oacc-parallel.c (GOACC_parallel_keyed): Use gomp_map_val instead of ++ open-coding device-address calculation. ++ * target.c (gomp_map_val): Make global. Use OFFSET_POINTER in ++ non-present case. ++ ++2019-12-19 Julian Brown ++ ++ * libgomp.h (struct splay_tree_key_s): Substitute dynamic_refcount ++ field for virtual_refcount. ++ (enum gomp_map_vars_kind): Add GOMP_MAP_VARS_OPENACC_ENTER_DATA. ++ (gomp_free_memmap): Remove prototype. ++ * oacc-init.c (acc_shutdown_1): Iteratively call gomp_remove_var ++ instead of calling gomp_free_memmap. ++ * oacc-mem.c (acc_map_data): Use virtual_refcount instead of ++ dynamic_refcount. ++ (acc_unmap_data): Open code instead of forcing target_mem_desc's ++ to_free field to NULL then calling gomp_unmap_vars. Handle ++ REFCOUNT_INFINITY on target blocks. ++ (goacc_enter_data): Rename to... ++ (goacc_enter_datum): ...this. Remove MAPNUM parameter and special ++ handling for mapping groups. Use virtual_refcount instead of ++ dynamic_refcount. Use GOMP_MAP_VARS_OPENACC_ENTER_DATA for ++ map_map_vars_async call. Re-do lookup for target pointer return value. ++ (acc_create, acc_create_async, acc_copyin, acc_copyin_async): Call ++ renamed goacc_enter_datum function. ++ (goacc_exit_data): Rename to... ++ (goacc_exit_datum): ...this. Update for virtual_refcount semantics. ++ (acc_delete, acc_delete_async, acc_delete_finalize, ++ acc_delete_finalize_async, acc_copyout, acc_copyout_async, ++ acc_copyout_finalize, acc_copyout_finalize_async): Call renamed ++ goacc_exit_datum function. ++ (gomp_acc_remove_pointer, find_pointer): Remove functions. ++ (find_group_last, goacc_enter_data_internal, goacc_exit_data_internal): ++ New functions. ++ (GOACC_enter_exit_data): Use goacc_enter_data_internal and ++ goacc_exit_data_internal helper functions. ++ * target.c (gomp_map_vars_internal): Handle ++ GOMP_MAP_VARS_OPENACC_ENTER_DATA. Update for virtual_refcount ++ semantics. ++ (gomp_unmap_vars_internal): Update for virtual_refcount semantics. ++ (gomp_load_image_to_device, omp_target_associate_ptr): Zero-initialise ++ virtual_refcount field instead of dynamic_refcount. ++ (gomp_free_memmap): Remove function. ++ * testsuite/libgomp.oacc-c-c++-common/unmap-infinity-1.c: New test. ++ * testsuite/libgomp.c-c++-common/unmap-infinity-2.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/pr92843-1.c: Add XFAIL. ++ ++2019-12-19 Julian Brown ++ Thomas Schwinge ++ ++ * libgomp.h (struct splay_tree_aux): New. ++ (struct splay_tree_key_s): Replace link_key field with aux pointer. ++ * target.c (gomp_map_vars_internal): Adjust for link_key being moved ++ to aux struct. ++ (gomp_remove_var_internal): Free aux block if present. ++ (gomp_load_image_to_device): Zero-initialise aux field instead of ++ link_key field. ++ (omp_target_associate_pointer): Zero-initialise aux field. ++ ++2019-12-18 Jakub Jelinek ++ ++ PR middle-end/86416 ++ * testsuite/libgomp.c/pr86416-1.c (main): Use L suffixes rather than ++ q or none. ++ * testsuite/libgomp.c/pr86416-2.c (main): Use Q suffixes rather than ++ L or none. ++ ++2019-12-19 Julian Brown ++ Maciej W. Rozycki ++ Tobias Burnus ++ Thomas Schwinge ++ ++ * target.c (gomp_map_vars_async): Support GOMP_MAP_NO_ALLOC. ++ * testsuite/libgomp.oacc-c-c++-common/no_create-1.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/no_create-2.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/no_create-3.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/no_create-4.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/no_create-5.c: New test. ++ * testsuite/libgomp.oacc-fortran/no_create-1.f90: New test. ++ * testsuite/libgomp.oacc-fortran/no_create-2.f90: New test. ++ * testsuite/libgomp.oacc-fortran/no_create-3.F90: New test. ++ ++2019-12-18 Thomas Schwinge ++ ++ * oacc-mem.c (goacc_enter_data): Refactor, so that it can be ++ called... ++ (goacc_insert_pointer): ... from here, "present" case. ++ (goacc_insert_pointer): Inline function into... ++ (GOACC_enter_exit_data): ... here, and simplify. ++ ++ * oacc-mem.c (goacc_enter_data): Refactor, so that it can be ++ called... ++ (goacc_insert_pointer): ... from here, "not present" case. ++ ++ * oacc-mem.c (goacc_remove_pointer): Refactor interface. Adjust ++ all users. ++ ++ * oacc-mem.c (GOACC_enter_exit_data): Refactor code to call ++ 'goacc_enter_data', 'goacc_exit_data'. ++ ++ * oacc-mem.c (delete_copyout): Refactor into... ++ (goacc_exit_data): ... this. Adjust all users. ++ ++ * oacc-mem.c (present_create_copy): Refactor into... ++ (goacc_enter_data): ... this. Adjust all users. ++ ++ * target.c (gomp_unmap_vars_internal): Add a safeguard to ++ 'gomp_remove_var'. ++ ++ * target.c (gomp_to_device_kind_p): Handle 'GOMP_MAP_FORCE_FROM' ++ like 'GOMP_MAP_FROM'. ++ ++ PR libgomp/92726 ++ PR libgomp/92970 ++ PR libgomp/92984 ++ * oacc-mem.c (delete_copyout): No-op behavior if 'lookup_host' ++ fails. ++ (GOACC_enter_exit_data): Simplify accordingly. ++ * testsuite/libgomp.oacc-c-c++-common/pr92970-1.c: New file, ++ subsuming... ++ * testsuite/libgomp.oacc-c-c++-common/lib-17.c: ... this file... ++ * testsuite/libgomp.oacc-c-c++-common/lib-18.c: ..., and this ++ file. ++ * testsuite/libgomp.oacc-c-c++-common/pr92984-1.c: New file, ++ subsuming... ++ * testsuite/libgomp.oacc-c-c++-common/lib-21.c: ... this file... ++ * testsuite/libgomp.oacc-c-c++-common/lib-29.c: ..., and this ++ file. ++ * testsuite/libgomp.oacc-c-c++-common/pr92726-1.c: New file, ++ subsuming... ++ * testsuite/libgomp.oacc-c-c++-common/lib-28.c: ... this file. ++ ++ * oacc-mem.c (GOACC_enter_exit_data): Simplify 'exit data' ++ 'finalize' handling. ++ ++ PR libgomp/92848 ++ * oacc-mem.c (acc_map_data, present_create_copy) ++ (goacc_insert_pointer): Use 'GOMP_MAP_VARS_ENTER_DATA'. ++ (acc_unmap_data, delete_copyout, goacc_remove_pointer): Adjust. ++ * testsuite/libgomp.oacc-c-c++-common/lib-50.c: Remove. ++ * testsuite/libgomp.oacc-c-c++-common/pr92848-1-d-a.c: New file ++ * testsuite/libgomp.oacc-c-c++-common/pr92848-1-d-p.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/pr92848-1-r-a.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/pr92848-1-r-p.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/subset-subarray-mappings-1-r-p.c: ++ Remove "XFAIL"s. ++ ++ * target.c (gomp_unmap_tgt): Make it 'static'. ++ * libgomp.h (gomp_unmap_tgt): Remove. ++ ++2019-12-18 Tobias Burnus ++ ++ PR middle-end/86416 ++ * testsuite/libgomp.c/pr86416-1.c: New. ++ * testsuite/libgomp.c/pr86416-2.c: New. ++ ++2019-12-17 Tobias Burnus ++ ++ * config/accel/openacc.f90 (module openacc_kinds): Use 'PUBLIC' to mark ++ all symbols as public except for the 'use =E2=80=A6, only' imported symb= ol, ++ which is private. ++ (module openacc): Default to 'PRIVATE' to exclude openacc_internal; mark ++ all symbols from module openacc_kinds as PUBLIC ++ * openacc.f90: Add comment with crossref to that file and openmp_lib.h; ++ fix comment typo. ++ * openacc_lib.h (acc_device_gcn): Add this PARAMETER. ++ ++2019-12-13 Julian Brown ++ ++ PR libgomp/92881 ++ ++ * libgomp.h (gomp_remove_var_async): Add prototype. ++ * oacc-mem.c (delete_copyout): Call gomp_remove_var_async instead of ++ gomp_remove_var. ++ * target.c (gomp_unref_tgt): Change return type to bool, indicating ++ whether target_mem_desc was unmapped. ++ (gomp_unref_tgt_void): New. ++ (gomp_remove_var): Reimplement in terms of... ++ (gomp_remove_var_internal): ...this new helper function. ++ (gomp_remove_var_async): New, implemented using above helper function. ++ (gomp_unmap_vars_internal): Use gomp_unref_tgt_void instead of ++ gomp_unref_tgt. ++ ++2019-12-13 Andrew Stubbs ++ ++ * testsuite/libgomp.oacc-c-c++-common/acc_prof-init-1.c: Handle gcn. ++ * testsuite/libgomp.oacc-c-c++-common/acc_prof-kernels-1.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_prof-parallel-1.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/asyncwait-nop-1.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/function-not-offloaded.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/async_queue-1.c: Disable on GCN. ++ * testsuite/libgomp.oacc-c-c++-common/tile-1.c: Likewise. ++ ++2019-12-13 Tobias Burnus ++ ++ * openacc.f90 (module openacc_kinds): Use 'PUBLIC' to mark all symbols ++ as public except for the 'use =E2=80=A6, only' imported symbol, which is ++ private. ++ (module openacc): Default to 'PRIVATE' to exclude openacc_internal; mark ++ all symbols from module openacc_kinds as PUBLIC; add missing PUBLIC ++ attributes for acc_copyout_finalize and acc_delete_finalize. ++ ++2019-12-11 Jakub Jelinek ++ ++ PR fortran/92899 ++ * testsuite/libgomp.fortran/atomic1.f90: New test. ++ ++2019-12-11 Thomas Schwinge ++ ++ PR libgomp/92843 ++ * oacc-mem.c (present_create_copy, delete_copyout): Fix dynamic ++ reference counting for structured 'REFCOUNT_INFINITY'. Add some ++ assertions. ++ (goacc_insert_pointer, goacc_remove_pointer): Adjust accordingly. ++ * testsuite/libgomp.oacc-c-c++-common/pr92843-1.c: New file. ++ * testsuite/libgomp.oacc-c-c++-common/clauses-1.c: Fix OpenACC. ++ * testsuite/libgomp.oacc-c-c++-common/lib-82.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/nested-1.c: Likewise. ++ ++ * oacc-parallel.c (find_pointer, GOACC_enter_exit_data): Move... ++ * oacc-mem.c: ... here. ++ (gomp_acc_insert_pointer, gomp_acc_remove_pointer): Rename to ++ 'goacc_insert_pointer', 'goacc_remove_pointer', and make 'static'. ++ * libgomp.h (gomp_acc_insert_pointer, gomp_acc_remove_pointer): ++ Remove. ++ * libgomp_g.h: Update. ++ ++ * oacc-parallel.c (GOACC_wait, goacc_wait): Move... ++ * oacc-async.c: ... here. ++ * oacc-int.h (goacc_wait): Declare. ++ * libgomp_g.h: Update ++ ++ PR libgomp/92854 ++ * testsuite/libgomp.oacc-c-c++-common/acc_map_data-device_already-1.c: ++ New file. ++ * testsuite/libgomp.oacc-c-c++-common/acc_map_data-device_already-2.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_map_data-device_already-3.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_map_data-host_already-1.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_map_data-host_already-2.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_map_data-host_already-3.c: ++ Likewise. ++ ++2019-12-11 Thomas Schwinge ++ Julian Brown ++ ++ * target.c (gomp_load_image_to_device, omp_target_associate_ptr): ++ Initialize 'dynamic_refcount' whenever we initialize 'refcount'. ++ ++2019-12-11 Tobias Burnus ++ ++ * omp_lib.h.in: Fix spelling of function declaration ++ omp_get_cancell(l)ation. ++ * libgomp.texi (acc_is_present, acc_async_test, acc_async_test_all): ++ Fix typos. ++ * env.c: Fix comment typos. ++ * oacc-host.c: Likewise. ++ * ordered.c: Likewise. ++ * task.c: Likewise. ++ * team.c: Likewise. ++ * config/gcn/task.c: Likewise. ++ * config/gcn/team.c: Likewise. ++ * config/nvptx/task.c: Likewise. ++ * config/nvptx/team.c: Likewise. ++ * plugin/plugin-gcn.c: Likewise. ++ * testsuite/libgomp.fortran/jacobi.f: Likewise. ++ * testsuite/libgomp.hsa.c/tiling-2.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/enter_exit-lib.c: Likewise. ++ ++2019-12-11 Tobias Burnus ++ ++ * testsuite/libgomp.oacc-fortran/optional-cache.f95: Add 'dg-do run'. ++ * testsuite/libgomp.oacc-fortran/optional-reduction.f90: Remove ++ unnecessary 'dg-additional-options "-w"'. ++ ++2019-12-09 Thomas Schwinge ++ Julian Brown ++ ++ PR libgomp/92116 ++ PR libgomp/92877 ++ ++ * oacc-mem.c (lookup_dev): Reimplement. Adjust all users. ++ * libgomp.h (struct acc_dispatch_t): Remove 'data_environ' member. ++ Adjust all users. ++ * testsuite/libgomp.oacc-c-c++-common/acc_free-pr92503-4-2.c: ++ Remove XFAIL. ++ * testsuite/libgomp.oacc-c-c++-common/acc_free-pr92503-4.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/pr92877-1.c: New file. ++ ++2019-12-09 Thomas Schwinge ++ ++ PR libgomp/92503 ++ * oacc-mem.c (acc_free): Error out instead of 'acc_unmap_data'. ++ * testsuite/libgomp.oacc-c-c++-common/acc_free-pr92503-1.c: New ++ file. ++ * testsuite/libgomp.oacc-c-c++-common/acc_free-pr92503-2.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_free-pr92503-3-2.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_free-pr92503-3.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_free-pr92503-4-2.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_free-pr92503-4.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/clauses-1.c: Adjust. ++ * testsuite/libgomp.oacc-c-c++-common/context-1.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/context-2.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/context-3.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/context-4.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/lib-13.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/lib-14.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/lib-18.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/lib-91.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/nested-1.c: Likewise. ++ ++ PR libgomp/92840 ++ * oacc-mem.c (acc_map_data): Clarify reference counting behavior. ++ (acc_unmap_data): Add error case for 'REFCOUNT_INFINITY'. ++ * testsuite/libgomp.oacc-c-c++-common/acc_unmap_data-pr92840-1.c: ++ New file. ++ * testsuite/libgomp.oacc-c-c++-common/acc_unmap_data-pr92840-2.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_unmap_data-pr92840-3.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/clauses-1.c: Adjust. ++ * testsuite/libgomp.oacc-c-c++-common/nested-1.c: Adjust. ++ ++ PR libgomp/92511 ++ * testsuite/libgomp.oacc-c-c++-common/copyin-devptr-1.c: Remove ++ this file... ++ * testsuite/libgomp.oacc-c-c++-common/copyin-devptr-2.c: ..., and ++ this file... ++ * testsuite/libgomp.oacc-c-c++-common/lib-22.c: ..., and this ++ file... ++ * testsuite/libgomp.oacc-c-c++-common/lib-30.c: ..., and this ++ file... ++ * testsuite/libgomp.oacc-c-c++-common/subset-subarray-mappings-1-r-p.c: ++ ... with their content moved into, and extended in this new file. ++ * testsuite/libgomp.oacc-c-c++-common/subset-subarray-mappings-1-d-a.c: ++ New file. ++ * testsuite/libgomp.oacc-c-c++-common/subset-subarray-mappings-1-d-p.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/subset-subarray-mappings-1-r-a.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/subset-subarray-mappings-2.c: ++ Likewise. ++ ++ * testsuite/libgomp.oacc-c-c++-common/map-data-1.c: New file. ++ ++ PR libgomp/92854 ++ * testsuite/libgomp.oacc-c-c++-common/pr92854-1.c: New file. ++ ++ * testsuite/libgomp.oacc-c-c++-common/host_data-6.c: New file. ++ ++ * target.c (gomp_exit_data): Use 'gomp_remove_var'. ++ ++2019-12-09 Tobias Burnus ++ ++ * testsuite/libgomp.fortran/use_device_addr-3.f90: Make 'stop' codes ++ unique. ++ * testsuite/libgomp.fortran/use_device_addr-4.f90: Ditto. ++ * testsuite/libgomp.fortran/use_device_ptr-optional-2.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/declare-5.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/optional-data-copyin-by-value.f90: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/optional-firstprivate.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/optional-update-host.f90: Ditto. ++ ++2019-12-06 Kwok Cheung Yeung ++ ++ * config/accel/proc.c (omp_get_num_procs): Apply ialias macro. ++ ++2019-12-06 Tobias Burnus ++ Kwok Cheung Yeung ++ ++ * oacc-mem.c (update_dev_host, gomp_acc_insert_pointer): Just return ++ if input it a NULL pointer. ++ * testsuite/libgomp.oacc-c-c++-common/lib-43.c: Remove; dependent on ++ diagnostic of NULL pointer. ++ * testsuite/libgomp.oacc-c-c++-common/lib-47.c: Ditto. ++ * testsuite/libgomp.fortran/optional-map.f90: New. ++ * testsuite/libgomp.fortran/use_device_addr-1.f90 ++ (test_dummy_opt_callee_1_absent): New. ++ (test_dummy_opt_call_1): Call it. ++ * testsuite/libgomp.fortran/use_device_addr-2.f90: Likewise. ++ * testsuite/libgomp.fortran/use_device_addr-3.f90: Likewise. ++ * testsuite/libgomp.fortran/use_device_addr-4.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/optional-cache.f95: New. ++ * testsuite/libgomp.oacc-fortran/optional-data-copyin-by-value.f90: New. ++ * testsuite/libgomp.oacc-fortran/optional-data-copyin.f90: New. ++ * testsuite/libgomp.oacc-fortran/optional-data-copyout.f90: New. ++ * testsuite/libgomp.oacc-fortran/optional-data-enter-exit.f90: New. ++ * testsuite/libgomp.oacc-fortran/optional-declare.f90: New. ++ * testsuite/libgomp.oacc-fortran/optional-firstprivate.f90: New. ++ * testsuite/libgomp.oacc-fortran/optional-host_data.f90: New. ++ * testsuite/libgomp.oacc-fortran/optional-nested-calls.f90: New. ++ * testsuite/libgomp.oacc-fortran/optional-private.f90: New. ++ * testsuite/libgomp.oacc-fortran/optional-reduction.f90: New. ++ * testsuite/libgomp.oacc-fortran/optional-update-device.f90: New. ++ * testsuite/libgomp.oacc-fortran/optional-update-host.f90: New. ++ ++2019-12-05 Tobias Burnus ++ ++ * testsuite/libgomp.oacc-fortran/error_stop-1.f: Also don't ++ expect dg-output of 'Error termination.' for GCN. ++ * testsuite/libgomp.oacc-fortran/error_stop-2.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/error_stop-3.f: Likewise. ++ ++2019-12-04 Jakub Jelinek ++ ++ PR fortran/92756 ++ * testsuite/libgomp.fortran/teams1.f90: New test. ++ * testsuite/libgomp.fortran/teams2.f90: New test. ++ ++2019-12-03 Frederik Harwath ++ ++ * oacc-init.c (acc_known_device_type): Add function. ++ (unknown_device_type_error): Add function. ++ (name_of_acc_device_t): Change to call unknown_device_type_error ++ on unknown type. ++ (resolve_device): Use acc_known_device_type. ++ (acc_init): Fail if acc_device_t argument is not valid. ++ (acc_shutdown): Likewise. ++ (acc_get_num_devices): Likewise. ++ (acc_set_device_type): Likewise. ++ (acc_get_device_num): Likewise. ++ (acc_set_device_num): Likewise. ++ (acc_on_device): Add comment that argument validity is not checked. ++ ++2019-12-03 Andrew Stubbs ++ ++ * testsuite/lib/libgomp.exp (offload_target_to_openacc_device_type): ++ Recognize amdgcn. ++ (check_effective_target_openacc_amdgcn_accel_present): New proc. ++ (check_effective_target_openacc_amdgcn_accel_selected): New proc. ++ * testsuite/libgomp.oacc-c++/c++.exp: Add support for amdgcn. ++ * testsuite/libgomp.oacc-c/c.exp: Likewise. ++ * testsuite/libgomp.oacc-fortran/fortran.exp: Likewise. ++ ++2019-12-03 Szabolcs Nagy ++ ++ PR libgomp/91938 ++ * configure.tgt: Avoid IE tls on *-*-musl*. ++ ++2019-11-29 Tobias Burnus ++ ++ * testsuite/libgomp.oacc-fortran/declare-5.f90: Extend by ++ adding a common-block test case. ++ ++2019-11-29 Jakub Jelinek ++ ++ PR c++/60228 ++ * testsuite/libgomp.c++/udr-20.C: New test. ++ * testsuite/libgomp.c++/udr-21.C: New test. ++ ++2019-11-27 Thomas Schwinge ++ ++ * testsuite/lib/libgomp.exp ++ (check_effective_target_offload_target_nvptx): New proc. ++ * testsuite/libgomp.fortran/target-print-1.f90: Use it with ++ 'dg-skip-if'. ++ * testsuite/libgomp.oacc-fortran/print-1.f90: Likewise. ++ * testsuite/libgomp.fortran/target-print-1-nvptx.f90: New file. ++ * testsuite/libgomp.oacc-fortran/print-1-nvptx.f90: Likewise. ++ ++2019-11-21 Rainer Orth ++ ++ * testsuite/libgomp.c/pr39591-1.c: Rename err to e. ++ * testsuite/libgomp.c/pr39591-2.c: Likewise. ++ * testsuite/libgomp.c/pr39591-3.c: Likewise. ++ * testsuite/libgomp.c/private-1.c: Likewise. ++ * testsuite/libgomp.c/task-1.c: Likewise. ++ * testsuite/libgomp.c/task-5.c: Renamed err to serr. ++ ++2019-11-20 Julian Brown ++ ++ * plugin/plugin-gcn.c (wait_for_queue_nonfull): Don't lock/unlock ++ aq->mutex here. ++ (queue_push_launch): Lock aq->mutex before calling ++ wait_for_queue_nonfull. ++ (queue_push_callback): Likewise. ++ (queue_push_asyncwait): Likewise. ++ (queue_push_placeholder): Likewise. ++ ++2019-11-20 Julian Brown ++ ++ * plugin/plugin-gcn.c (hsa_memory_copy_wrapper): New. ++ (copy_data, GOMP_OFFLOAD_host2dev): Use above function. ++ (GOMP_OFFLOAD_dev2host, GOMP_OFFLOAD_dev2dev): Check hsa_memory_copy ++ return code. ++ ++2019-11-20 Julian Brown ++ ++ PR libgomp/92511 ++ ++ * oacc-mem.c (present_create_copy): Fix device pointer return value in ++ case of "present" subarray. Use tgt->tgt_start instead of tgt->to_free ++ in non-present/create case. ++ (delete_copyout): Change error condition to fail only on copies outside ++ of mapped block. Adjust error message accordingly. ++ * testsuite/libgomp.oacc-c-c++-common/copyin-devptr-1.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/copyin-devptr-2.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/lib-20.c: Adjust expected error ++ message. ++ * testsuite/libgomp.oacc-c-c++-common/lib-23.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/lib-22.c: Allow test to pass now. ++ * testsuite/libgomp.oacc-c-c++-common/lib-30.c: Likewise. ++ ++2019-11-20 Maciej W. Rozycki ++ ++ * testsuite/lib/libgomp.exp (libgomp_init): Add flags to find ++ libatomic in build-tree testing. ++ ++2019-11-18 Maciej W. Rozycki ++ ++ * testsuite/Makefile.in: Regenerate. ++ ++2019-11-15 Andrew Stubbs ++ ++ * testsuite/libgomp.c/target-print-1.c: New file. ++ * testsuite/libgomp.fortran/target-print-1.f90: New file. ++ * testsuite/libgomp.oacc-c/print-1.c: New file. ++ * testsuite/libgomp.oacc-fortran/print-1.f90: New file. ++ ++2019-11-13 Andrew Stubbs ++ Kwok Cheung Yeung ++ Julian Brown ++ Tom de Vries ++ ++ * plugin/Makefrag.am: Add amdgcn plugin support. ++ * plugin/configfrag.ac: Likewise. ++ * plugin/plugin-gcn.c: New file. ++ * configure: Regenerate. ++ * Makefile.in: Regenerate. ++ * testsuite/Makefile.in: Regenerate. ++ ++2019-11-13 Andrew Stubbs ++ ++ * config/gcn/team.c (gomp_gcn_enter_kernel): Set up the team arena ++ and use team_malloc variants. ++ (gomp_gcn_exit_kernel): Use team_free. ++ * libgomp.h (TEAM_ARENA_SIZE): Define. ++ (TEAM_ARENA_START): Define. ++ (TEAM_ARENA_FREE): Define. ++ (TEAM_ARENA_END): Define. ++ (team_malloc): New function. ++ (team_malloc_cleared): New function. ++ (team_free): New function. ++ * team.c (gomp_new_team): Initialize and use team_malloc. ++ (free_team): Use team_free. ++ (gomp_free_thread): Use team_free. ++ (gomp_pause_host): Use team_free. ++ * work.c (gomp_init_work_share): Use team_malloc. ++ (gomp_fini_work_share): Use team_free. ++ ++2019-11-13 Andrew Stubbs ++ Kwok Cheung Yeung ++ Julian Brown ++ Tom de Vries ++ ++ * Makefile.am (libgomp_la_SOURCES): Add oacc-target.c. ++ * Makefile.in: Regenerate. ++ * config.h.in (PLUGIN_GCN): Add new undef. ++ * config/accel/openacc.f90 (acc_device_gcn): New parameter. ++ * config/gcn/affinity-fmt.c: New file. ++ * config/gcn/bar.c: New file. ++ * config/gcn/bar.h: New file. ++ * config/gcn/doacross.h: New file. ++ * config/gcn/icv-device.c: New file. ++ * config/gcn/oacc-target.c: New file. ++ * config/gcn/simple-bar.h: New file. ++ * config/gcn/target.c: New file. ++ * config/gcn/task.c: New file. ++ * config/gcn/team.c: New file. ++ * config/gcn/time.c: New file. ++ * configure.ac: Add amdgcn*-*-*. ++ * configure: Regenerate. ++ * configure.tgt: Add amdgcn*-*-*. ++ * libgomp-plugin.h (offload_target_type): Add OFFLOAD_TARGET_TYPE_GCN. ++ * libgomp.h (gcn_thrs): Add amdgcn variant. ++ (set_gcn_thrs): Likewise. ++ (gomp_thread): Likewise. ++ * oacc-int.h (goacc_thread): Likewise. ++ * oacc-target.c: New file. ++ * openacc.f90 (acc_device_gcn): New parameter. ++ * openacc.h (acc_device_t): Add acc_device_gcn. ++ * team.c (gomp_free_pool_helper): Add amdgcn support. ++ ++2019-11-13 Andrew Stubbs ++ Julian Brown ++ ++ * libgomp-plugin.h (GOMP_OFFLOAD_openacc_async_construct): Add int ++ parameter. ++ * oacc-async.c (lookup_goacc_asyncqueue): Pass device number to the ++ queue constructor. ++ * oacc-host.c (host_openacc_async_construct): Add device parameter. ++ * plugin/plugin-nvptx.c (GOMP_OFFLOAD_openacc_async_construct): Add ++ device parameter. ++ ++2019-11-13 Andrew Stubbs ++ ++ * configure.tgt (nvptx*-*-*): Add "accel" directory. ++ * config/nvptx/libgomp-plugin.c: Move ... ++ * config/accel/libgomp-plugin.c: ... to here. ++ * config/nvptx/lock.c: Move ... ++ * config/accel/lock.c: ... to here. ++ * config/nvptx/mutex.c: Move ... ++ * config/accel/mutex.c: ... to here. ++ * config/nvptx/mutex.h: Move ... ++ * config/accel/mutex.h: ... to here. ++ * config/nvptx/oacc-async.c: Move ... ++ * config/accel/oacc-async.c: ... to here. ++ * config/nvptx/oacc-cuda.c: Move ... ++ * config/accel/oacc-cuda.c: ... to here. ++ * config/nvptx/oacc-host.c: Move ... ++ * config/accel/oacc-host.c: ... to here. ++ * config/nvptx/oacc-init.c: Move ... ++ * config/accel/oacc-init.c: ... to here. ++ * config/nvptx/oacc-mem.c: Move ... ++ * config/accel/oacc-mem.c: ... to here. ++ * config/nvptx/oacc-plugin.c: Move ... ++ * config/accel/oacc-plugin.c: ... to here. ++ * config/nvptx/omp-lock.h: Move ... ++ * config/accel/omp-lock.h: ... to here. ++ * config/nvptx/openacc.f90: Move ... ++ * config/accel/openacc.f90: ... to here. ++ * config/nvptx/pool.h: Move ... ++ * config/accel/pool.h: ... to here. ++ * config/nvptx/proc.c: Move ... ++ * config/accel/proc.c: ... to here. ++ * config/nvptx/ptrlock.c: Move ... ++ * config/accel/ptrlock.c: ... to here. ++ * config/nvptx/ptrlock.h: Move ... ++ * config/accel/ptrlock.h: ... to here. ++ * config/nvptx/sem.c: Move ... ++ * config/accel/sem.c: ... to here. ++ * config/nvptx/sem.h: Move ... ++ * config/accel/sem.h: ... to here. ++ * config/nvptx/thread-stacksize.h: Move ... ++ * config/accel/thread-stacksize.h: ... to here. ++ ++2019-11-12 Maciej W. Rozycki ++ Tobias Burnus ++ Frederik Harwath ++ Thomas Schwinge ++ ++ libgomp/ ++ * testsuite/libgomp.oacc-c-c++-common/parallel-dims.c: New test. ++ * testsuite/libgomp.oacc-fortran/parallel-dims-aux.c: New test. ++ * testsuite/libgomp.oacc-fortran/parallel-dims.f89: New test. ++ ++2019-11-11 Tobias Burnus ++ Kwok Cheung Yeung ++ ++ * testsuite/libgomp.fortran/use_device_ptr-optional-1.f90: Extend. ++ * testsuite/libgomp.fortran/use_device_ptr-optional-2.f90: New. ++ ++2019-11-11 Thomas Schwinge ++ ++ * testsuite/libgomp.fortran/target9.f90: Specify 'dg-do run'. ++ ++ * testsuite/libgomp.fortran/use_device_addr-3.f90: Specify 'dg-do ++ run'. ++ * testsuite/libgomp.fortran/use_device_addr-4.f90: Likewise. ++ * testsuite/libgomp.fortran/use_device_ptr-1.f90: Likewise. ++ ++2019-11-06 Thomas Schwinge ++ ++ * testsuite/libgomp.oacc-c-c++-common/par-loop-comb-reduction-1.c: ++ Add expected warnings about missing reduction clauses. ++ * testsuite/libgomp.oacc-c-c++-common/par-loop-comb-reduction-2.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/par-loop-comb-reduction-3.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/par-loop-comb-reduction-4.c: ++ Likewise. ++ ++2019-11-04 Tobias Burnus ++ ++ * testsuite/libgomp.fortran/pr66199-1.f90: Remove ++ 'dg-do run' (implies torture test) as 'dg-options "O2"' is used. ++ * testsuite/libgomp.fortran/pr66199-2.f90: Ditto. ++ * testsuite/libgomp.fortran/taskloop2.f90: Ditto. ++ * testsuite/libgomp.fortran/taskloop3.f90: Ditto. ++ * testsuite/libgomp.fortran/taskloop4.f90: Ditto. ++ ++2019-11-04 Tobias Burnus ++ ++ PR fortran/92305 ++ * testsuite/libgomp.fortran/allocatable2.f90: Use ++ unique numbers with 'stop'. ++ * testsuite/libgomp.fortran/use_device_addr-1.f90: Ditto. ++ * testsuite/libgomp.fortran/use_device_addr-2.f90: Ditto. ++ * testsuite/libgomp.fortran/use_device_ptr-1.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/lib-15.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/pset-1.f90: Ditto. ++ ++2019-11-01 Tobias Burnus ++ ++ * testsuite/libgomp.fortran/use_device_addr-1.f90 (test_nullptr_1, ++ test_dummy_opt_nullptr_callee_1): Add present but unallocated test. ++ * testsuite/libgomp.fortran/use_device_addr-2.f90: Likewise. ++ * testsuite/libgomp.fortran/use_device_addr-3.f90: New. ++ * testsuite/libgomp.fortran/use_device_addr-4.f90: New. ++ * testsuite/testsuite/libgomp.fortran/use_device_ptr-1.f90: New. ++ ++2019-10-30 Tobias Burnus ++ ++ * testsuite/libgomp.fortran/target9.f90: New. ++ ++2019-10-30 Tobias Burnus ++ ++ * testsuite/libgomp.fortran/aligned1.f03: Replace 'STOP' by 'stop'. ++ * testsuite/libgomp.fortran/alloc-comp-1.f90: Ditto. ++ * testsuite/libgomp.fortran/alloc-comp-2.f90: Ditto. ++ * testsuite/libgomp.fortran/alloc-comp-3.f90: Ditto. ++ * testsuite/libgomp.fortran/allocatable1.f90: Ditto. ++ * testsuite/libgomp.fortran/allocatable10.f90: Ditto. ++ * testsuite/libgomp.fortran/allocatable11.f90: Ditto. ++ * testsuite/libgomp.fortran/allocatable12.f90: Ditto. ++ * testsuite/libgomp.fortran/allocatable2.f90: Ditto. ++ * testsuite/libgomp.fortran/allocatable3.f90: Ditto. ++ * testsuite/libgomp.fortran/allocatable4.f90: Ditto. ++ * testsuite/libgomp.fortran/allocatable5.f90: Ditto. ++ * testsuite/libgomp.fortran/allocatable6.f90: Ditto. ++ * testsuite/libgomp.fortran/allocatable7.f90: Ditto. ++ * testsuite/libgomp.fortran/allocatable8.f90: Ditto. ++ * testsuite/libgomp.fortran/allocatable9.f90: Ditto. ++ * testsuite/libgomp.fortran/associate1.f90: Ditto. ++ * testsuite/libgomp.fortran/associate2.f90: Ditto. ++ * testsuite/libgomp.fortran/associate3.f90: Ditto. ++ * testsuite/libgomp.fortran/async_io_4.f90: Ditto. ++ * testsuite/libgomp.fortran/async_io_5.f90: Ditto. ++ * testsuite/libgomp.fortran/async_io_6.f90: Ditto. ++ * testsuite/libgomp.fortran/async_io_7.f90: Ditto. ++ * testsuite/libgomp.fortran/cancel-do-1.f90: Ditto. ++ * testsuite/libgomp.fortran/cancel-do-2.f90: Ditto. ++ * testsuite/libgomp.fortran/cancel-parallel-1.f90: Ditto. ++ * testsuite/libgomp.fortran/cancel-sections-1.f90: Ditto. ++ * testsuite/libgomp.fortran/cancel-taskgroup-2.f90: Ditto. ++ * testsuite/libgomp.fortran/character1.f90: Ditto. ++ * testsuite/libgomp.fortran/character2.f90: Ditto. ++ * testsuite/libgomp.fortran/collapse1.f90: Ditto. ++ * testsuite/libgomp.fortran/collapse2.f90: Ditto. ++ * testsuite/libgomp.fortran/collapse3.f90: Ditto. ++ * testsuite/libgomp.fortran/collapse4.f90: Ditto. ++ * testsuite/libgomp.fortran/crayptr1.f90: Ditto. ++ * testsuite/libgomp.fortran/crayptr2.f90: Ditto. ++ * testsuite/libgomp.fortran/crayptr3.f90: Ditto. ++ * testsuite/libgomp.fortran/declare-simd-1.f90: Ditto. ++ * testsuite/libgomp.fortran/declare-simd-3.f90: Ditto. ++ * testsuite/libgomp.fortran/declare-target-2.f90: Ditto. ++ * testsuite/libgomp.fortran/depend-1.f90: Ditto. ++ * testsuite/libgomp.fortran/depend-2.f90: Ditto. ++ * testsuite/libgomp.fortran/depend-3.f90: Ditto. ++ * testsuite/libgomp.fortran/do1.f90: Ditto. ++ * testsuite/libgomp.fortran/do2.f90: Ditto. ++ * testsuite/libgomp.fortran/do_concurrent_5.f90: Ditto. ++ * testsuite/libgomp.fortran/doacross1.f90: Ditto. ++ * testsuite/libgomp.fortran/doacross2.f90: Ditto. ++ * testsuite/libgomp.fortran/doacross3.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/array_sections-3.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/array_sections-4.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/async_target-1.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/async_target-2.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/declare_target-1.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/declare_target-2.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/declare_target-3.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/declare_target-4.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/declare_target-5.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/device-1.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/device-2.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/device-3.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/simd-1.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/simd-2.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/simd-3.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/simd-4.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/simd-5.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/simd-6.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/simd-7.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/simd-8.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/target-1.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/target-2.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/target-3.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/target-4.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/target-5.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/target_data-1.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/target_data-2.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/target_data-3.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/target_data-4.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/target_data-5.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/target_data-6.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/target_data-7.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/target_update-1.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/target_update-2.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/task_dep-1.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/task_dep-2.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/task_dep-3.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/task_dep-4.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/task_dep-5.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/teams-2.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/teams-3.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/teams-4.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/teams-5.f90: Ditto. ++ * testsuite/libgomp.fortran/examples-4/teams-6.f90: Ditto. ++ * testsuite/libgomp.fortran/lastprivate1.f90: Ditto. ++ * testsuite/libgomp.fortran/lastprivate2.f90: Ditto. ++ * testsuite/libgomp.fortran/lib1.f90: Ditto. ++ * testsuite/libgomp.fortran/lib4.f90: Ditto. ++ * testsuite/libgomp.fortran/lock-1.f90: Ditto. ++ * testsuite/libgomp.fortran/lock-2.f90: Ditto. ++ * testsuite/libgomp.fortran/nested1.f90: Ditto. ++ * testsuite/libgomp.fortran/nestedfn1.f90: Ditto. ++ * testsuite/libgomp.fortran/nestedfn2.f90: Ditto. ++ * testsuite/libgomp.fortran/nestedfn3.f90: Ditto. ++ * testsuite/libgomp.fortran/nestedfn4.f90: Ditto. ++ * testsuite/libgomp.fortran/nestedfn5.f90: Ditto. ++ * testsuite/libgomp.fortran/omp_atomic1.f90: Ditto. ++ * testsuite/libgomp.fortran/omp_atomic2.f90: Ditto. ++ * testsuite/libgomp.fortran/omp_atomic3.f90: Ditto. ++ * testsuite/libgomp.fortran/omp_atomic4.f90: Ditto. ++ * testsuite/libgomp.fortran/omp_atomic5.f90: Ditto. ++ * testsuite/libgomp.fortran/omp_cond1.f: Ditto. ++ * testsuite/libgomp.fortran/omp_cond2.f: Ditto. ++ * testsuite/libgomp.fortran/omp_cond3.F90: Ditto. ++ * testsuite/libgomp.fortran/omp_cond4.F90: Ditto. ++ * testsuite/libgomp.fortran/omp_parse1.f90: Ditto. ++ * testsuite/libgomp.fortran/omp_parse2.f90: Ditto. ++ * testsuite/libgomp.fortran/omp_parse3.f90: Ditto. ++ * testsuite/libgomp.fortran/omp_parse4.f90: Ditto. ++ * testsuite/libgomp.fortran/openmp_version-1.f: Ditto. ++ * testsuite/libgomp.fortran/openmp_version-2.f90: Ditto. ++ * testsuite/libgomp.fortran/parloops-exit-first-loop-alt-2.f95: Ditto. ++ * testsuite/libgomp.fortran/parloops-exit-first-loop-alt.f95: Ditto. ++ * testsuite/libgomp.fortran/pointer1.f90: Ditto. ++ * testsuite/libgomp.fortran/pointer2.f90: Ditto. ++ * testsuite/libgomp.fortran/pr25219.f90: Ditto. ++ * testsuite/libgomp.fortran/pr27395-1.f90: Ditto. ++ * testsuite/libgomp.fortran/pr27395-2.f90: Ditto. ++ * testsuite/libgomp.fortran/pr27416-1.f90: Ditto. ++ * testsuite/libgomp.fortran/pr27916-1.f90: Ditto. ++ * testsuite/libgomp.fortran/pr27916-2.f90: Ditto. ++ * testsuite/libgomp.fortran/pr28390.f: Ditto. ++ * testsuite/libgomp.fortran/pr29629.f90: Ditto. ++ * testsuite/libgomp.fortran/pr32550.f90: Ditto. ++ * testsuite/libgomp.fortran/pr33880.f90: Ditto. ++ * testsuite/libgomp.fortran/pr34020.f90: Ditto. ++ * testsuite/libgomp.fortran/pr35130.f90: Ditto. ++ * testsuite/libgomp.fortran/pr42162.f90: Ditto. ++ * testsuite/libgomp.fortran/pr46753.f90: Ditto. ++ * testsuite/libgomp.fortran/pr48894.f90: Ditto. ++ * testsuite/libgomp.fortran/pr49792-1.f90: Ditto. ++ * testsuite/libgomp.fortran/pr49792-2.f90: Ditto. ++ * testsuite/libgomp.fortran/pr63938-1.f90: Ditto. ++ * testsuite/libgomp.fortran/pr63938-2.f90: Ditto. ++ * testsuite/libgomp.fortran/pr65597.f90: Ditto. ++ * testsuite/libgomp.fortran/pr66199-1.f90: Ditto. ++ * testsuite/libgomp.fortran/pr71014.f90: Ditto. ++ * testsuite/libgomp.fortran/pr81304.f90: Ditto. ++ * testsuite/libgomp.fortran/pr81841.f90: Ditto. ++ * testsuite/libgomp.fortran/pr84418-1.f90: Ditto. ++ * testsuite/libgomp.fortran/pr84418-2.f90: Ditto. ++ * testsuite/libgomp.fortran/procptr1.f90: Ditto. ++ * testsuite/libgomp.fortran/recursion1.f90: Ditto. ++ * testsuite/libgomp.fortran/reduction1.f90: Ditto. ++ * testsuite/libgomp.fortran/reduction2.f90: Ditto. ++ * testsuite/libgomp.fortran/reduction3.f90: Ditto. ++ * testsuite/libgomp.fortran/reduction4.f90: Ditto. ++ * testsuite/libgomp.fortran/reduction5.f90: Ditto. ++ * testsuite/libgomp.fortran/reduction6.f90: Ditto. ++ * testsuite/libgomp.fortran/reference1.f90: Ditto. ++ * testsuite/libgomp.fortran/reference2.f90: Ditto. ++ * testsuite/libgomp.fortran/retval1.f90: Ditto. ++ * testsuite/libgomp.fortran/retval2.f90: Ditto. ++ * testsuite/libgomp.fortran/sharing1.f90: Ditto. ++ * testsuite/libgomp.fortran/sharing2.f90: Ditto. ++ * testsuite/libgomp.fortran/simd1.f90: Ditto. ++ * testsuite/libgomp.fortran/simd2.f90: Ditto. ++ * testsuite/libgomp.fortran/simd3.f90: Ditto. ++ * testsuite/libgomp.fortran/simd4.f90: Ditto. ++ * testsuite/libgomp.fortran/simd5.f90: Ditto. ++ * testsuite/libgomp.fortran/simd6.f90: Ditto. ++ * testsuite/libgomp.fortran/simd7.f90: Ditto. ++ * testsuite/libgomp.fortran/stack.f90: Ditto. ++ * testsuite/libgomp.fortran/strassen.f90: Ditto. ++ * testsuite/libgomp.fortran/tabs1.f90: Ditto. ++ * testsuite/libgomp.fortran/tabs2.f: Ditto. ++ * testsuite/libgomp.fortran/target1.f90: Ditto. ++ * testsuite/libgomp.fortran/target2.f90: Ditto. ++ * testsuite/libgomp.fortran/target3.f90: Ditto. ++ * testsuite/libgomp.fortran/target4.f90: Ditto. ++ * testsuite/libgomp.fortran/target5.f90: Ditto. ++ * testsuite/libgomp.fortran/target6.f90: Ditto. ++ * testsuite/libgomp.fortran/target7.f90: Ditto. ++ * testsuite/libgomp.fortran/target8.f90: Ditto. ++ * testsuite/libgomp.fortran/task1.f90: Ditto. ++ * testsuite/libgomp.fortran/task2.f90: Ditto. ++ * testsuite/libgomp.fortran/task3.f90: Ditto. ++ * testsuite/libgomp.fortran/task4.f90: Ditto. ++ * testsuite/libgomp.fortran/taskgroup1.f90: Ditto. ++ * testsuite/libgomp.fortran/taskloop1.f90: Ditto. ++ * testsuite/libgomp.fortran/taskloop2.f90: Ditto. ++ * testsuite/libgomp.fortran/taskloop3.f90: Ditto. ++ * testsuite/libgomp.fortran/taskloop4.f90: Ditto. ++ * testsuite/libgomp.fortran/threadprivate1.f90: Ditto. ++ * testsuite/libgomp.fortran/threadprivate2.f90: Ditto. ++ * testsuite/libgomp.fortran/threadprivate3.f90: Ditto. ++ * testsuite/libgomp.fortran/threadprivate4.f90: Ditto. ++ * testsuite/libgomp.fortran/udr1.f90: Ditto. ++ * testsuite/libgomp.fortran/udr10.f90: Ditto. ++ * testsuite/libgomp.fortran/udr11.f90: Ditto. ++ * testsuite/libgomp.fortran/udr12.f90: Ditto. ++ * testsuite/libgomp.fortran/udr13.f90: Ditto. ++ * testsuite/libgomp.fortran/udr14.f90: Ditto. ++ * testsuite/libgomp.fortran/udr15.f90: Ditto. ++ * testsuite/libgomp.fortran/udr2.f90: Ditto. ++ * testsuite/libgomp.fortran/udr3.f90: Ditto. ++ * testsuite/libgomp.fortran/udr4.f90: Ditto. ++ * testsuite/libgomp.fortran/udr5.f90: Ditto. ++ * testsuite/libgomp.fortran/udr6.f90: Ditto. ++ * testsuite/libgomp.fortran/udr7.f90: Ditto. ++ * testsuite/libgomp.fortran/udr8.f90: Ditto. ++ * testsuite/libgomp.fortran/udr9.f90: Ditto. ++ * testsuite/libgomp.fortran/vla1.f90: Ditto. ++ * testsuite/libgomp.fortran/vla2.f90: Ditto. ++ * testsuite/libgomp.fortran/vla3.f90: Ditto. ++ * testsuite/libgomp.fortran/vla4.f90: Ditto. ++ * testsuite/libgomp.fortran/vla5.f90: Ditto. ++ * testsuite/libgomp.fortran/vla6.f90: Ditto. ++ * testsuite/libgomp.fortran/vla7.f90: Ditto. ++ * testsuite/libgomp.fortran/vla8.f90: Ditto. ++ * testsuite/libgomp.fortran/workshare1.f90: Ditto. ++ * testsuite/libgomp.fortran/workshare2.f90: Ditto. ++ ++2019-10-30 Tobias Burnus ++ ++ * testsuite/libgomp.fortran/target-simd.f90: Use stop not abort. ++ * testsuite/libgomp.fortran/use_device_ptr-optional-1.f90: ++ Ditto; add 'dg-do run' for torture testing. ++ * testsuite/libgomp.fortran/lastprivate1.f90: Add 'dg-do run'. ++ * testsuite/libgomp.fortran/lastprivate2.f90: Ditto. ++ * testsuite/libgomp.fortran/nestedfn4.f90: Ditto. ++ * testsuite/libgomp.fortran/pr25219.f90: Ditto. ++ * testsuite/libgomp.fortran/pr28390.f: Ditto. ++ * testsuite/libgomp.fortran/pr35130.f90: Ditto. ++ * testsuite/libgomp.fortran/pr90779.f90: Ditto. ++ * testsuite/libgomp.fortran/task2.f90: Ditto. ++ * testsuite/libgomp.fortran/taskgroup1.f90: Ditto. ++ * testsuite/libgomp.fortran/taskloop1.f90: Ditto. ++ * testsuite/libgomp.fortran/use_device_addr-1.f90: Ditto. ++ * testsuite/libgomp.fortran/use_device_addr-2.f90: Ditto. ++ * testsuite/libgomp.fortran/workshare1.f90: Ditto. ++ * testsuite/libgomp.fortran/workshare2.f90: Ditto. ++ ++2019-10-28 Tobias Burnus ++ ++ * testsuite/libgomp.oacc-fortran/abort-1.f90: Add 'dg-do run'. ++ * testsuite/libgomp.oacc-fortran/abort-2.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/acc_on_device-1-1.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/acc_on_device-1-2.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/acc_on_device-1-3.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/lib-1.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/common-block-1.f90: ++ Use 'stop' not abort(). ++ * testsuite/libgomp.oacc-fortran/common-block-2.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/common-block-3.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/data-1.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/data-2.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/data-5.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/dummy-array.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/gemm-2.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/gemm.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/host_data-2.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/host_data-3.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/host_data-4.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-collapse-3.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-collapse-4.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-independent.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-loop-1.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-map-1.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-parallel-loop-data-enter-exit.f= 95: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-gang-1.f90: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-gang-2.f90: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-gang-3.f90: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-gang-6.f90: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-vector-1.f90: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-vector-2.f90: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-worker-1.f90: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-worker-2.f90: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-worker-3.f90: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-worker-4.f90: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-worker-5.f90: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-worker-6.f90: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-worker-7.f90: ++ Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-reduction-1.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/lib-12.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/lib-13.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/lib-14.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/kernels-acc-loop-reduction-2.f90: ++ Likewise and also add 'dg-do run'. ++ * testsuite/libgomp.oacc-fortran/kernels-acc-loop-reduction.f90: ++ Ditto. ++ ++2019-10-25 Cesar Philippidis ++ Tobias Burnus ++ ++ * testsuite/libgomp.oacc-fortran/common-block-1.f90: New test. ++ * testsuite/libgomp.oacc-fortran/common-block-2.f90: New test. ++ * testsuite/libgomp.oacc-fortran/common-block-3.f90: New test. ++ ++2019-10-14 Jakub Jelinek ++ ++ PR libgomp/92081 ++ * testsuite/libgomp.fortran/target-simd.f90: Iterate from 1 rather ++ than 0. ++ ++2019-10-11 Tobias Burnus ++ ++ * testsuite/libgomp.fortran/use_device_addr-1.f90: New. ++ * testsuite/libgomp.fortran/use_device_addr-2.f90: New. ++ ++2019-10-09 Thomas Schwinge ++ ++ PR middle-end/92036 ++ * testsuite/libgomp.oacc-c-c++-common/data-firstprivate-1.c: New ++ file. ++ ++2019-10-09 Tobias Burnus ++ ++ PR testsuite/91884 ++ * testsuite/libgomp.fortran/fortran.exp: Conditionally ++ add -lquadmath. ++ * testsuite/libgomp.oacc-fortran/fortran.exp: Ditto. ++ ++2019-10-09 Jakub Jelinek ++ ++ PR libgomp/92028 ++ * target.c (gomp_map_vars_internal): Readd the previous ++ GOMP_MAP_USE_DEVICE_PTR handling code in the first loop, ++ though do that just in the !not_found_cnt case. ++ ++2019-10-08 Tobias Burnus ++ ++ * gfortran.dg/gomp/target-simd.f90: New. ++ ++2019-10-02 Julian Brown ++ Cesar Philippidis ++ ++ * libgomp.h (OFFSET_INLINED, OFFSET_POINTER, OFFSET_STRUCT): Define. ++ * target.c (FIELD_TGT_EMPTY): Define. ++ (gomp_map_val): Use OFFSET_* macros instead of magic constants. Write ++ as switch instead of list of ifs. ++ (gomp_map_vars_internal): Use OFFSET_* and FIELD_TGT_EMPTY macros. ++ ++2019-10-02 Andreas Tobler ++ ++ * testsuite/libgomp.oacc-c-c++-common/loop-default.h: Remove alloca.h ++ include. Replace alloca () with __builtin_alloca (). ++ * testsuite/libgomp.oacc-c-c++-common/loop-dim-default.c: Likewise. ++ ++2019-10-01 Jakub Jelinek ++ ++ * configure.ac: Remove GCC_HEADER_STDINT(gstdint.h). ++ * libgomp.h: Include instead of "gstdint.h". ++ * oacc-parallel.c: Don't include "libgomp_g.h". ++ * plugin/plugin-hsa.c: Include instead of "gstdint.h". ++ * plugin/plugin-nvptx.c: Don't include "gstdint.h". ++ * aclocal.m4: Regenerated. ++ * config.h.in: Regenerated. ++ * configure: Regenerated. ++ * Makefile.in: Regenerated. ++ ++2019-09-30 Kwok Cheung Yeung ++ ++ * libgomp_g.h: Include stdint.h instead of gstdint.h. ++ ++2019-09-27 Maciej W. Rozycki ++ ++ * configure: Regenerate. ++ ++2019-09-13 Tobias Burnus ++ ++ * plugin/plugin-hsa.c (hsa_warn, hsa_fatal, hsa_error): Ensure ++ string is initialized. ++ ++2019-09-06 Florian Weimer ++ ++ * configure: Regenerate. ++ ++2019-09-03 Chung-Lin Tang ++ ++ PR other/79543 ++ * acinclude.m4 (LIBGOMP_CHECK_LINKER_FEATURES): Fix GNU ld --version ++ scanning to conform to the GNU Coding Standards. ++ * configure: Regenerate. ++ ++2019-08-28 Jakub Jelinek ++ ++ PR libgomp/91530 ++ * testsuite/libgomp.c/scan-21.c: New test. ++ * testsuite/libgomp.c/scan-22.c: New test. ++ ++2019-08-27 Jakub Jelinek ++ ++ PR libgomp/91530 ++ * testsuite/libgomp.c/scan-11.c: Add -msse2 option for sse2_runtime ++ targets. ++ * testsuite/libgomp.c/scan-12.c: Likewise. ++ * testsuite/libgomp.c/scan-13.c: Likewise. ++ * testsuite/libgomp.c/scan-14.c: Likewise. ++ * testsuite/libgomp.c/scan-15.c: Likewise. ++ * testsuite/libgomp.c/scan-16.c: Likewise. ++ * testsuite/libgomp.c/scan-17.c: Likewise. ++ * testsuite/libgomp.c/scan-18.c: Likewise. ++ * testsuite/libgomp.c/scan-19.c: Likewise. ++ * testsuite/libgomp.c/scan-20.c: Likewise. ++ * testsuite/libgomp.c++/scan-9.C: Likewise. ++ * testsuite/libgomp.c++/scan-10.C: Likewise. ++ * testsuite/libgomp.c++/scan-11.C: Likewise. ++ * testsuite/libgomp.c++/scan-12.C: Likewise. ++ * testsuite/libgomp.c++/scan-14.C: Likewise. ++ * testsuite/libgomp.c++/scan-15.C: Likewise. ++ * testsuite/libgomp.c++/scan-13.C: Likewise. Use sse2_runtime ++ instead of i?86-*-* x86_64-*-* as target for scan-tree-dump-times. ++ * testsuite/libgomp.c++/scan-16.C: Likewise. ++ ++2019-08-17 Thomas Koenig ++ ++ PR fortran/91473 ++ * testsuite/libgomp.fortran/appendix-a/a.28.5.f90: Add ++ -std=3Dlegacy so invalid code in the test case is accepted. ++ ++2019-08-12 Thomas Koenig ++ ++ PR fortran/91422 ++ * testsuite/libgomp.oacc-fortran/routine-7.f90: Correct array ++ dimension. ++ ++2019-08-08 Jakub Jelinek ++ ++ * target.c (gomp_map_vars_internal): For GOMP_MAP_USE_DEVICE_PTR ++ perform the lookup in the first loop only if !not_found_cnt, otherwise ++ perform lookups for it in the second loop guarded with ++ if (not_found_cnt || has_firstprivate). ++ * testsuite/libgomp.c/target-37.c: New test. ++ * testsuite/libgomp.c++/target-22.C: New test. ++ ++2019-08-07 Jakub Jelinek ++ ++ * testsuite/libgomp.c/target-18.c (struct S): New type. ++ (foo): Use use_device_addr clause instead of use_device_ptr clause ++ where required by OpenMP 5.0, add further tests for both use_device_ptr ++ and use_device_addr clauses. ++ * testsuite/libgomp.c++/target-9.C (struct S): New type. ++ (foo): Use use_device_addr clause instead of use_device_ptr clause ++ where required by OpenMP 5.0, add further tests for both use_device_ptr ++ and use_device_addr clauses. Add t and u arguments. ++ (main): Adjust caller. ++ ++2019-08-06 Jakub Jelinek ++ ++ * testsuite/libgomp.c++/loop-13.C: New test. ++ * testsuite/libgomp.c++/loop-14.C: New test. ++ * testsuite/libgomp.c++/loop-15.C: New test. ++ ++2019-07-31 Jakub Jelinek ++ ++ PR middle-end/91301 ++ * testsuite/libgomp.c++/for-27.C: New test. ++ ++2019-07-23 Steven G. Kargl ++ ++ * testsuite/libgomp.fortran/reduction4.f90: Update BOZ usage. ++ * testsuite/libgomp.fortran/reduction5.f90: Ditto. ++ ++2019-07-20 Jakub Jelinek ++ ++ * testsuite/libgomp.c-c++-common/loop-1.c: New test. ++ ++2019-07-08 Jakub Jelinek ++ ++ * testsuite/libgomp.c++/scan-13.C: Replace xfail with target x86. ++ * testsuite/libgomp.c++/scan-16.C: Likewise. ++ ++2019-07-06 Jakub Jelinek ++ ++ * testsuite/libgomp.c/scan-19.c: New test. ++ * testsuite/libgomp.c/scan-20.c: New test. ++ ++ * testsuite/libgomp.c/scan-11.c: New test. ++ * testsuite/libgomp.c/scan-12.c: New test. ++ * testsuite/libgomp.c/scan-13.c: New test. ++ * testsuite/libgomp.c/scan-14.c: New test. ++ * testsuite/libgomp.c/scan-15.c: New test. ++ * testsuite/libgomp.c/scan-16.c: New test. ++ * testsuite/libgomp.c/scan-17.c: New test. ++ * testsuite/libgomp.c/scan-18.c: New test. ++ * testsuite/libgomp.c++/scan-9.C: New test. ++ * testsuite/libgomp.c++/scan-10.C: New test. ++ * testsuite/libgomp.c++/scan-11.C: New test. ++ * testsuite/libgomp.c++/scan-12.C: New test. ++ * testsuite/libgomp.c++/scan-13.C: New test. ++ * testsuite/libgomp.c++/scan-14.C: New test. ++ * testsuite/libgomp.c++/scan-15.C: New test. ++ * testsuite/libgomp.c++/scan-16.C: New test. ++ ++2019-07-04 Jakub Jelinek ++ ++ * testsuite/libgomp.c/scan-9.c: New test. ++ * testsuite/libgomp.c/scan-10.c: New test. ++ ++2019-07-03 Jakub Jelinek ++ ++ * testsuite/libgomp.c++/scan-1.C: New test. ++ * testsuite/libgomp.c++/scan-2.C: New test. ++ * testsuite/libgomp.c++/scan-3.C: New test. ++ * testsuite/libgomp.c++/scan-4.C: New test. ++ * testsuite/libgomp.c++/scan-5.C: New test. ++ * testsuite/libgomp.c++/scan-6.C: New test. ++ * testsuite/libgomp.c++/scan-7.C: New test. ++ * testsuite/libgomp.c++/scan-8.C: New test. ++ * testsuite/libgomp.c/scan-1.c: New test. ++ * testsuite/libgomp.c/scan-2.c: New test. ++ * testsuite/libgomp.c/scan-3.c: New test. ++ * testsuite/libgomp.c/scan-4.c: New test. ++ * testsuite/libgomp.c/scan-5.c: New test. ++ * testsuite/libgomp.c/scan-6.c: New test. ++ * testsuite/libgomp.c/scan-7.c: New test. ++ * testsuite/libgomp.c/scan-8.c: New test. ++ ++2019-06-18 Thomas Schwinge ++ ++ * testsuite/libgomp.oacc-c++/firstprivate-mappings-1.C: New file. ++ * testsuite/libgomp.oacc-c-c++-common/firstprivate-mappings-1.c: ++ Likewise. ++ ++ * testsuite/libgomp.fortran/allocatable3.f90: Add missing results ++ check. ++ ++2019-06-18 Cesar Philippidis ++ ++ * testsuite/libgomp.oacc-fortran/allocatable-array-1.f90: New ++ file. ++ ++2019-06-18 Thomas Schwinge ++ ++ PR fortran/90743 ++ * oacc-parallel.c (GOACC_parallel_keyed): Handle NULL mapping ++ case. ++ * testsuite/libgomp.fortran/target-allocatable-1-1.f90: New file. ++ * testsuite/libgomp.fortran/target-allocatable-1-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/allocatable-1-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/allocatable-1-2.f90: Likewise. ++ ++ PR testsuite/90861 ++ * testsuite/libgomp.oacc-c-c++-common/declare-vla.c: Update. ++ ++ PR middle-end/90862 ++ * testsuite/libgomp.oacc-c-c++-common/declare-1.c: Update. ++ ++2019-06-16 Tom de Vries ++ ++ PR tree-optimization/89376 ++ * testsuite/libgomp.oacc-c-c++-common/pr89376.c: New test. ++ ++2019-06-15 Tom de Vries ++ ++ PR tree-optimization/89713 ++ * testsuite/libgomp.oacc-c-c++-common/pr85381-2.c: Expect no bar.sync. ++ * testsuite/libgomp.oacc-c-c++-common/pr85381-4.c: Same. ++ ++2019-06-15 Jakub Jelinek ++ ++ PR middle-end/90779 ++ * testsuite/libgomp.c/pr90779.c: New test. ++ * testsuite/libgomp.fortran/pr90779.f90: New test. ++ ++2019-06-15 Tom de Vries ++ ++ PR tree-optimization/90009 ++ * testsuite/libgomp.oacc-c-c++-common/pr90009.c: New test. ++ ++2019-06-13 Feng Xue ++ ++ PR tree-optimization/89713 ++ * testsuite/libgomp.oacc-c-c++-common/pr84955-1.c: New test. ++ ++2019-06-11 Jakub Jelinek ++ ++ PR target/90811 ++ * testsuite/libgomp.c/pr90811.c: New test. ++ ++2019-06-05 Jakub Jelinek ++ ++ * testsuite/libgomp.c++/lastprivate-conditional-1.C: New test. ++ * testsuite/libgomp.c++/lastprivate-conditional-2.C: New test. ++ ++2019-06-04 Jakub Jelinek ++ ++ * testsuite/libgomp.c-c++-common/lastprivate-conditional-7.c: New test. ++ * testsuite/libgomp.c-c++-common/lastprivate-conditional-8.c: New test. ++ * testsuite/libgomp.c-c++-common/lastprivate-conditional-9.c: New test. ++ * testsuite/libgomp.c-c++-common/lastprivate-conditional-10.c: New test. ++ ++2019-05-30 Rainer Orth ++ ++ * configure.ac: Call AX_COUNT_CPUS. ++ Substitute CPU_COUNT. ++ * testsuite/Makefile.am (check-am): Use CPU_COUNT as processor ++ count fallback. ++ * aclocal.m4: Regenerate. ++ * configure: Regenerate. ++ * Makefile.in, testsuite/Makefile.in: Regenerate. ++ ++2019-05-29 Jakub Jelinek ++ ++ * testsuite/libgomp.c-c++-common/lastprivate_conditional_4.c: Rename ++ to ... ++ * testsuite/libgomp.c-c++-common/lastprivate-conditional-4.c: ... this. ++ * testsuite/libgomp.c-c++-common/lastprivate-conditional-5.c: New test. ++ * testsuite/libgomp.c-c++-common/lastprivate-conditional-6.c: New test. ++ ++2019-05-27 Jakub Jelinek ++ ++ * testsuite/libgomp.c-c++-common/lastprivate_conditional_4.c: New test. ++ ++ * testsuite/libgomp.c-c++-common/lastprivate-conditional-3.c: New test. ++ ++ PR libgomp/90641 ++ * work.c (gomp_init_work_share): Instead of aligning final ordered ++ value to multiples of long long alignment, align to that the ++ first part (ordered team ids) and if inline_ordered_team_ids ++ is not on a long long alignment boundary within the structure, ++ use __alignof__ (long long) - 1 pad size always. ++ * loop.c (GOMP_loop_start): Fix *mem computation if ++ inline_ordered_team_ids is not aligned on long long alignment boundary ++ within the structure. ++ * loop-ull.c (GOMP_loop_ull_start): Likewise. ++ * sections.c (GOMP_sections2_start): Likewise. ++ ++2019-05-24 Jakub Jelinek ++ ++ * testsuite/libgomp.c-c++-common/lastprivate-conditional-1.c: New test. ++ * testsuite/libgomp.c-c++-common/lastprivate-conditional-2.c: New test. ++ ++ PR libgomp/90585 ++ * plugin/plugin-hsa.c: Include gstdint.h. Include inttypes.h only if ++ HAVE_INTTYPES_H is defined. ++ (print_uint64_t): New typedef. ++ (PRIu64): Define if HAVE_INTTYPES_H is not defined. ++ (print_kernel_dispatch, run_kernel): Use PRIu64 macro instead of ++ "lu", cast uint64_t HSA_DEBUG and fprintf arguments to print_uint64_t. ++ (release_kernel_dispatch): Likewise. Cast shadow->debug to uintptr_t ++ before casting to void *. ++ * plugin/plugin-nvptx.c: Include gstdint.h instead of stdint.h. ++ * oacc-mem.c: Don't include config.h nor stdint.h. ++ * target.c: Don't include config.h. ++ * oacc-cuda.c: Likewise. ++ * oacc-host.c: Don't include stdint.h. ++ ++2019-05-20 Jakub Jelinek ++ ++ PR libgomp/90527 ++ * alloc.c (_GNU_SOURCE): Define. ++ ++2019-05-17 Thomas Schwinge ++ ++ * acc_prof.h: New file. ++ * oacc-profiling.c: Likewise. ++ * Makefile.am (nodist_libsubinclude_HEADERS, libgomp_la_SOURCES): ++ Add these, respectively. ++ * Makefile.in: Regenerate. ++ * env.c (initialize_env): Call goacc_profiling_initialize. ++ * oacc-plugin.c (GOMP_PLUGIN_goacc_thread) ++ (GOMP_PLUGIN_goacc_profiling_dispatch): New functions. ++ * oacc-plugin.h (GOMP_PLUGIN_goacc_thread) ++ (GOMP_PLUGIN_goacc_profiling_dispatch): Declare. ++ * libgomp.map (OACC_2.5.1): Add acc_prof_lookup, ++ acc_prof_register, acc_prof_unregister, and acc_register_library. ++ (GOMP_PLUGIN_1.3): Add GOMP_PLUGIN_goacc_profiling_dispatch, and ++ GOMP_PLUGIN_goacc_thread. ++ * oacc-int.h (struct goacc_thread): Add prof_info, api_info, ++ prof_callbacks_enabled members. ++ (goacc_prof_enabled, goacc_profiling_initialize) ++ (_goacc_profiling_dispatch_p, _goacc_profiling_setup_p) ++ (goacc_profiling_dispatch): Declare. ++ (GOACC_PROF_ENABLED, GOACC_PROFILING_DISPATCH_P) ++ (GOACC_PROFILING_SETUP_P): Define. ++ * oacc-async.c (acc_async_test, acc_async_test_all, acc_wait) ++ (acc_wait_async, acc_wait_all, acc_wait_all_async): Update for ++ OpenACC Profiling Interface. ++ * oacc-cuda.c (acc_get_current_cuda_device) ++ (acc_get_current_cuda_context, acc_get_cuda_stream) ++ (acc_set_cuda_stream): Likewise. ++ * oacc-init.c (acc_init_1, goacc_attach_host_thread_to_device) ++ (acc_init, acc_set_device_type, acc_get_device_type) ++ (acc_get_device_num, goacc_lazy_initialize): Likewise. ++ * oacc-mem.c (acc_malloc, acc_free, memcpy_tofrom_device) ++ (acc_deviceptr, acc_hostptr, acc_is_present, acc_map_data) ++ (acc_unmap_data, present_create_copy, delete_copyout) ++ (update_dev_host): Likewise. ++ * oacc-parallel.c (GOACC_parallel_keyed, GOACC_data_start) ++ (GOACC_data_end, GOACC_enter_exit_data, GOACC_update, GOACC_wait): ++ Likewise. ++ * plugin/plugin-nvptx.c (nvptx_exec, nvptx_alloc, nvptx_free) ++ (GOMP_OFFLOAD_openacc_exec, GOMP_OFFLOAD_openacc_async_exec): ++ Likewise. ++ * libgomp.texi: Update. ++ * testsuite/libgomp.oacc-c-c++-common/acc_prof-dispatch-1.c: New ++ file. ++ * testsuite/libgomp.oacc-c-c++-common/acc_prof-init-1.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_prof-kernels-1.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_prof-parallel-1.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_prof-valid_bytes-1.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/acc_prof-version-1.c: ++ Likewise. ++ ++2019-05-13 Chung-Lin Tang ++ ++ * libgomp-plugin.h (struct goacc_asyncqueue): Declare. ++ (struct goacc_asyncqueue_list): Likewise. ++ (goacc_aq): Likewise. ++ (goacc_aq_list): Likewise. ++ (GOMP_OFFLOAD_openacc_register_async_cleanup): Remove. ++ (GOMP_OFFLOAD_openacc_async_test): Remove. ++ (GOMP_OFFLOAD_openacc_async_test_all): Remove. ++ (GOMP_OFFLOAD_openacc_async_wait): Remove. ++ (GOMP_OFFLOAD_openacc_async_wait_async): Remove. ++ (GOMP_OFFLOAD_openacc_async_wait_all): Remove. ++ (GOMP_OFFLOAD_openacc_async_wait_all_async): Remove. ++ (GOMP_OFFLOAD_openacc_async_set_async): Remove. ++ (GOMP_OFFLOAD_openacc_exec): Adjust declaration. ++ (GOMP_OFFLOAD_openacc_cuda_get_stream): Likewise. ++ (GOMP_OFFLOAD_openacc_cuda_set_stream): Likewise. ++ (GOMP_OFFLOAD_openacc_async_exec): Declare. ++ (GOMP_OFFLOAD_openacc_async_construct): Declare. ++ (GOMP_OFFLOAD_openacc_async_destruct): Declare. ++ (GOMP_OFFLOAD_openacc_async_test): Declare. ++ (GOMP_OFFLOAD_openacc_async_synchronize): Declare. ++ (GOMP_OFFLOAD_openacc_async_serialize): Declare. ++ (GOMP_OFFLOAD_openacc_async_queue_callback): Declare. ++ (GOMP_OFFLOAD_openacc_async_host2dev): Declare. ++ (GOMP_OFFLOAD_openacc_async_dev2host): Declare. ++ ++ * libgomp.h (struct acc_dispatch_t): Define 'async' sub-struct. ++ (gomp_acc_insert_pointer): Adjust declaration. ++ (gomp_copy_host2dev): New declaration. ++ (gomp_copy_dev2host): Likewise. ++ (gomp_map_vars_async): Likewise. ++ (gomp_unmap_tgt): Likewise. ++ (gomp_unmap_vars_async): Likewise. ++ (gomp_fini_device): Likewise. ++ ++ * oacc-async.c (get_goacc_thread): New function. ++ (get_goacc_thread_device): New function. ++ (lookup_goacc_asyncqueue): New function. ++ (get_goacc_asyncqueue): New function. ++ (acc_async_test): Adjust code to use new async design. ++ (acc_async_test_all): Likewise. ++ (acc_wait): Likewise. ++ (acc_wait_async): Likewise. ++ (acc_wait_all): Likewise. ++ (acc_wait_all_async): Likewise. ++ (goacc_async_free): New function. ++ (goacc_init_asyncqueues): Likewise. ++ (goacc_fini_asyncqueues): Likewise. ++ * oacc-cuda.c (acc_get_cuda_stream): Adjust code to use new async ++ design. ++ (acc_set_cuda_stream): Likewise. ++ * oacc-host.c (host_openacc_exec): Adjust parameters, remove 'async'. ++ (host_openacc_register_async_cleanup): Remove. ++ (host_openacc_async_exec): New function. ++ (host_openacc_async_test): Adjust parameters. ++ (host_openacc_async_test_all): Remove. ++ (host_openacc_async_wait): Remove. ++ (host_openacc_async_wait_async): Remove. ++ (host_openacc_async_wait_all): Remove. ++ (host_openacc_async_wait_all_async): Remove. ++ (host_openacc_async_set_async): Remove. ++ (host_openacc_async_synchronize): New function. ++ (host_openacc_async_serialize): New function. ++ (host_openacc_async_host2dev): New function. ++ (host_openacc_async_dev2host): New function. ++ (host_openacc_async_queue_callback): New function. ++ (host_openacc_async_construct): New function. ++ (host_openacc_async_destruct): New function. ++ (struct gomp_device_descr host_dispatch): Remove initialization of old ++ interface, add initialization of new async sub-struct. ++ * oacc-init.c (acc_shutdown_1): Adjust to use gomp_fini_device. ++ (goacc_attach_host_thread_to_device): Remove old async code usage. ++ * oacc-int.h (goacc_init_asyncqueues): New declaration. ++ (goacc_fini_asyncqueues): Likewise. ++ (goacc_async_copyout_unmap_vars): Likewise. ++ (goacc_async_free): Likewise. ++ (get_goacc_asyncqueue): Likewise. ++ (lookup_goacc_asyncqueue): Likewise. ++ * oacc-mem.c (memcpy_tofrom_device): Adjust code to use new async ++ design. ++ (present_create_copy): Adjust code to use new async design. ++ (delete_copyout): Likewise. ++ (update_dev_host): Likewise. ++ (gomp_acc_insert_pointer): Add async parameter, adjust code to use new ++ async design. ++ (gomp_acc_remove_pointer): Adjust code to use new async design. ++ * oacc-parallel.c (GOACC_parallel_keyed): Adjust code to use new async ++ design. ++ (GOACC_enter_exit_data): Likewise. ++ (goacc_wait): Likewise. ++ (GOACC_update): Likewise. ++ * oacc-plugin.c (GOMP_PLUGIN_async_unmap_vars): Change to assert fail ++ when called, warn as obsolete in comment. ++ * target.c (goacc_device_copy_async): New function. ++ (gomp_copy_host2dev): Remove 'static', add goacc_asyncqueue parameter, ++ add goacc_device_copy_async case. ++ (gomp_copy_dev2host): Likewise. ++ (gomp_map_vars_existing): Add goacc_asyncqueue parameter, adjust code. ++ (gomp_map_pointer): Likewise. ++ (gomp_map_fields_existing): Likewise. ++ (gomp_map_vars_internal): New always_inline function, renamed from ++ gomp_map_vars. ++ (gomp_map_vars): Implement by calling gomp_map_vars_internal. ++ (gomp_map_vars_async): Implement by calling gomp_map_vars_internal, ++ passing goacc_asyncqueue argument. ++ (gomp_unmap_tgt): Remove static, add attribute_hidden. ++ (gomp_unref_tgt): New function. ++ (gomp_unmap_vars_internal): New always_inline function, renamed from ++ gomp_unmap_vars. ++ (gomp_unmap_vars): Implement by calling gomp_unmap_vars_internal. ++ (gomp_unmap_vars_async): Implement by calling ++ gomp_unmap_vars_internal, passing goacc_asyncqueue argument. ++ (gomp_fini_device): New function. ++ (gomp_exit_data): Adjust gomp_copy_dev2host call. ++ (gomp_load_plugin_for_device): Remove old interface, adjust to load ++ new async interface. ++ (gomp_target_fini): Adjust code to call gomp_fini_device. ++ ++ * plugin/plugin-nvptx.c (struct cuda_map): Remove. ++ (struct ptx_stream): Remove. ++ (struct nvptx_thread): Remove current_stream field. ++ (cuda_map_create): Remove. ++ (cuda_map_destroy): Remove. ++ (map_init): Remove. ++ (map_fini): Remove. ++ (map_pop): Remove. ++ (map_push): Remove. ++ (struct goacc_asyncqueue): Define. ++ (struct nvptx_callback): Define. ++ (struct ptx_free_block): Define. ++ (struct ptx_device): Remove null_stream, active_streams, async_streams, ++ stream_lock, and next fields. ++ (enum ptx_event_type): Remove. ++ (struct ptx_event): Remove. ++ (ptx_event_lock): Remove. ++ (ptx_events): Remove. ++ (init_streams_for_device): Remove. ++ (fini_streams_for_device): Remove. ++ (select_stream_for_async): Remove. ++ (nvptx_init): Remove ptx_events and ptx_event_lock references. ++ (nvptx_attach_host_thread_to_device): Remove CUDA_ERROR_NOT_PERMITTED ++ case. ++ (nvptx_open_device): Add free_blocks initialization, remove ++ init_streams_for_device call. ++ (nvptx_close_device): Remove fini_streams_for_device call, add ++ free_blocks destruct code. ++ (event_gc): Remove. ++ (event_add): Remove. ++ (nvptx_exec): Adjust parameters and code. ++ (nvptx_free): Likewise. ++ (nvptx_host2dev): Remove. ++ (nvptx_dev2host): Remove. ++ (nvptx_set_async): Remove. ++ (nvptx_async_test): Remove. ++ (nvptx_async_test_all): Remove. ++ (nvptx_wait): Remove. ++ (nvptx_wait_async): Remove. ++ (nvptx_wait_all): Remove. ++ (nvptx_wait_all_async): Remove. ++ (nvptx_get_cuda_stream): Remove. ++ (nvptx_set_cuda_stream): Remove. ++ (GOMP_OFFLOAD_alloc): Adjust code. ++ (GOMP_OFFLOAD_free): Likewise. ++ (GOMP_OFFLOAD_openacc_register_async_cleanup): Remove. ++ (GOMP_OFFLOAD_openacc_exec): Adjust parameters and code. ++ (GOMP_OFFLOAD_openacc_async_test_all): Remove. ++ (GOMP_OFFLOAD_openacc_async_wait): Remove. ++ (GOMP_OFFLOAD_openacc_async_wait_async): Remove. ++ (GOMP_OFFLOAD_openacc_async_wait_all): Remove. ++ (GOMP_OFFLOAD_openacc_async_wait_all_async): Remove. ++ (GOMP_OFFLOAD_openacc_async_set_async): Remove. ++ (cuda_free_argmem): New function. ++ (GOMP_OFFLOAD_openacc_async_exec): New plugin hook function. ++ (GOMP_OFFLOAD_openacc_create_thread_data): Adjust code. ++ (GOMP_OFFLOAD_openacc_cuda_get_stream): Adjust code. ++ (GOMP_OFFLOAD_openacc_cuda_set_stream): Adjust code. ++ (GOMP_OFFLOAD_openacc_async_construct): New plugin hook function. ++ (GOMP_OFFLOAD_openacc_async_destruct): New plugin hook function. ++ (GOMP_OFFLOAD_openacc_async_test): Remove and re-implement. ++ (GOMP_OFFLOAD_openacc_async_synchronize): New plugin hook function. ++ (GOMP_OFFLOAD_openacc_async_serialize): New plugin hook function. ++ (GOMP_OFFLOAD_openacc_async_queue_callback): New plugin hook function. ++ (cuda_callback_wrapper): New function. ++ (cuda_memcpy_sanity_check): New function. ++ (GOMP_OFFLOAD_host2dev): Remove and re-implement. ++ (GOMP_OFFLOAD_dev2host): Remove and re-implement. ++ (GOMP_OFFLOAD_openacc_async_host2dev): New plugin hook function. ++ (GOMP_OFFLOAD_openacc_async_dev2host): New plugin hook function. ++ ++2019-05-07 Thomas Schwinge ++ ++ PR target/87835 ++ * testsuite/libgomp.oacc-c-c++-common/pr87835.c: Update. ++ ++2019-05-06 Thomas Schwinge ++ ++ * oacc-parallel.c: Add comments to legacy entry points (GCC 5). ++ ++2019-03-27 Kevin Buettner ++ ++ * team.c (gomp_team_start): Initialize pool->threads[0]. ++ ++2019-02-22 Thomas Schwinge ++ ++ * testsuite/libgomp.oacc-c++/c++.exp: Specify ++ "-foffload=3D$offload_target". ++ * testsuite/libgomp.oacc-c/c.exp: Likewise. ++ * testsuite/libgomp.oacc-fortran/fortran.exp: Likewise. ++ * testsuite/lib/libgomp.exp ++ (check_effective_target_openacc_nvidia_accel_configured): Remove, ++ as (conceptually) merged into ++ check_effective_target_openacc_nvidia_accel_selected. Adjust all ++ users. ++ ++ * plugin/configfrag.ac: Populate and AC_SUBST offload_targets. ++ * testsuite/libgomp-test-support.exp.in: Adjust. ++ * testsuite/lib/libgomp.exp: Likewise. Don't populate ++ openacc_device_types_s. ++ (offload_target_to_openacc_device_type): New proc. ++ * testsuite/libgomp.oacc-c++/c++.exp: Adjust. ++ * testsuite/libgomp.oacc-c/c.exp: Likewise. ++ * testsuite/libgomp.oacc-fortran/fortran.exp: Likewise. ++ * Makefile.in: Regenerate. ++ * configure: Likewise. ++ * testsuite/Makefile.in: Likewise. ++ ++ * plugin/configfrag.ac: Populate and AC_SUBST offload_plugins ++ instead of offload_targets, and AC_DEFINE_UNQUOTED OFFLOAD_PLUGINS ++ instead of OFFLOAD_TARGETS. ++ * target.c (gomp_target_init): Adjust. ++ * testsuite/libgomp-test-support.exp.in: Likewise. ++ * testsuite/lib/libgomp.exp: Likewise. Populate ++ openacc_device_types_s instead of offload_targets_s_openacc. ++ (check_effective_target_openacc_nvidia_accel_selected) ++ (check_effective_target_openacc_host_selected): Adjust. ++ * testsuite/libgomp.oacc-c++/c++.exp: Likewise. ++ * testsuite/libgomp.oacc-c/c.exp: Likewise. ++ * testsuite/libgomp.oacc-fortran/fortran.exp: Likewise. ++ * Makefile.in: Regenerate. ++ * config.h.in: Likewise. ++ * configure: Likewise. ++ * testsuite/Makefile.in: Likewise. ++ ++ * testsuite/lib/libgomp.exp: Error out for unknown offload target. ++ * testsuite/libgomp.oacc-c++/c++.exp: Likewise. Report if ++ "offloading: supported, but hardware not accessible". ++ * testsuite/libgomp.oacc-c/c.exp: Likewise. ++ * testsuite/libgomp.oacc-fortran/fortran.exp: Likewise. ++ ++2019-02-19 Chung-Lin Tang ++ ++ PR c/87924 ++ * oacc-parallel.c (GOACC_parallel_keyed): Remove condition on call to ++ goacc_wait(). ++ (goacc_wait): Handle ACC_ASYNC_NOVAL case, remove goacc_thread() call ++ and related adjustment. ++ ++2019-01-30 Jakub Jelinek ++ ++ PR c++/88988 ++ * testsuite/libgomp.c++/pr88988.C: New test. ++ ++2019-01-28 Jakub Jelinek ++ ++ PR middle-end/89002 ++ * testsuite/libgomp.c/pr89002.c: New test. ++ ++2019-01-28 Richard Biener ++ ++ PR testsuite/89064 ++ PR tree-optimization/86865 ++ * testsuite/libgomp.graphite/force-parallel-5.c: XFAIL. ++ ++2019-01-24 Tom de Vries ++ ++ * plugin/plugin-nvptx.c (GOMP_OFFLOAD_fini_device): Free ptx_devices ++ once instantiated_devices drops to 0. ++ ++2019-01-23 Tom de Vries ++ ++ PR target/PR88946 ++ * plugin/plugin-nvptx.c (cuda_map_destroy): Use CUDA_CALL_NOCHECK for ++ cuMemFree. ++ (nvptx_exec): Don't call map_push if mapnum =3D=3D 0. ++ * testsuite/libgomp.oacc-c-c++-common/pr88946.c: New test. ++ ++2019-01-23 Tom de Vries ++ ++ PR target/88941 ++ PR target/88939 ++ * plugin/plugin-nvptx.c (cuda_map_destroy): Handle map->active case. ++ (map_fini): Remove "assert (!s->map->active)". ++ * testsuite/libgomp.oacc-c-c++-common/pr88941.c: New test. ++ ++2019-01-23 Tom de Vries ++ ++ PR target/87835 ++ * plugin/plugin-nvptx.c (map_push): Fix adding of allocated element. ++ * testsuite/libgomp.oacc-c-c++-common/pr87835.c: New test. ++ ++2019-01-15 Tom de Vries ++ ++ PR target/80547 ++ * testsuite/libgomp.oacc-c-c++-common/gang-reduction-var-assignment.c: ++ New test. ++ ++2019-01-12 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/pr85486-2.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/vector-length-128-2.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/vector-length-128-5.c: New test. ++ * testsuite/libgomp.oacc-fortran/gemm-2.f90: New test. ++ ++2019-01-12 Tom de Vries ++ ++ * plugin/plugin-nvptx.c (nvptx_exec): Update error message. ++ ++2019-01-12 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/vector-length-64-1.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/vector-length-64-2.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/vector-length-64-3.c: New test. ++ ++2019-01-12 Tom de Vries ++ ++ PR target/85486 ++ * testsuite/libgomp.oacc-c-c++-common/pr85486-3.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/pr85486.c: New test. ++ ++2019-01-12 Tom de Vries ++ ++ PR target/85381 ++ * testsuite/libgomp.oacc-c-c++-common/pr85381-5.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/pr85381.c: New test. ++ ++2019-01-12 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/vred2d-128.c: New test. ++ * testsuite/libgomp.oacc-fortran/gemm.f90: New test. ++ * testsuite/libgomp.oacc-c-c++-common/vector-length-128-10.c: New test. ++ ++2019-01-12 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/vector-length-128-7.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/vector-length-128-4.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/vector-length-128-6.c: New test. ++ ++2019-01-12 Tom de Vries ++ ++ * plugin/plugin-nvptx.c (nvptx_exec): Update insufficient hardware ++ resources diagnostic. ++ ++2019-01-12 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/vector-length-128-1.c: Expect ++ vector length to be 128. ++ * testsuite/libgomp.oacc-c-c++-common/parallel-dims.c: Expect vector ++ length 2097152 to be reduced to 1024 instead of 32. ++ ++2019-01-11 Thomas Schwinge ++ James Norris ++ ++ * libgomp.texi: Better distinguish OpenACC and OpenMP "Runtime ++ Library Routines", and "Environment Variables". ++ ++2019-01-11 Tom de Vries ++ ++ * plugin/plugin-nvptx.c (nvptx_exec): Prevent vector_length 64 and ++ num_workers 16. ++ ++2019-01-11 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/reduction-1.c: Remove ++ -foffload=3D-w. ++ * testsuite/libgomp.oacc-c-c++-common/reduction-2.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/reduction-3.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/reduction-4.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/reduction-5.c: Same. ++ ++2019-01-11 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/insufficient-resources.c: New ++ test. ++ ++2019-01-10 Nathan Sidwell ++ Julian Brown ++ ++ PR lto/71959 ++ * testsuite/libgomp.oacc-c++/pr71959-aux.cc: New. ++ * testsuite/libgomp.oacc-c++/pr71959.C: New. ++ ++2019-01-09 Sebastian Huber ++ ++ * config/rtems/bar.c: Include "../linux/bar.c" and delete copy ++ and paste code. ++ ++2019-01-09 Sebastian Huber ++ ++ * config/rtems/affinity-fmt.c: New file. Include affinity-fmt.c, ++ undefining HAVE_GETPID and HAVE_GETHOSTNAME, and mapping fwrite to ++ write. ++ ++2019-01-09 Tom de Vries ++ ++ PR target/88756 ++ * testsuite/libgomp.oacc-c-c++-common/reduction-1.c (ng, nw, vl): Use ++ #define instead of "const int". ++ * testsuite/libgomp.oacc-c-c++-common/reduction-2.c (ng, nw, vl): Same. ++ * testsuite/libgomp.oacc-c-c++-common/reduction-3.c (ng, nw, vl): Same. ++ * testsuite/libgomp.oacc-c-c++-common/reduction-4.c (ng, nw, vl): Same. ++ * testsuite/libgomp.oacc-c-c++-common/reduction-5.c (ng, nw, vl): Same. ++ ++2019-01-09 Tom de Vries ++ ++ * plugin/plugin-nvptx.c (nvptx_exec): Make sure to launch with at least ++ one worker. ++ ++2019-01-07 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/vector-length-128-3.c: Fix ++ GOMP_OPENACC_DIM argument. ++ ++2019-01-03 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/vector-length-128-1.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/vector-length-128-3.c: New test. ++ ++2019-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++2019-01-01 Jakub Jelinek ++ ++ * libgomp.texi: Bump @copying's copyright year. ++ ++2018-12-28 Thomas Schwinge ++ ++ * oacc-parallel.c (GOACC_parallel_keyed, GOACC_parallel) ++ (GOACC_data_start, GOACC_enter_exit_data, GOACC_update) ++ (GOACC_declare): Redefine the "device" argument to "flags". ++ ++2018-12-28 Thomas Schwinge ++ Cesar Philippidis ++ ++ * target.c (struct gomp_coalesce_chunk): New structure. ++ (struct gomp_coalesce_buf): Update the chunks member to use that ++ type. Adjust all users. ++ ++2018-12-19 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/pr85381-2.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/pr85381-3.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/pr85381-4.c: New test. ++ ++2018-12-19 Tom de Vries ++ ++ * testsuite/lib/libgomp.exp: Add load_lib of scanoffloadrtl.exp. ++ * testsuite/libgomp.oacc-c-c++-common/nvptx-merged-loop.c: Move from ++ gcc/testsuite/gcc.dg/goacc. ++ * testsuite/libgomp.oacc-c-c++-common/nvptx-sese-1.c: Same. ++ ++2018-12-14 Thomas Schwinge ++ Chung-Lin Tang ++ ++ * oacc-mem.c (acc_present_or_create): Remove definition and change ++ to alias of acc_create. ++ (acc_present_or_copyin): Remove definition and change to alias of ++ acc_copyin. ++ * oacc-parallel.c (GOACC_enter_exit_data): Call acc_create instead ++ of acc_present_or_create. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-1.c: Remove. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-2.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-3.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-4.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-5.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-6.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-7.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-8.c: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-already-1.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-already-2.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-already-3.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-already-4.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-already-5.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-already-6.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-already-7.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-already-8.f: Likewise. ++ ++2018-12-14 Thomas Schwinge ++ ++ PR libgomp/88495 ++ * plugin/plugin-nvptx.c (nvptx_wait_async): Don't refuse ++ "identical parameters". ++ * testsuite/libgomp.oacc-c-c++-common/asyncwait-nop-1.c: Update. ++ * testsuite/libgomp.oacc-c-c++-common/lib-80.c: Remove. ++ ++ PR libgomp/88484 ++ * oacc-parallel.c (GOACC_wait): Correct handling for "async >=3D 0". ++ * testsuite/libgomp.oacc-c-c++-common/asyncwait-nop-1.c: New file. ++ ++ PR libgomp/88407 ++ * plugin/plugin-nvptx.c (nvptx_async_test, nvptx_wait) ++ (nvptx_wait_async): Unseen async-argument is a no-op. ++ * testsuite/libgomp.oacc-c-c++-common/async_queue-1.c: Update. ++ * testsuite/libgomp.oacc-c-c++-common/data-2-lib.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-2.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/lib-79.c: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-12.f90: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/lib-71.c: Merge into... ++ * testsuite/libgomp.oacc-c-c++-common/lib-69.c: ... this. Update. ++ * testsuite/libgomp.oacc-c-c++-common/lib-77.c: Merge into... ++ * testsuite/libgomp.oacc-c-c++-common/lib-74.c: ... this. Update ++ ++ * testsuite/libgomp.oacc-c-c++-common/data-2-lib.c: Revise. ++ * testsuite/libgomp.oacc-c-c++-common/data-2.c: Likewise. ++ ++2018-12-14 Chung-Lin Tang ++ ++ * testsuite/libgomp.oacc-c-c++-common/data-2-lib.c: Adjust. ++ * testsuite/libgomp.oacc-c-c++-common/data-2.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-3.c: Likewise. ++ ++2018-12-14 Thomas Schwinge ++ ++ PR libgomp/88370 ++ * libgomp.texi (acc_get_current_cuda_context, acc_get_cuda_stream) ++ (acc_set_cuda_stream): Clarify. ++ * oacc-cuda.c (acc_get_cuda_stream, acc_set_cuda_stream): Use ++ "async_valid_p". ++ * plugin/plugin-nvptx.c (nvptx_set_cuda_stream): Refuse "async =3D=3D ++ acc_async_sync". ++ * testsuite/libgomp.oacc-c-c++-common/acc_set_cuda_stream-1.c: New file. ++ * testsuite/libgomp.oacc-c-c++-common/async_queue-1.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/lib-84.c: Update. ++ * testsuite/libgomp.oacc-c-c++-common/lib-85.c: Likewise. ++ ++2018-12-14 Tom de Vries ++ ++ * testsuite/libgomp.c-c++-common/function-not-offloaded-aux.c: New test. ++ * testsuite/libgomp.c-c++-common/function-not-offloaded.c: New test. ++ * testsuite/libgomp.c-c++-common/variable-not-offloaded.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/function-not-offloaded.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/variable-not-offloaded.c: New test. ++ ++2018-12-13 Tom de Vries ++ ++ * affinity-fmt.c (gomp_print_string): New function, factored out of ... ++ (omp_display_affinity, gomp_display_affinity_thread): ... here, and ... ++ * fortran.c (omp_display_affinity_): ... here. ++ * libgomp.h (gomp_print_string): Declare. ++ * config/nvptx/affinity-fmt.c: New file. Include affinity-fmt.c, ++ undefining HAVE_GETPID and HAVE_GETHOSTNAME, and mapping fwrite to ++ write. ++ ++2018-12-13 Jakub Jelinek ++ ++ PR libgomp/88460 ++ * testsuite/libgomp.c++/for-24.C (results): Include it in ++ omp declare target region. ++ (main): Use map (always, tofrom: results) instead of ++ map (tofrom: results). ++ ++2018-12-12 Jakub Jelinek ++ ++ PR fortran/88463 ++ * testsuite/libgomp.fortran/pr88463-1.f90: New test. ++ * testsuite/libgomp.fortran/pr88463-2.f90: New test. ++ ++ * testsuite/libgomp.c-c++-common/for-16.c: New test. ++ ++2018-12-12 Andreas Schwab ++ ++ * config/linux/ia64/futex.h (sys_futex0): Don't mark r12 as ++ clobbered. ++ ++2018-12-09 Thomas Koenig ++ ++ PR fortran/88411 ++ * testsuite/libgomp.fortran/async_io_8.f90: New test. ++ ++2018-12-09 Thomas Schwinge ++ Jakub Jelinek ++ ++ * target.c (gomp_map_vars): Call gomp_copy_host2dev instead of ++ devicep->host2dev_func. ++ ++2018-12-08 Jakub Jelinek ++ ++ PR libgomp/87995 ++ * testsuite/libgomp.c-c++-common/cancel-taskgroup-3.c: Require ++ tls_runtime effective target. ++ (t): New threadprivate variable. ++ (main): Set t in threads which execute iterations of the worksharing ++ loop. Propagate that to the task after the loop and don't abort ++ if the current taskgroup hasn't been cancelled. ++ ++2018-12-02 Jakub Jelinek ++ ++ * testsuite/libgomp.c/task-reduction-3.c: New test. ++ ++ * testsuite/libgomp.c-c++-common/cancel-taskgroup-4.c: New test. ++ ++2018-11-30 Cesar Philippidis ++ ++ PR libgomp/88288 ++ * oacc-parallel.c (GOACC_parallel_keyed): Add offset to devaddrs. ++ * testsuite/libgomp.oacc-c-c++-common/pr88288.c: New test. ++ ++2018-11-30 Thomas Schwinge ++ ++ * testsuite/libgomp.oacc-fortran/lib-16-2.f90: New file. ++ ++2018-10-19 Richard Biener ++ ++ PR tree-optimization/88182 ++ * testsuite/libgomp.c++/pr88182.C: Move to g++.dg/gomp. ++ ++2018-11-26 Jakub Jelinek ++ ++ * testsuite/Makefile.am (AUTOMAKE_OPTIONS): Drop dejagnu. ++ (RUNTEST): Don't define. ++ (RUNTESTDEFAULTFLAGS): Add. ++ (check-DEJAGNU, site.exp, distclean-DEJAGNU): New goals. ++ (distclean-am): Depend on distclean-DEJAGNU. ++ (check-am): If -j% option is present in MFLAGS and if ++ `getconf _NPROCESSORS_ONLN` is more than 8, export OMP_NUM_THREADS=3D8. ++ (.PHONY): Add check-DEJAGNU and distclean-DEJAGNU. ++ * testsuite/Makefile.in: Regenerated. ++ ++2018-11-26 Richard Biener ++ ++ PR tree-optimization/88182 ++ * testsuite/libgomp.c++/pr88182.C: New testcase. ++ ++2018-11-20 Jakub Jelinek ++ ++ PR bootstrap/88106 ++ * config/mingw32/affinity-fmt.c: New file. ++ ++2018-11-09 Jakub Jelinek ++ ++ * affinity-fmt.c: Include inttypes.h if HAVE_INTTYPES_H. ++ (gomp_display_affinity): Use __builtin_choose_expr to handle ++ properly handle argument having integral, or pointer or some other ++ type. If inttypes.h is available and PRIx64 is defined, use PRIx64 ++ with uint64_t type instead of %llx and unsigned long long. ++ ++ * testsuite/libgomp.c-c++-common/task-reduction-13.c: New test. ++ * testsuite/libgomp.c-c++-common/task-reduction-14.c: New test. ++ ++2018-11-08 Rainer Orth ++ ++ * affinity.c: Include , . ++ (gomp_display_affinity_place): Remove cpusetp. ++ * teams.c: Include . ++ ++2018-11-08 Jakub Jelinek ++ ++ * testsuite/libgomp.c-c++-common/task-reduction-8.c (bar): Add ++ in_reduction clause for s[0]. ++ ++ * affinity.c (gomp_display_affinity_place): New function. ++ * affinity-fmt.c: New file. ++ * alloc.c (gomp_aligned_alloc, gomp_aligned_free): New functions. ++ * config/linux/affinity.c (gomp_display_affinity_place): New function. ++ * config/nvptx/icv-device.c (omp_get_num_teams, omp_get_team_num): ++ Move these functions to ... ++ * config/nvptx/teams.c: ... here. New file. ++ * config/nvptx/target.c (omp_pause_resource, omp_pause_resource_all): ++ New functions. ++ * config/nvptx/team.c (gomp_team_start, gomp_pause_host): New ++ functions. ++ * configure.ac: Check for aligned_alloc, posix_memalign, memalign ++ and _aligned_malloc. ++ (HAVE_UNAME, HAVE_GETHOSTNAME, HAVE_GETPID): Add new tests. ++ * configure.tgt: Add -DUSING_INITIAL_EXEC_TLS to XCFLAGS for Linux. ++ * env.c (gomp_display_affinity_var, gomp_affinity_format_var, ++ gomp_affinity_format_len): New variables. ++ (parse_schedule): Parse monotonic and nonmonotonic modifiers in ++ OMP_SCHEDULE variable. Set GFS_MONOTONIC for monotonic schedules. ++ (handle_omp_display_env): Display monotonic/nonmonotonic schedule ++ modifiers. Display (non-default) chunk sizes. Print ++ OMP_DISPLAY_AFFINITY and OMP_AFFINITY_FORMAT. ++ (initialize_env): Don't call pthread_attr_setdetachstate. Handle ++ OMP_DISPLAY_AFFINITY and OMP_AFFINITY_FORMAT env vars. ++ * fortran.c: Include stdio.h and string.h. ++ (omp_pause_resource, omp_pause_resource_all): Add ialias_redirect. ++ (omp_get_schedule_, omp_get_schedule_8_): Mask off GFS_MONOTONIC bit. ++ (omp_set_affinity_format_, omp_get_affinity_format_, ++ omp_display_affinity_, omp_capture_affinity_, omp_pause_resource_, ++ omp_pause_resource_all_): New functions. ++ * icv.c (omp_set_schedule): Mask off omp_sched_monotonic bit in ++ switch. ++ * icv-device.c (omp_get_num_teams, omp_get_team_num): Move these ++ functions to ... ++ * teams.c: ... here. New file. ++ * libgomp_g.h: Include gstdint.h. ++ (GOMP_loop_nonmonotonic_runtime_start, ++ GOMP_loop_maybe_nonmonotonic_runtime_start, GOMP_loop_start, ++ GOMP_loop_ordered_start, GOMP_loop_nonmonotonic_runtime_next, ++ GOMP_loop_maybe_nonmonotonic_runtime_next, GOMP_loop_doacross_start, ++ GOMP_parallel_loop_nonmonotonic_runtime, ++ GOMP_parallel_loop_maybe_nonmonotonic_runtime, ++ GOMP_loop_ull_nonmonotonic_runtime_start, ++ GOMP_loop_ull_maybe_nonmonotonic_runtime_start, GOMP_loop_ull_start, ++ GOMP_loop_ull_ordered_start, GOMP_loop_ull_nonmonotonic_runtime_next, ++ GOMP_loop_ull_maybe_nonmonotonic_runtime_next, ++ GOMP_loop_ull_doacross_start, GOMP_parallel_reductions, ++ GOMP_taskwait_depend, GOMP_taskgroup_reduction_register, ++ GOMP_taskgroup_reduction_unregister, GOMP_task_reduction_remap, ++ GOMP_workshare_task_reduction_unregister, GOMP_sections2_start, ++ GOMP_teams_reg): Declare. ++ * libgomp.h (GOMP_HAVE_EFFICIENT_ALIGNED_ALLOC): Define unless ++ gomp_aligned_alloc uses fallback implementation. ++ (gomp_aligned_alloc, gomp_aligned_free): Declare. ++ (enum gomp_schedule_type): Add GFS_MONOTONIC. ++ (struct gomp_doacross_work_share): Add extra field. ++ (struct gomp_work_share): Add task_reductions field. ++ (struct gomp_taskgroup): Add workshare and reductions fields. ++ (GOMP_NEEDS_THREAD_HANDLE): Define if needed. ++ (gomp_thread_handle): New typedef. ++ (gomp_display_affinity_place, gomp_set_affinity_format, ++ gomp_display_string, gomp_display_affinity, ++ gomp_display_affinity_thread): Declare. ++ (gomp_doacross_init, gomp_doacross_ull_init): Add size_t argument. ++ (gomp_parallel_reduction_register, gomp_workshare_taskgroup_start, ++ gomp_workshare_task_reduction_register): Declare. ++ (gomp_team_start): Add taskgroup argument. ++ (gomp_pause_host): Declare. ++ (gomp_init_work_share, gomp_work_share_start): Change bool argument ++ to size_t. ++ (gomp_thread_self, gomp_thread_to_pthread_t): New inline functions. ++ * libgomp.map (GOMP_5.0): Export GOMP_loop_start, ++ GOMP_loop_ordered_start, GOMP_loop_doacross_start, ++ GOMP_loop_ull_start, GOMP_loop_ull_ordered_start, ++ GOMP_loop_ull_doacross_start, ++ GOMP_workshare_task_reduction_unregister, GOMP_sections2_start, ++ GOMP_loop_maybe_nonmonotonic_runtime_next, ++ GOMP_loop_maybe_nonmonotonic_runtime_start, ++ GOMP_loop_nonmonotonic_runtime_next, ++ GOMP_loop_nonmonotonic_runtime_start, ++ GOMP_loop_ull_maybe_nonmonotonic_runtime_next, ++ GOMP_loop_ull_maybe_nonmonotonic_runtime_start, ++ GOMP_loop_ull_nonmonotonic_runtime_next, ++ GOMP_loop_ull_nonmonotonic_runtime_start, ++ GOMP_parallel_loop_maybe_nonmonotonic_runtime, ++ GOMP_parallel_loop_nonmonotonic_runtime, GOMP_parallel_reductions, ++ GOMP_taskgroup_reduction_register, ++ GOMP_taskgroup_reduction_unregister, GOMP_task_reduction_remap, ++ GOMP_teams_reg and GOMP_taskwait_depend. ++ (OMP_5.0): Export omp_pause_resource{,_all}{,_}, ++ omp_{capture,display}_affinity{,_}, and ++ omp_[gs]et_affinity_format{,_}. ++ * loop.c: Include string.h. ++ (GOMP_loop_runtime_next): Add ialias. ++ (GOMP_taskgroup_reduction_register): Add ialias_redirect. ++ (gomp_loop_static_start, gomp_loop_dynamic_start, ++ gomp_loop_guided_start, gomp_loop_ordered_static_start, ++ gomp_loop_ordered_dynamic_start, gomp_loop_ordered_guided_start, ++ gomp_loop_doacross_static_start, gomp_loop_doacross_dynamic_start, ++ gomp_loop_doacross_guided_start): Adjust gomp_work_share_start ++ or gomp_doacross_init callers. ++ (gomp_adjust_sched, GOMP_loop_start, GOMP_loop_ordered_start, ++ GOMP_loop_doacross_start): New functions. ++ (GOMP_loop_runtime_start, GOMP_loop_ordered_runtime_start, ++ GOMP_loop_doacross_runtime_start, GOMP_parallel_loop_runtime_start): ++ Mask off GFS_MONOTONIC bit. ++ (GOMP_loop_maybe_nonmonotonic_runtime_next, ++ GOMP_loop_maybe_nonmonotonic_runtime_start, ++ GOMP_loop_nonmonotonic_runtime_next, ++ GOMP_loop_nonmonotonic_runtime_start, ++ GOMP_parallel_loop_maybe_nonmonotonic_runtime, ++ GOMP_parallel_loop_nonmonotonic_runtime): New aliases or wrapper ++ functions. ++ (gomp_parallel_loop_start): Pass NULL as taskgroup to ++ gomp_team_start. ++ * loop_ull.c: Include string.h. ++ (GOMP_loop_ull_runtime_next): Add ialias. ++ (GOMP_taskgroup_reduction_register): Add ialias_redirect. ++ (gomp_loop_ull_static_start, gomp_loop_ull_dynamic_start, ++ gomp_loop_ull_guided_start, gomp_loop_ull_ordered_static_start, ++ gomp_loop_ull_ordered_dynamic_start, ++ gomp_loop_ull_ordered_guided_start, ++ gomp_loop_ull_doacross_static_start, ++ gomp_loop_ull_doacross_dynamic_start, ++ gomp_loop_ull_doacross_guided_start): Adjust gomp_work_share_start ++ and gomp_doacross_ull_init callers. ++ (gomp_adjust_sched, GOMP_loop_ull_start, GOMP_loop_ull_ordered_start, ++ GOMP_loop_ull_doacross_start): New functions. ++ (GOMP_loop_ull_runtime_start, ++ GOMP_loop_ull_ordered_runtime_start, ++ GOMP_loop_ull_doacross_runtime_start): Mask off GFS_MONOTONIC bit. ++ (GOMP_loop_ull_maybe_nonmonotonic_runtime_next, ++ GOMP_loop_ull_maybe_nonmonotonic_runtime_start, ++ GOMP_loop_ull_nonmonotonic_runtime_next, ++ GOMP_loop_ull_nonmonotonic_runtime_start): Likewise. ++ * Makefile.am (libgomp_la_SOURCES): Add teams.c and affinity-fmt.c. ++ * omp.h.in (enum omp_sched_t): Add omp_sched_monotonic. ++ (omp_pause_resource_t, omp_depend_t): New typedefs. ++ (enum omp_lock_hint_t): Renamed to ... ++ (enum omp_sync_hint_t): ... this. Define omp_sync_hint_* ++ enumerators using numbers and omp_lock_hint_* as their aliases. ++ (omp_lock_hint_t): New typedef. Rename to ... ++ (omp_sync_hint_t): ... this. ++ (omp_init_lock_with_hint, omp_init_nest_lock_with_hint): Use ++ omp_sync_hint_t instead of omp_lock_hint_t. ++ (omp_pause_resource, omp_pause_resource_all, omp_set_affinity_format, ++ omp_get_affinity_format, omp_display_affinity, omp_capture_affinity): ++ Declare. ++ (omp_target_is_present, omp_target_disassociate_ptr): ++ Change first argument from void * to const void *. ++ (omp_target_memcpy, omp_target_memcpy_rect): Change second argument ++ from void * to const void *. ++ (omp_target_associate_ptr): Change first and second arguments from ++ void * to const void *. ++ * omp_lib.f90.in (omp_pause_resource_kind, omp_pause_soft, ++ omp_pause_hard): New parameters. ++ (omp_pause_resource, omp_pause_resource_all, omp_set_affinity_format, ++ omp_get_affinity_format, omp_display_affinity, omp_capture_affinity): ++ New interfaces. ++ * omp_lib.h.in (omp_pause_resource_kind, omp_pause_soft, ++ omp_pause_hard): New parameters. ++ (omp_pause_resource, omp_pause_resource_all, omp_set_affinity_format, ++ omp_get_affinity_format, omp_display_affinity, omp_capture_affinity): ++ New externals. ++ * ordered.c (gomp_doacross_init, gomp_doacross_ull_init): Add ++ EXTRA argument. If not needed to prepare array, if extra is 0, ++ clear ws->doacross, otherwise allocate just doacross structure and ++ extra payload. If array is needed, allocate also extra payload. ++ (GOMP_doacross_post, GOMP_doacross_wait, GOMP_doacross_ull_post, ++ GOMP_doacross_ull_wait): Handle doacross->array =3D=3D NULL like ++ doacross =3D=3D NULL. ++ * parallel.c (GOMP_parallel_start): Pass NULL as taskgroup to ++ gomp_team_start. ++ (GOMP_parallel): Likewise. Formatting fix. ++ (GOMP_parallel_reductions): New function. ++ (GOMP_cancellation_point): If taskgroup has workshare ++ flag set, check cancelled of prev taskgroup if any. ++ (GOMP_cancel): If taskgroup has workshare flag set, set cancelled ++ on prev taskgroup if any. ++ * sections.c: Include string.h. ++ (GOMP_taskgroup_reduction_register): Add ialias_redirect. ++ (GOMP_sections_start): Adjust gomp_work_share_start caller. ++ (GOMP_sections2_start): New function. ++ (GOMP_parallel_sections_start, GOMP_parallel_sections): ++ Pass NULL as taskgroup to gomp_team_start. ++ * single.c (GOMP_single_start, GOMP_single_copy_start): Adjust ++ gomp_work_share_start callers. ++ * target.c (GOMP_target_update_ext, GOMP_target_enter_exit_data): ++ If taskgroup has workshare flag set, check cancelled on prev ++ taskgroup if any. Guard all cancellation tests with ++ gomp_cancel_var test. ++ (omp_target_is_present, omp_target_disassociate_ptr): ++ Change ptr argument from void * to const void *. ++ (omp_target_memcpy): Change src argument from void * to const void *. ++ (omp_target_memcpy_rect): Likewise. ++ (omp_target_memcpy_rect_worker): Likewise. Use const char * casts ++ instead of char * where needed. ++ (omp_target_associate_ptr): Change host_ptr and device_ptr arguments ++ from void * to const void *. ++ (omp_pause_resource, omp_pause_resource_all): New functions. ++ * task.c (gomp_task_handle_depend): Handle new depend array format ++ in addition to the old. Handle mutexinoutset kinds the same as ++ inout for now, handle unspecified kinds. ++ (gomp_create_target_task): If taskgroup has workshare flag set, check ++ cancelled on prev taskgroup if any. Guard all cancellation tests with ++ gomp_cancel_var test. Handle new depend array format count in ++ addition to the old. ++ (GOMP_task): Likewise. Adjust function comment. ++ (gomp_task_run_pre): If taskgroup has workshare flag set, check ++ cancelled on prev taskgroup if any. Guard all cancellation tests with ++ gomp_cancel_var test. ++ (GOMP_taskwait_depend): New function. ++ (gomp_task_maybe_wait_for_dependencies): Handle new depend array ++ format in addition to the old. Handle mutexinoutset kinds the same as ++ inout for now, handle unspecified kinds. Fix a function comment typo. ++ (gomp_taskgroup_init): New function. ++ (GOMP_taskgroup_start): Use it. ++ (gomp_reduction_register, gomp_create_artificial_team, ++ GOMP_taskgroup_reduction_register, ++ GOMP_taskgroup_reduction_unregister, GOMP_task_reduction_remap, ++ gomp_parallel_reduction_register, ++ gomp_workshare_task_reduction_register, ++ gomp_workshare_taskgroup_start, ++ GOMP_workshare_task_reduction_unregister): New functions. ++ * taskloop.c (GOMP_taskloop): If taskgroup has workshare flag set, ++ check cancelled on prev taskgroup if any. Guard all cancellation ++ tests with gomp_cancel_var test. Handle GOMP_TASK_FLAG_REDUCTION flag ++ by calling GOMP_taskgroup_reduction_register. ++ * team.c (gomp_thread_attr): Remove comment. ++ (struct gomp_thread_start_data): Add handle field. ++ (gomp_thread_start): Call pthread_detach. ++ (gomp_new_team): Adjust gomp_init_work_share caller. ++ (gomp_free_pool_helper): Call pthread_detach. ++ (gomp_team_start): Add taskgroup argument, initialize implicit ++ tasks' taskgroup field to that. Don't call ++ pthread_attr_setdetachstate. Handle OMP_DISPLAY_AFFINITY env var. ++ (gomp_team_end): Determine nesting by thr->ts.level !=3D 0 ++ rather than thr->ts.team !=3D NULL. ++ (gomp_pause_pool_helper, gomp_pause_host): New functions. ++ * work.c (alloc_work_share): Use gomp_aligned_alloc instead of ++ gomp_malloc if GOMP_HAVE_EFFICIENT_ALIGNED_ALLOC is defined. ++ (gomp_init_work_share): Change ORDERED argument from bool to size_t, ++ if more than 1 allocate also extra payload at the end of array. Never ++ keep ordered_team_ids NULL, set it to inline_ordered_team_ids instead. ++ (gomp_work_share_start): Change ORDERED argument from bool to size_t, ++ return true instead of ws. ++ * Makefile.in: Regenerated. ++ * configure: Regenerated. ++ * config.h.in: Regenerated. ++ * testsuite/libgomp.c/cancel-for-2.c (foo): Use cancel modifier ++ in some cases. ++ * testsuite/libgomp.c-c++-common/cancel-parallel-1.c: New test. ++ * testsuite/libgomp.c-c++-common/cancel-taskgroup-3.c: New test. ++ * testsuite/libgomp.c-c++-common/depend-iterator-1.c: New test. ++ * testsuite/libgomp.c-c++-common/depend-iterator-2.c: New test. ++ * testsuite/libgomp.c-c++-common/depend-mutexinout-1.c: New test. ++ * testsuite/libgomp.c-c++-common/depend-mutexinout-2.c: New test. ++ * testsuite/libgomp.c-c++-common/depobj-1.c: New test. ++ * testsuite/libgomp.c-c++-common/display-affinity-1.c: New test. ++ * testsuite/libgomp.c-c++-common/for-10.c: New test. ++ * testsuite/libgomp.c-c++-common/for-11.c: New test. ++ * testsuite/libgomp.c-c++-common/for-12.c: New test. ++ * testsuite/libgomp.c-c++-common/for-13.c: New test. ++ * testsuite/libgomp.c-c++-common/for-14.c: New test. ++ * testsuite/libgomp.c-c++-common/for-15.c: New test. ++ * testsuite/libgomp.c-c++-common/for-2.h: If CONDNE macro is defined, ++ define a different N(test), don't define N(f0) to N(f14), but instead ++ define N(f20) to N(f34) using !=3D comparisons. ++ * testsuite/libgomp.c-c++-common/for-7.c: New test. ++ * testsuite/libgomp.c-c++-common/for-8.c: New test. ++ * testsuite/libgomp.c-c++-common/for-9.c: New test. ++ * testsuite/libgomp.c-c++-common/master-combined-1.c: New test. ++ * testsuite/libgomp.c-c++-common/pause-1.c: New test. ++ * testsuite/libgomp.c-c++-common/pause-2.c: New test. ++ * testsuite/libgomp.c-c++-common/pr66199-10.c: New test. ++ * testsuite/libgomp.c-c++-common/pr66199-11.c: New test. ++ * testsuite/libgomp.c-c++-common/pr66199-12.c: New test. ++ * testsuite/libgomp.c-c++-common/pr66199-13.c: New test. ++ * testsuite/libgomp.c-c++-common/pr66199-14.c: New test. ++ * testsuite/libgomp.c-c++-common/simd-1.c: New test. ++ * testsuite/libgomp.c-c++-common/taskloop-reduction-1.c: New test. ++ * testsuite/libgomp.c-c++-common/taskloop-reduction-2.c: New test. ++ * testsuite/libgomp.c-c++-common/taskloop-reduction-3.c: New test. ++ * testsuite/libgomp.c-c++-common/taskloop-reduction-4.c: New test. ++ * testsuite/libgomp.c-c++-common/task-reduction-11.c: New test. ++ * testsuite/libgomp.c-c++-common/task-reduction-12.c: New test. ++ * testsuite/libgomp.c-c++-common/task-reduction-1.c: New test. ++ * testsuite/libgomp.c-c++-common/task-reduction-2.c: New test. ++ * testsuite/libgomp.c-c++-common/task-reduction-3.c: New test. ++ * testsuite/libgomp.c-c++-common/task-reduction-4.c: New test. ++ * testsuite/libgomp.c-c++-common/task-reduction-5.c: New test. ++ * testsuite/libgomp.c-c++-common/task-reduction-6.c: New test. ++ * testsuite/libgomp.c-c++-common/task-reduction-7.c: New test. ++ * testsuite/libgomp.c-c++-common/task-reduction-8.c: New test. ++ * testsuite/libgomp.c-c++-common/task-reduction-9.c: New test. ++ * testsuite/libgomp.c-c++-common/taskwait-depend-1.c: New test. ++ * testsuite/libgomp.c++/depend-1.C: New test. ++ * testsuite/libgomp.c++/depend-iterator-1.C: New test. ++ * testsuite/libgomp.c++/depobj-1.C: New test. ++ * testsuite/libgomp.c++/for-16.C: New test. ++ * testsuite/libgomp.c++/for-21.C: New test. ++ * testsuite/libgomp.c++/for-22.C: New test. ++ * testsuite/libgomp.c++/for-23.C: New test. ++ * testsuite/libgomp.c++/for-24.C: New test. ++ * testsuite/libgomp.c++/for-25.C: New test. ++ * testsuite/libgomp.c++/for-26.C: New test. ++ * testsuite/libgomp.c++/taskloop-reduction-1.C: New test. ++ * testsuite/libgomp.c++/taskloop-reduction-2.C: New test. ++ * testsuite/libgomp.c++/taskloop-reduction-3.C: New test. ++ * testsuite/libgomp.c++/taskloop-reduction-4.C: New test. ++ * testsuite/libgomp.c++/task-reduction-10.C: New test. ++ * testsuite/libgomp.c++/task-reduction-11.C: New test. ++ * testsuite/libgomp.c++/task-reduction-12.C: New test. ++ * testsuite/libgomp.c++/task-reduction-13.C: New test. ++ * testsuite/libgomp.c++/task-reduction-14.C: New test. ++ * testsuite/libgomp.c++/task-reduction-15.C: New test. ++ * testsuite/libgomp.c++/task-reduction-16.C: New test. ++ * testsuite/libgomp.c++/task-reduction-17.C: New test. ++ * testsuite/libgomp.c++/task-reduction-18.C: New test. ++ * testsuite/libgomp.c++/task-reduction-19.C: New test. ++ * testsuite/libgomp.c/task-reduction-1.c: New test. ++ * testsuite/libgomp.c++/task-reduction-1.C: New test. ++ * testsuite/libgomp.c/task-reduction-2.c: New test. ++ * testsuite/libgomp.c++/task-reduction-2.C: New test. ++ * testsuite/libgomp.c++/task-reduction-3.C: New test. ++ * testsuite/libgomp.c++/task-reduction-4.C: New test. ++ * testsuite/libgomp.c++/task-reduction-5.C: New test. ++ * testsuite/libgomp.c++/task-reduction-6.C: New test. ++ * testsuite/libgomp.c++/task-reduction-7.C: New test. ++ * testsuite/libgomp.c++/task-reduction-8.C: New test. ++ * testsuite/libgomp.c++/task-reduction-9.C: New test. ++ * testsuite/libgomp.c/teams-1.c: New test. ++ * testsuite/libgomp.c/teams-2.c: New test. ++ * testsuite/libgomp.c/thread-limit-4.c: New test. ++ * testsuite/libgomp.c/thread-limit-5.c: New test. ++ * testsuite/libgomp.fortran/display-affinity-1.f90: New test. ++ ++2018-11-06 Chung-Lin Tang ++ ++ * oacc-mem.c (memcpy_tofrom_device): New function, combined from ++ acc_memcpy_to/from_device functions, now with async parameter. ++ (acc_memcpy_to_device): Modify to use memcpy_tofrom_device. ++ (acc_memcpy_from_device): Likewise. ++ (acc_memcpy_to_device_async): New API function. ++ (acc_memcpy_from_device_async): Likewise. ++ (present_create_copy): Add async parameter and async setting/unsetting. ++ (acc_create): Adjust present_create_copy call. ++ (acc_copyin): Likewise. ++ (acc_present_or_create): Likewise. ++ (acc_present_or_copyin): Likewise. ++ (acc_create_async): New API function. ++ (acc_copyin_async): New API function. ++ (delete_copyout): Add async parameter and async setting/unsetting. ++ (acc_delete): Adjust delete_copyout call. ++ (acc_copyout): Likewise. ++ (acc_delete_async): New API function. ++ (acc_copyout_async): Likewise. ++ (update_dev_host): Add async parameter and async setting/unsetting. ++ (acc_update_device): Adjust update_dev_host call. ++ (acc_update_self): Likewise. ++ (acc_update_device_async): New API function. ++ (acc_update_self_async): Likewise. ++ * openacc.h (acc_copyin_async): Declare new API function. ++ (acc_create_async): Likewise. ++ (acc_copyout_async): Likewise. ++ (acc_delete_async): Likewise. ++ (acc_update_device_async): Likewise. ++ (acc_update_self_async): Likewise. ++ (acc_memcpy_to_device_async): Likewise. ++ (acc_memcpy_from_device_async): Likewise. ++ * openacc_lib.h (acc_copyin_async_32_h): New subroutine. ++ (acc_copyin_async_64_h): New subroutine. ++ (acc_copyin_async_array_h): New subroutine. ++ (acc_create_async_32_h): New subroutine. ++ (acc_create_async_64_h): New subroutine. ++ (acc_create_async_array_h): New subroutine. ++ (acc_copyout_async_32_h): New subroutine. ++ (acc_copyout_async_64_h): New subroutine. ++ (acc_copyout_async_array_h): New subroutine. ++ (acc_delete_async_32_h): New subroutine. ++ (acc_delete_async_64_h): New subroutine. ++ (acc_delete_async_array_h): New subroutine. ++ (acc_update_device_async_32_h): New subroutine. ++ (acc_update_device_async_64_h): New subroutine. ++ (acc_update_device_async_array_h): New subroutine. ++ (acc_update_self_async_32_h): New subroutine. ++ (acc_update_self_async_64_h): New subroutine. ++ (acc_update_self_async_array_h): New subroutine. ++ * openacc.f90 (acc_copyin_async_32_h): New subroutine. ++ (acc_copyin_async_64_h): New subroutine. ++ (acc_copyin_async_array_h): New subroutine. ++ (acc_create_async_32_h): New subroutine. ++ (acc_create_async_64_h): New subroutine. ++ (acc_create_async_array_h): New subroutine. ++ (acc_copyout_async_32_h): New subroutine. ++ (acc_copyout_async_64_h): New subroutine. ++ (acc_copyout_async_array_h): New subroutine. ++ (acc_delete_async_32_h): New subroutine. ++ (acc_delete_async_64_h): New subroutine. ++ (acc_delete_async_array_h): New subroutine. ++ (acc_update_device_async_32_h): New subroutine. ++ (acc_update_device_async_64_h): New subroutine. ++ (acc_update_device_async_array_h): New subroutine. ++ (acc_update_self_async_32_h): New subroutine. ++ (acc_update_self_async_64_h): New subroutine. ++ (acc_update_self_async_array_h): New subroutine. ++ * libgomp.map (OACC_2.5): Add acc_copyin_async*, acc_copyout_async*, ++ acc_copyout_finalize_async*, acc_create_async*, acc_delete_async*, ++ acc_delete_finalize_async*, acc_memcpy_from_device_async*, ++ acc_memcpy_to_device_async*, acc_update_device_async*, and ++ acc_update_self_async* entries. ++ * testsuite/libgomp.oacc-c-c++-common/lib-94.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/lib-95.c: New test. ++ * testsuite/libgomp.oacc-fortran/lib-16.f90: New test. ++ ++2018-10-31 Joseph Myers ++ ++ PR bootstrap/82856 ++ * Makefile.am: Include multilib.am ++ (AUTOMAKE_OPTIONS): Add info-in-builddir. ++ (CLEANFILES): Remove libgomp.info. ++ * configure.ac: Remove AC_PREREQ. ++ * testsuite/Makefile.am (RUNTEST): Remove quotes. ++ * Makefile.in, aclocal.m4, configure, testsuite/Makefile.in: ++ Regenerate. ++ ++2018-10-29 Joseph Myers ++ Julian Brown ++ ++ * testsuite/libgomp.oacc-c++/this.C: New. ++ ++2018-09-18 Cesar Philippidis ++ ++ * plugin/plugin-nvptx.c (struct cuda_map): New. ++ (struct ptx_stream): Replace d, h, h_begin, h_end, h_next, h_prev, ++ h_tail with (cuda_map *) map. ++ (cuda_map_create): New function. ++ (cuda_map_destroy): New function. ++ (map_init): Update to use a linked list of cuda_map objects. ++ (map_fini): Likewise. ++ (map_pop): Likewise. ++ (map_push): Likewise. Return CUdeviceptr instead of void. ++ (init_streams_for_device): Remove stales references to ptx_stream ++ members. ++ (select_stream_for_async): Likewise. ++ (nvptx_exec): Update call to map_init. ++ ++2018-09-09 Cesar Philippidis ++ Julian Brown ++ ++ PR middle-end/86336 ++ * testsuite/libgomp.oacc-c++/non-scalar-data.C: Remove XFAIL. ++ ++2018-08-21 Nicolas Koenig ++ Thomas Koenig ++ ++ PR fortran/25829 ++ * testsuite/libgomp.fortran/async_io_1.f90: New test. ++ * testsuite/libgomp.fortran/async_io_2.f90: New test. ++ * testsuite/libgomp.fortran/async_io_3.f90: New test. ++ * testsuite/libgomp.fortran/async_io_4.f90: New test. ++ * testsuite/libgomp.fortran/async_io_5.f90: New test. ++ * testsuite/libgomp.fortran/async_io_6.f90: New test. ++ * testsuite/libgomp.fortran/async_io_7.f90: New test. ++ ++2018-08-13 Cesar Philippidis ++ Tom de Vries ++ ++ PR target/85590 ++ * plugin/cuda/cuda.h (CUoccupancyB2DSize): New typedef. ++ (cuOccupancyMaxPotentialBlockSize): Declare. ++ * plugin/cuda-lib.def (cuOccupancyMaxPotentialBlockSize): New ++ CUDA_ONE_CALL_MAYBE_NULL. ++ * plugin/plugin-nvptx.c (CUDA_VERSION < 6050): Define ++ CUoccupancyB2DSize and declare ++ cuOccupancyMaxPotentialBlockSize. ++ (nvptx_exec): Use cuOccupancyMaxPotentialBlockSize to set the ++ default num_gangs and num_workers when the driver supports it. ++ ++2018-08-08 Tom de Vries ++ ++ * plugin/cuda-lib.def (cuLinkAddData_v2, cuLinkCreate_v2): Declare using ++ CUDA_ONE_CALL_MAYBE_NULL. ++ * plugin/plugin-nvptx.c (cuLinkAddData, cuLinkCreate): Undef and declare. ++ (cuLinkAddData_v2, cuLinkCreate_v2): Declare. ++ (link_ptx): Fall back to cuLinkAddData/cuLinkCreate if the _v2 versions ++ are not found. ++ ++2018-08-08 Tom de Vries ++ ++ * plugin/cuda-lib.def (cuGetErrorString): Use CUDA_ONE_CALL_MAYBE_NULL. ++ * plugin/plugin-nvptx.c (cuda_error): Handle if cuGetErrorString is not ++ present. ++ ++2018-08-08 Tom de Vries ++ ++ * plugin/plugin-nvptx.c ++ (CU_DEVICE_ATTRIBUTE_MAX_REGISTERS_PER_MULTIPROCESSOR): Define. ++ (nvptx_open_device): Use ++ CU_DEVICE_ATTRIBUTE_MAX_REGISTERS_PER_MULTIPROCESSOR. ++ ++2018-08-08 Tom de Vries ++ ++ * plugin/plugin-nvptx.c (cuda_error): Move declaration of cuGetErrorStri= ng ... ++ (cuGetErrorString): ... here. Guard with CUDA_VERSION < 6000. ++ ++2018-08-07 Tom de Vries ++ ++ * plugin/plugin-nvptx.c (DO_PRAGMA): Define. ++ (struct cuda_lib_s): Add def/undef of CUDA_ONE_CALL_MAYBE_NULL. ++ (init_cuda_lib): Add new param to CUDA_ONE_CALL_1. Add arg to ++ corresponding call in CUDA_ONE_CALL. Add def/undef of ++ CUDA_ONE_CALL_MAYBE_NULL. ++ (CUDA_CALL_EXISTS): Define. ++ ++2018-08-07 Tom de Vries ++ ++ * plugin/plugin-nvptx.c (struct cuda_lib_s, init_cuda_lib): Put ++ CUDA_ONE_CALL defines right before the cuda-lib.def include, and the ++ corresponding undefs right after. ++ ++2018-08-04 Tom de Vries ++ ++ * plugin/configfrag.ac: For --without-cuda-driver, set ++ CUDA_DRIVER_INCLUDE and CUDA_DRIVER_LIB to no. Handle ++ CUDA_DRIVER_INCLUDE =3D=3D no and CUDA_DRIVER_LIB =3D=3D no. ++ * configure: Regenerate. ++ ++2018-08-02 Tom de Vries ++ ++ PR target/86660 ++ * testsuite/libgomp.oacc-c++/routine-1-auto.C: Remove -fno-exceptions. ++ * testsuite/libgomp.oacc-c++/routine-1-template-auto.C: Same. ++ * testsuite/libgomp.oacc-c++/routine-1-template-trailing-return-type.C: ++ Same. ++ * testsuite/libgomp.oacc-c++/routine-1-template.C: Same. ++ * testsuite/libgomp.oacc-c++/routine-1-trailing-return-type.C: Same. ++ * testsuite/libgomp.oacc-c-c++-common/routine-1.c: Same. ++ ++2018-08-01 Cesar Philippidis ++ Thomas Schwinge ++ ++ * config/nvptx/oacc-parallel.c: Truncate. ++ ++2018-08-01 Cesar Philippidis ++ James Norris ++ ++ * plugin/plugin-nvptx.c (struct map): Removed. ++ (map_init, map_pop): Remove use of struct map. ++ (map_push): Likewise and change argument list. ++ * testsuite/libgomp.oacc-c-c++-common/mapping-1.c: New ++ ++2018-08-01 Tom de Vries ++ ++ * plugin/cuda-lib.def: New file. Factor out of ... ++ * plugin/plugin-nvptx.c (CUDA_CALLS): ... here. ++ (struct cuda_lib_s, init_cuda_lib): Include cuda-lib.def instead of ++ using CUDA_CALLS. ++ ++2018-07-31 Andre Vieira ++ ++ Revert 'AsyncI/O patch committed'. ++ 2018-07-25 Nicolas Koenig ++ Thomas Koenig ++ ++ PR fortran/25829 ++ * testsuite/libgomp.fortran/async_io_1.f90: New test. ++ * testsuite/libgomp.fortran/async_io_2.f90: New test. ++ * testsuite/libgomp.fortran/async_io_3.f90: New test. ++ * testsuite/libgomp.fortran/async_io_4.f90: New test. ++ * testsuite/libgomp.fortran/async_io_5.f90: New test. ++ * testsuite/libgomp.fortran/async_io_6.f90: New test. ++ * testsuite/libgomp.fortran/async_io_7.f90: New test. ++ ++2018-07-30 Tom de Vries ++ ++ * plugin/plugin-nvptx.c (MIN, MAX): Redefine. ++ (nvptx_exec): Ensure worker and vector default dims don't exceed ++ targ_fn->max_threads_per_block. ++ ++2018-07-30 Tom de Vries ++ ++ * plugin/plugin-nvptx.c (struct ptx_device): Add default_dims field. ++ (nvptx_open_device): Init default_dims for device. ++ (nvptx_exec): Use default_dims from device. ++ ++2018-07-26 Jakub Jelinek ++ ++ PR testsuite/86660 ++ * testsuite/libgomp.c++/for-15.C (results): Include it in ++ omp declare target region. ++ (main): Use map (always, tofrom: results) instead of ++ map (tofrom: results). ++ ++ PR middle-end/86660 ++ * testsuite/libgomp.c/pr86660.c: New test. ++ ++2018-07-26 Cesar Philippidis ++ Tom de Vries ++ ++ * plugin/plugin-nvptx.c (nvptx_exec): Error if the hardware doesn't have ++ sufficient resources to launch a kernel, and give a hint on how to fix ++ it. ++ ++2018-07-26 Cesar Philippidis ++ Tom de Vries ++ ++ * plugin/plugin-nvptx.c (struct ptx_device): Add warp_size, ++ max_threads_per_block and max_threads_per_multiprocessor fields. ++ (nvptx_open_device): Initialize new fields. ++ (nvptx_exec): Use num_sms, and new fields. ++ ++2018-07-26 Tom de Vries ++ ++ * testsuite/libgomp.oacc-fortran/lib-12.f90: Move acc_async_test calls ++ to correct locations. Remove xfail. ++ ++2018-07-26 Tom de Vries ++ ++ * testsuite/libgomp.oacc-fortran/lib-13.f90: Replace acc_wait_all with ++ acc_wait. Move acc_async_test calls to correct locations. Remove ++ xfail. ++ ++2018-07-25 Nicolas Koenig ++ Thomas Koenig ++ ++ PR fortran/25829 ++ * testsuite/libgomp.fortran/async_io_1.f90: New test. ++ * testsuite/libgomp.fortran/async_io_2.f90: New test. ++ * testsuite/libgomp.fortran/async_io_3.f90: New test. ++ * testsuite/libgomp.fortran/async_io_4.f90: New test. ++ * testsuite/libgomp.fortran/async_io_5.f90: New test. ++ * testsuite/libgomp.fortran/async_io_6.f90: New test. ++ * testsuite/libgomp.fortran/async_io_7.f90: New test. ++ ++2018-07-17 Jakub Jelinek ++ ++ PR middle-end/86542 ++ * testsuite/libgomp.c++/pr86542.C: New test. ++ ++ PR middle-end/86539 ++ * testsuite/libgomp.c++/pr86539.C: New test. ++ ++2018-07-11 Jakub Jelinek ++ ++ PR c++/86443 ++ * testsuite/libgomp.c++/for-15.C (a): Remove unused variable. ++ (results): Make sure the variable is not inside declare target region. ++ (qux): Remove unused function. ++ ++2018-07-10 Jakub Jelinek ++ ++ PR c++/86443 ++ * testsuite/libgomp.c++/for-15.C: New test. ++ ++2018-06-26 Jakub Jelinek ++ ++ PR c++/86291 ++ * testsuite/libgomp.c++/pr86291.C: New test. ++ ++2018-06-24 Gerald Pfeifer ++ ++ * libgomp.texi (Top): Move www.openmp.org to https. ++ (Enabling OpenMP): Ditto. ++ (omp_get_active_level): Ditto. ++ (omp_get_ancestor_thread_num): Ditto. ++ (omp_get_cancellation): Ditto. ++ (omp_get_default_device): Ditto. ++ (omp_get_dynamic): Ditto. ++ (omp_get_level): Ditto. ++ (omp_get_max_active_levels): Ditto. ++ (omp_get_max_task_priority): Ditto. ++ (omp_get_max_threads): Ditto. ++ (omp_get_nested): Ditto. ++ (omp_get_num_devices): Ditto. ++ (omp_get_num_procs): Ditto. ++ (omp_get_num_teams): Ditto. ++ (omp_get_num_threads): Ditto. ++ (omp_get_proc_bind): Ditto. ++ (omp_get_schedule): Ditto. ++ (omp_get_team_num): Ditto. ++ (omp_get_team_size): Ditto. ++ (omp_get_thread_limit): Ditto. ++ (omp_get_thread_num): Ditto. ++ (omp_in_parallel): Ditto. ++ (omp_in_final): Ditto. ++ (omp_is_initial_device): Ditto. ++ (omp_set_default_device): Ditto. ++ (omp_set_dynamic): Ditto. ++ (omp_set_max_active_levels): Ditto. ++ (omp_set_nested): Ditto. ++ (omp_set_num_threads): Ditto. ++ (omp_set_schedule): Ditto. ++ (omp_init_lock): Ditto. ++ (omp_set_lock): Ditto. ++ (omp_test_lock): Ditto. ++ (omp_unset_lock): Ditto. ++ (omp_destroy_lock): Ditto. ++ (omp_init_nest_lock): Ditto. ++ (omp_set_nest_lock): Ditto. ++ (omp_test_nest_lock): Ditto. ++ (omp_unset_nest_lock): Ditto. ++ (omp_destroy_nest_lock): Ditto. ++ (omp_get_wtick): Ditto. ++ (omp_get_wtime): Ditto. ++ (OMP_CANCELLATION): Ditto. ++ (OMP_DISPLAY_ENV): Ditto. ++ (OMP_DEFAULT_DEVICE): Ditto. ++ (OMP_DYNAMIC): Ditto. ++ (OMP_MAX_ACTIVE_LEVELS): Ditto. ++ (OMP_MAX_TASK_PRIORITY): Ditto. ++ (OMP_NESTED): Ditto. ++ (OMP_NUM_THREADS): Ditto. ++ (OMP_PROC_BIND): Ditto. ++ (OMP_PLACES): Ditto. ++ (OMP_STACKSIZE): Ditto. ++ (OMP_SCHEDULE): Ditto. ++ (OMP_THREAD_LIMIT): Ditto. ++ (OMP_WAIT_POLICY): Ditto. ++ ++2018-06-22 Cesar Philippidis ++ James Norris ++ Julian Brown ++ Thomas Schwinge ++ Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-wv-1.c: Don't force "-O2". ++ * testsuite/libgomp.oacc-c-c++-common/data-2.c: Update. ++ * testsuite/libgomp.oacc-c-c++-common/host_data-1.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/mode-transitions.c: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-2.f90: Likewise. ++ * testsuite/libgomp.oacc-c++/non-scalar-data.C: New file. ++ * testsuite/libgomp.oacc-c-c++-common/declare-3.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/enter-data.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-loop-data-2.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-loop-data-enter-exit-2.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-loop-data-enter-exit.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-loop-data-update.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-loop-data.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-parallel-loop-data-enter-e= xit.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-local-worker-= 1.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-local-worker-= 2.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-local-worker-= 3.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-local-worker-= 4.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-local-worker-= 5.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-gang-1.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-gang-2.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-gang-3.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-gang-4.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-gang-5.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-gang-6.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-vector-1= .c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-vector-2= .c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-worker-1= .c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-worker-2= .c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-worker-3= .c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-worker-4= .c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-worker-5= .c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-worker-6= .c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-private-vars-loop-worker-7= .c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/kernels-reduction-1.c: ++ Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/parallel-loop-1.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/parallel-loop-1.h: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/parallel-loop-2.h: Likewise. ++ * testsuite/libgomp.oacc-fortran/cublas-fixed.h: Likewise. ++ * testsuite/libgomp.oacc-fortran/dummy-array.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/host_data-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/host_data-3.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/host_data-4.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-acc-loop-reduction-2.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-acc-loop-reduction.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-collapse-3.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-collapse-4.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-independent.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-loop-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-map-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-parallel-loop-data-enter-exit.f= 95: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-gang-1.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-gang-2.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-gang-3.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-gang-6.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-vector-1.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-vector-2.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-worker-1.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-worker-2.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-worker-3.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-worker-4.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-worker-5.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-worker-6.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-private-vars-loop-worker-7.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-reduction-1.f90: ++ Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-12.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-13.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-14.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-15.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/parallel-loop-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/reference-reductions.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/vector-routine.f90: Likewise. ++ ++2018-06-20 Chung-Lin Tang ++ Thomas Schwinge ++ Cesar Philippidis +=20 +-2019-08-30 Jakub Jelinek ++ * libgomp.h (struct splay_tree_key_s): Add dynamic_refcount member. ++ (gomp_acc_remove_pointer): Update declaration. ++ (gomp_acc_declare_allocate): Declare. ++ (gomp_remove_var): Declare. ++ * libgomp.map (OACC_2.5): Define. ++ * oacc-mem.c (acc_map_data): Update refcount. ++ (acc_unmap_data): Likewise. ++ (present_create_copy): Likewise. ++ (acc_create): Add FLAG_PRESENT when calling present_create_copy. ++ (acc_copyin): Likewise. ++ (FLAG_FINALIZE): Define. ++ (delete_copyout): Update dynamic refcounts, add support for FINALIZE. ++ (acc_delete_finalize): New function. ++ (acc_delete_finalize_async): New function. ++ (acc_copyout_finalize): New function. ++ (acc_copyout_finalize_async): New function. ++ (gomp_acc_insert_pointer): Update refcounts. ++ (gomp_acc_remove_pointer): Return if data is not present on the ++ accelerator. ++ * oacc-parallel.c (find_pset): Rename to find_pointer. ++ (find_pointer): Add support for GOMP_MAP_POINTER. ++ (handle_ftn_pointers): New function. ++ (GOACC_parallel_keyed): Update refcounts of variables. ++ (GOACC_enter_exit_data): Add support for finalized data mappings. ++ Add support for GOMP_MAP_{TO,ALLOC,RELESE,FROM}. Update handling ++ of fortran arrays. ++ (GOACC_update): Add support for GOMP_MAP_{ALWAYS_POINTER,TO,FROM}. ++ (GOACC_declare): Add support for GOMP_MAP_RELEASE, remove support ++ for GOMP_MAP_FORCE_FROM. ++ * openacc.f90 (module openacc_internal): Add ++ acc_copyout_finalize_{32_h,64_h,array_h,_l}, and ++ acc_delete_finalize_{32_h,64_h,array_h,_l}. Add interfaces for ++ acc_copyout_finalize and acc_delete_finalize. ++ (acc_copyout_finalize_32_h): New subroutine. ++ (acc_copyout_finalize_64_h): New subroutine. ++ (acc_copyout_finalize_array_h): New subroutine. ++ (acc_delete_finalize_32_h): New subroutine. ++ (acc_delete_finalize_64_h): New subroutine. ++ (acc_delete_finalize_array_h): New subroutine. ++ * openacc.h (acc_copyout_finalize): Declare. ++ (acc_copyout_finalize_async): Declare. ++ (acc_delete_finalize): Declare. ++ (acc_delete_finalize_async): Declare. ++ * openacc_lib.h (acc_copyout_finalize): New interface. ++ (acc_delete_finalize): New interface. ++ * target.c (gomp_map_vars): Update dynamic_refcount. ++ (gomp_remove_var): New function. ++ (gomp_unmap_vars): Use it. ++ (gomp_unload_image_from_device): Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-1.c: Update test ++ case to utilize OpenACC 2.5 data clause semantics. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-2.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-3.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-4.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-5.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-6.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-7.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/data-already-8.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/lib-16.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/lib-25.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/lib-32.c: Likewise. ++ * testsuite/libgomp.oacc-c-c++-common/lib-83.c: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-5.f90: New test. ++ * testsuite/libgomp.oacc-fortran/data-already-1.f: Update test case to ++ utilize OpenACC 2.5 data clause semantics. ++ * testsuite/libgomp.oacc-fortran/data-already-2.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-already-3.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-already-4.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-already-5.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-already-6.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-already-7.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-already-8.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-32-1.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-32-2.f: Likewise. ++ ++2018-05-21 Janus Weil ++ ++ PR fortran/85841 ++ PR testsuite/85865 ++ * testsuite/libgomp.fortran/collapse2.f90: Add option "-std=3Dlegacy". ++ * testsuite/libgomp.fortran/omp_atomic2.f90: Ditto. ++ * testsuite/libgomp.fortran/omp_parse1.f90: Ditto. ++ * testsuite/libgomp.fortran/omp_parse3.f90: Ditto. ++ * testsuite/libgomp.fortran/task2.f90: Ditto. ++ * testsuite/libgomp.fortran/vla1.f90: Ditto. ++ * testsuite/libgomp.fortran/vla2.f90: Ditto. ++ * testsuite/libgomp.fortran/vla3.f90: Ditto. ++ * testsuite/libgomp.fortran/vla4.f90: Ditto. ++ * testsuite/libgomp.fortran/vla5.f90: Ditto. ++ * testsuite/libgomp.fortran/vla6.f90: Ditto. ++ * testsuite/libgomp.fortran/vla8.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/collapse-2.f90: Ditto. ++ * testsuite/libgomp.oacc-fortran/nested-function-1.f90: Ditto. ++ ++2018-05-18 Cesar Philippidis ++ ++ PR c++/85782 ++ * testsuite/libgomp.oacc-c-c++-common/pr85782.c: New test. ++ ++2018-05-09 Tom de Vries ++ ++ PR libgomp/82901 ++ * oacc-parallel.c (GOACC_declare): Use GOMP_ASYNC_SYNC as async argument ++ to GOACC_enter_exit_data. ++ ++2018-05-09 Tom de Vries ++ ++ PR libgomp/83792 ++ * oacc-int.h (async_valid_stream_id_p, async_valid_p) ++ (async_synchronous_p): New function. ++ * oacc-async.c (acc_async_test, acc_wait, acc_wait_all_async): Use ++ async_valid_p. ++ * oacc-cuda.c (acc_get_cuda_stream, acc_set_cuda_stream): Use ++ async_valid_stream_id_p. ++ * oacc-mem.c (gomp_acc_remove_pointer): Use async_synchronous_p. ++ * oacc-parallel.c (GOACC_parallel_keyed): Same. ++ ++2018-05-07 Tom de Vries ++ ++ PR testsuite/85677 ++ * testsuite/lib/libgomp.exp (libgomp_init): Move inclusion of top-level ++ include directory in ALWAYS_CFLAGS out of $blddir !=3D "" condition. ++ ++2018-05-03 Tom de Vries ++ ++ PR testsuite/85106 ++ * testsuite/lib/libgomp-dg.exp (libgomp-dg-test): Add save-temps to ++ extra_tool_flags if it contains an -foffload=3D-fdump-* flag. ++ * testsuite/lib/libgomp.exp: Include scanoffloadtree.exp. ++ * testsuite/libgomp.oacc-c/vec.c: Use scan-offload-tree-dump. ++ ++2018-05-02 Tom de Vries ++ ++ PR libgomp/85411 ++ * plugin/plugin-nvptx.c (nvptx_exec): Move parsing of ++ GOMP_OPENACC_DIM ... ++ * env.c (parse_gomp_openacc_dim): ... here. New function. ++ (initialize_env): Call parse_gomp_openacc_dim. ++ (goacc_default_dims): Define. ++ * libgomp.h (goacc_default_dims): Declare. ++ * oacc-plugin.c (GOMP_PLUGIN_acc_default_dim): New function. ++ * oacc-plugin.h (GOMP_PLUGIN_acc_default_dim): Declare. ++ * libgomp.map: New version "GOMP_PLUGIN_1.2". Add ++ GOMP_PLUGIN_acc_default_dim. ++ * testsuite/libgomp.oacc-c-c++-common/loop-default-runtime.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/loop-default.h: New test. ++ ++2018-05-02 Tom de Vries ++ ++ PR testsuite/83791 ++ * testsuite/libgomp.c++/udr-9.C: Update. ++ * testsuite/libgomp.c++/atomic-16.C: Remove. ++ * testsuite/libgomp.c++/cancel-taskgroup-2.C: Remove. ++ * testsuite/libgomp.c++/loop-13.C: Remove. ++ * testsuite/libgomp.c++/loop-14.C: Remove. ++ * testsuite/libgomp.c++/loop-15.C: Remove. ++ * testsuite/libgomp.c++/monotonic-1.C: Remove. ++ * testsuite/libgomp.c++/monotonic-2.C: Remove. ++ * testsuite/libgomp.c++/nonmonotonic-1.C: Remove. ++ * testsuite/libgomp.c++/nonmonotonic-2.C: Remove. ++ * testsuite/libgomp.c++/ordered-1.C: Remove. ++ * testsuite/libgomp.c++/pr45784.C: Remove. ++ * testsuite/libgomp.c++/pr64824.C: Remove. ++ * testsuite/libgomp.c++/pr64868.C: Remove. ++ * testsuite/libgomp.c++/pr66199-1.C: Remove. ++ * testsuite/libgomp.c++/pr66199-2.C: Remove. ++ * testsuite/libgomp.c++/pr66199-3.C: Remove. ++ * testsuite/libgomp.c++/pr66199-4.C: Remove. ++ * testsuite/libgomp.c++/pr66199-5.C: Remove. ++ * testsuite/libgomp.c++/pr66199-6.C: Remove. ++ * testsuite/libgomp.c++/pr66199-7.C: Remove. ++ * testsuite/libgomp.c++/pr66199-8.C: Remove. ++ * testsuite/libgomp.c++/pr66199-9.C: Remove. ++ * testsuite/libgomp.c++/pr69389.C: Remove. ++ * testsuite/libgomp.c++/simd10.C: Remove. ++ * testsuite/libgomp.c++/simd11.C: Remove. ++ * testsuite/libgomp.c++/simd12.C: Remove. ++ * testsuite/libgomp.c++/simd13.C: Remove. ++ * testsuite/libgomp.c++/target-1.C: Remove. ++ * testsuite/libgomp.c++/target-3.C: Remove. ++ * testsuite/libgomp.c++/target-4.C: Remove. ++ * testsuite/libgomp.c++/target-5.C: Remove. ++ * testsuite/libgomp.c++/taskgroup-1.C: Remove. ++ * testsuite/libgomp.c++/taskloop-1.C: Remove. ++ * testsuite/libgomp.c++/taskloop-2.C: Remove. ++ * testsuite/libgomp.c++/taskloop-3.C: Remove. ++ * testsuite/libgomp.c++/taskloop-4.C: Remove. ++ * testsuite/libgomp.c++/udr-9.C: Remove. ++ * testsuite/libgomp.c++/for-10.C: Remove. ++ * testsuite/libgomp.c++/for-11.C: Remove. ++ * testsuite/libgomp.c++/for-12.C: Remove. ++ * testsuite/libgomp.c++/for-13.C: Remove. ++ * testsuite/libgomp.c++/for-14.C: Remove. ++ * testsuite/libgomp.c++/for-9.C: Remove. ++ * testsuite/libgomp.c/atomic-18.c: Move ... ++ * testsuite/libgomp.c-c++-common/atomic-18.c: ... here. ++ * testsuite/libgomp.c/cancel-taskgroup-2.c: Move ... ++ * testsuite/libgomp.c-c++-common/cancel-taskgroup-2.c: here. ++ * testsuite/libgomp.c/loop-13.c: Move ... ++ * testsuite/libgomp.c-c++-common/loop-13.c: ... here. ++ * testsuite/libgomp.c/loop-14.c: Move ... ++ * testsuite/libgomp.c-c++-common/loop-14.c: ... here. ++ * testsuite/libgomp.c/loop-15.c: Remove. ++ * testsuite/libgomp.c-c++-common/loop-15.c: New test. ++ * testsuite/libgomp.c/monotonic-1.c: Move ... ++ * testsuite/libgomp.c-c++-common/monotonic-1.c: ... here. ++ * testsuite/libgomp.c/monotonic-2.c: Move ... ++ * testsuite/libgomp.c-c++-common/monotonic-2.c: ... here. ++ * testsuite/libgomp.c/nonmonotonic-1.c: Move ... ++ * testsuite/libgomp.c-c++-common/nonmonotonic-1.c: ... here. ++ * testsuite/libgomp.c/nonmonotonic-2.c: Move ... ++ * testsuite/libgomp.c-c++-common/nonmonotonic-2.c: ... here. ++ * testsuite/libgomp.c/ordered-4.c: Move ... ++ * testsuite/libgomp.c-c++-common/ordered-4.c: ... here. ++ * testsuite/libgomp.c/pr45784.c: Move ... ++ * testsuite/libgomp.c-c++-common/pr45784.c: ... here. ++ * testsuite/libgomp.c/pr64824.c: Move ... ++ * testsuite/libgomp.c-c++-common/pr64824.c: ... here. ++ * testsuite/libgomp.c/pr64868.c: Move ... ++ * testsuite/libgomp.c-c++-common/pr64868.c: ... here. ++ * testsuite/libgomp.c/pr66199-1.c: Move ... ++ * testsuite/libgomp.c-c++-common/pr66199-1.c: ... here. ++ * testsuite/libgomp.c/pr66199-2.c: Move ... ++ * testsuite/libgomp.c-c++-common/pr66199-2.c: ... here. ++ * testsuite/libgomp.c/pr66199-3.c: Move ... ++ * testsuite/libgomp.c-c++-common/pr66199-3.c: ... here. ++ * testsuite/libgomp.c/pr66199-4.c: Move ... ++ * testsuite/libgomp.c-c++-common/pr66199-4.c: ... here. ++ * testsuite/libgomp.c/pr66199-5.c: Move ... ++ * testsuite/libgomp.c-c++-common/pr66199-5.c: ... here. ++ * testsuite/libgomp.c/pr66199-6.c: Move ... ++ * testsuite/libgomp.c-c++-common/pr66199-6.c: ... here. ++ * testsuite/libgomp.c/pr66199-7.c: Move ... ++ * testsuite/libgomp.c-c++-common/pr66199-7.c: ... here. ++ * testsuite/libgomp.c/pr66199-8.c: Move ... ++ * testsuite/libgomp.c-c++-common/pr66199-8.c: ... here. ++ * testsuite/libgomp.c/pr66199-9.c: Move ... ++ * testsuite/libgomp.c-c++-common/pr66199-9.c: ... here. ++ * testsuite/libgomp.c/pr69389.c: Move ... ++ * testsuite/libgomp.c-c++-common/pr69389.c: ... here. ++ * testsuite/libgomp.c/simd-14.c: Move ... ++ * testsuite/libgomp.c-c++-common/simd-14.c: ... here. ++ * testsuite/libgomp.c/simd-15.c: Move ... ++ * testsuite/libgomp.c-c++-common/simd-15.c: ... here. ++ * testsuite/libgomp.c/simd-16.c: Move ... ++ * testsuite/libgomp.c-c++-common/simd-16.c: ... here. ++ * testsuite/libgomp.c/simd-17.c: Move ... ++ * testsuite/libgomp.c-c++-common/simd-17.c: ... here. ++ * testsuite/libgomp.c/target-1.c: Move ... ++ * testsuite/libgomp.c-c++-common/target-1.c: ... here. ++ * testsuite/libgomp.c/target-10.c: Move ... ++ * testsuite/libgomp.c-c++-common/target-10.c: ... here. ++ * testsuite/libgomp.c/target-13.c: Move ... ++ * testsuite/libgomp.c-c++-common/target-13.c: ... here. ++ * testsuite/libgomp.c/target-2.c: Move ... ++ * testsuite/libgomp.c-c++-common/target-2.c: ... here. ++ * testsuite/libgomp.c/taskgroup-1.c: Move ... ++ * testsuite/libgomp.c-c++-common/taskgroup-1.c: ... here. ++ * testsuite/libgomp.c/taskloop-1.c: Move ... ++ * testsuite/libgomp.c-c++-common/taskloop-1.c: ... here. ++ * testsuite/libgomp.c/taskloop-2.c: Move ... ++ * testsuite/libgomp.c-c++-common/taskloop-2.c: ... here. ++ * testsuite/libgomp.c/taskloop-3.c: Move ... ++ * testsuite/libgomp.c-c++-common/taskloop-3.c: ... here. ++ * testsuite/libgomp.c/taskloop-4.c: Move ... ++ * testsuite/libgomp.c-c++-common/taskloop-4.c: ... here. ++ * testsuite/libgomp.c/udr-1.c: Move ... ++ * testsuite/libgomp.c-c++-common/udr-1.c: ... here. ++ * testsuite/libgomp.c/for-1.c: Move ... ++ * testsuite/libgomp.c-c++-common/for-1.c: ... here. ++ * testsuite/libgomp.c/for-1.h: Move ... ++ * testsuite/libgomp.c-c++-common/for-1.h: ... here. ++ * testsuite/libgomp.c/for-2.c: Move ... ++ * testsuite/libgomp.c-c++-common/for-2.c: ... here. ++ * testsuite/libgomp.c/for-2.h: Move ... ++ * testsuite/libgomp.c-c++-common/for-2.h: ... here. ++ * testsuite/libgomp.c/for-3.c: Move ... ++ * testsuite/libgomp.c-c++-common/for-3.c: ... here. ++ * testsuite/libgomp.c/for-4.c: Move ... ++ * testsuite/libgomp.c-c++-common/for-4.c: ... here. ++ * testsuite/libgomp.c/for-5.c: Move ... ++ * testsuite/libgomp.c-c++-common/for-5.c: ... here. ++ * testsuite/libgomp.c/for-6.c: Move ... ++ * testsuite/libgomp.c-c++-common/for-6.c: ... here. ++ ++2018-05-02 Tom de Vries ++ ++ PR libgomp/82428 ++ * testsuite/libgomp.oacc-c-c++-common/gang-static-2.c: Use ++ __builtin_goacc_parlevel_{id,size}. ++ * testsuite/libgomp.oacc-c-c++-common/loop-auto-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/loop-dim-default.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/loop-g-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/loop-g-2.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/loop-gwv-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-g-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-gwv-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-v-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-v-2.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-w-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-w-2.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-wv-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/loop-v-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/loop-w-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/loop-wv-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/parallel-dims.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/routine-g-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/routine-gwv-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/routine-v-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/routine-w-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/routine-wv-1.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/routine-wv-2.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/tile-1.c: Same. ++ ++2018-05-02 Tom de Vries ++ ++ PR testsuite/85106 ++ * testsuite/lib/libgomp.exp: Include scanltranstree.exp. ++ ++2018-05-02 Tom de Vries ++ ++ PR testsuite/85106 ++ * testsuite/lib/libgomp.exp: Include scanwpaipa.exp. ++ ++2018-04-29 Julian Brown ++ Tom de Vries +=20 +- Backported from mainline +- 2019-05-24 Jakub Jelinek ++ PR testsuite/85527 ++ * testsuite/libgomp.oacc-c-c++-common/atomic_capture-1.c: Allow ++ arbitrary order for iterations of atomic subtract check. +=20 +- PR libgomp/90585 +- * plugin/plugin-hsa.c (print_kernel_dispatch, run_kernel): Use PRIu64 +- macro instead of "lu". +- (release_kernel_dispatch): Likewise. Cast shadow->debug to uintptr_t +- before casting to void *. ++2018-04-28 Tom de Vries +=20 +- 2019-06-11 Jakub Jelinek ++ PR testsuite/85527 ++ * testsuite/libgomp.oacc-fortran/atomic_capture-1.f90 (main): Store ++ atomic capture results obtained in parallel loop to an array, instead of ++ to a scalar. +=20 +- PR target/90811 +- * testsuite/libgomp.c/pr90811.c: New test. ++2018-04-26 Tom de Vries +=20 +- 2019-01-28 Jakub Jelinek ++ PR libgomp/84020 ++ * plugin/cuda/cuda.h (CUjit_option): Add CU_JIT_OPTIMIZATION_LEVEL. ++ * plugin/plugin-nvptx.c (_GNU_SOURCE): Define. ++ (process_GOMP_NVPTX_JIT): New function. ++ (link_ptx): Use process_GOMP_NVPTX_JIT. +=20 +- PR middle-end/89002 +- * testsuite/libgomp.c/pr89002.c: New test. ++2018-04-26 Richard Biener ++ Tom de Vries +=20 +-2018-12-06 Release Manager ++ PR lto/85422 ++ * testsuite/libgomp.oacc-c-c++-common/pr85422.c: New test. +=20 +- * GCC 7.4.0 released. ++2018-04-26 Tom de Vries +=20 +-2018-10-12 Jakub Jelinek ++ PR target/85519 ++ * testsuite/libgomp.fortran/examples-4/declare_target-1.f90: Reduce ++ recursion depth from 25 to 23. ++ * testsuite/libgomp.fortran/examples-4/declare_target-2.f90: Same. +=20 +- Backported from mainline +- 2018-07-17 Jakub Jelinek ++2018-04-24 H.J. Lu +=20 +- PR middle-end/86542 +- * testsuite/libgomp.c++/pr86542.C: New test. ++ * configure: Regenerated. +=20 +- PR middle-end/86539 +- * testsuite/libgomp.c++/pr86539.C: New test. ++2018-04-20 Nathan Sidwell ++ Tom de Vries +=20 +- 2018-07-26 Jakub Jelinek ++ PR target/85445 ++ * testsuite/libgomp.oacc-c++/ref-1.C: New. +=20 +- PR middle-end/86660 +- * testsuite/libgomp.c/pr86660.c: New test. ++2018-04-19 Thomas Schwinge +=20 +-2018-06-26 Jakub Jelinek ++ PR libgomp/85463 ++ * testsuite/libgomp.oacc-fortran/error_stop-1.f: New file. ++ * testsuite/libgomp.oacc-fortran/error_stop-2.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/error_stop-3.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/stop-1.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/stop-2.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/stop-3.f: Likewise. +=20 +- PR c++/86291 +- * testsuite/libgomp.c++/pr86291.C: New test. ++ PR libfortran/85166 ++ * testsuite/libgomp.oacc-fortran/abort-1.f90: Switch back to "call ++ abort". ++ * testsuite/libgomp.oacc-fortran/abort-2.f90: Likewise. ++ ++2018-04-19 Jakub Jelinek +=20 +-2018-06-22 Jakub Jelinek ++ * configure: Regenerated. +=20 +- Backported from mainline +- 2018-04-18 David Malcolm ++2018-04-18 David Malcolm +=20 + PR jit/85384 + * configure: Regenerate. +=20 +-2018-05-01 Tom de Vries ++2018-04-16 Cesar Philippidis ++ Tom de Vries ++ ++ PR middle-end/84955 ++ * testsuite/libgomp.oacc-c-c++-common/pr84955.c: New test. ++ * testsuite/libgomp.oacc-fortran/pr84955.f90: New test. ++ ++2018-04-12 Thomas Koenig ++ ++ PR fortran/83064 ++ PR testsuite/85346 ++ * testsuite/libgomp.fortran/do_concurrent_5.f90: Move modified ++ test from gfortran.dg to here. +=20 +- backport from trunk: +- 2018-04-16 Cesar Philippidis +- Tom de Vries ++2018-04-12 Cesar Philippidis ++ ++ * testsuite/libgomp.oacc-c-c++-common/pr84955.c: Revert 259346. ++ * testsuite/libgomp.oacc-fortran/pr84955.f90: Likewise. ++ ++2018-04-12 Cesar Philippidis +=20 + PR middle-end/84955 + * testsuite/libgomp.oacc-c-c++-common/pr84955.c: New test. + * testsuite/libgomp.oacc-fortran/pr84955.f90: New test. +=20 +-2018-03-03 Jakub Jelinek ++2018-04-05 Tom de Vries ++ ++ PR target/85204 ++ * testsuite/libgomp.oacc-c-c++-common/broadcast-1.c: New test. ++ ++2018-03-26 Tom de Vries ++ ++ PR tree-optimization/85063 ++ * testsuite/libgomp.c/switch-conversion-2.c: New test. ++ * testsuite/libgomp.c/switch-conversion.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/switch-conversion-2.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/switch-conversion.c: New test. ++ ++2018-03-25 Thomas Koenig ++ ++ PR fortran/84381 ++ * testsuite/libgomp.fortran/aligned1.f03: Replace non-standard ++ call abort by STOP n. ++ * testsuite/libgomp.fortran/alloc-comp-1.f90: Likewise. ++ * testsuite/libgomp.fortran/alloc-comp-2.f90: Likewise. ++ * testsuite/libgomp.fortran/alloc-comp-3.f90: Likewise. ++ * testsuite/libgomp.fortran/allocatable1.f90: Likewise. ++ * testsuite/libgomp.fortran/allocatable10.f90: Likewise. ++ * testsuite/libgomp.fortran/allocatable11.f90: Likewise. ++ * testsuite/libgomp.fortran/allocatable12.f90: Likewise. ++ * testsuite/libgomp.fortran/allocatable2.f90: Likewise. ++ * testsuite/libgomp.fortran/allocatable3.f90: Likewise. ++ * testsuite/libgomp.fortran/allocatable4.f90: Likewise. ++ * testsuite/libgomp.fortran/allocatable5.f90: Likewise. ++ * testsuite/libgomp.fortran/allocatable6.f90: Likewise. ++ * testsuite/libgomp.fortran/allocatable7.f90: Likewise. ++ * testsuite/libgomp.fortran/allocatable8.f90: Likewise. ++ * testsuite/libgomp.fortran/allocatable9.f90: Likewise. ++ * testsuite/libgomp.fortran/appendix-a/a.18.1.f90: Likewise. ++ * testsuite/libgomp.fortran/appendix-a/a.19.1.f90: Likewise. ++ * testsuite/libgomp.fortran/associate1.f90: Likewise. ++ * testsuite/libgomp.fortran/associate2.f90: Likewise. ++ * testsuite/libgomp.fortran/associate3.f90: Likewise. ++ * testsuite/libgomp.fortran/cancel-do-1.f90: Likewise. ++ * testsuite/libgomp.fortran/cancel-do-2.f90: Likewise. ++ * testsuite/libgomp.fortran/cancel-parallel-1.f90: Likewise. ++ * testsuite/libgomp.fortran/cancel-sections-1.f90: Likewise. ++ * testsuite/libgomp.fortran/cancel-taskgroup-2.f90: Likewise. ++ * testsuite/libgomp.fortran/character1.f90: Likewise. ++ * testsuite/libgomp.fortran/character2.f90: Likewise. ++ * testsuite/libgomp.fortran/collapse1.f90: Likewise. ++ * testsuite/libgomp.fortran/collapse2.f90: Likewise. ++ * testsuite/libgomp.fortran/collapse3.f90: Likewise. ++ * testsuite/libgomp.fortran/collapse4.f90: Likewise. ++ * testsuite/libgomp.fortran/crayptr1.f90: Likewise. ++ * testsuite/libgomp.fortran/crayptr2.f90: Likewise. ++ * testsuite/libgomp.fortran/crayptr3.f90: Likewise. ++ * testsuite/libgomp.fortran/declare-simd-1.f90: Likewise. ++ * testsuite/libgomp.fortran/declare-simd-3.f90: Likewise. ++ * testsuite/libgomp.fortran/declare-target-2.f90: Likewise. ++ * testsuite/libgomp.fortran/depend-1.f90: Likewise. ++ * testsuite/libgomp.fortran/depend-2.f90: Likewise. ++ * testsuite/libgomp.fortran/depend-3.f90: Likewise. ++ * testsuite/libgomp.fortran/do1.f90: Likewise. ++ * testsuite/libgomp.fortran/do2.f90: Likewise. ++ * testsuite/libgomp.fortran/doacross1.f90: Likewise. ++ * testsuite/libgomp.fortran/doacross2.f90: Likewise. ++ * testsuite/libgomp.fortran/doacross3.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/array_sections-3.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/array_sections-4.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/async_target-1.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/async_target-2.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/declare_target-1.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/declare_target-2.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/declare_target-3.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/declare_target-4.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/declare_target-5.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/device-1.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/device-2.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/device-3.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/simd-1.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/simd-2.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/simd-3.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/simd-4.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/simd-5.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/simd-6.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/simd-7.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/simd-8.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/target-1.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/target-2.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/target-3.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/target-4.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/target-5.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/target_data-1.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/target_data-2.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/target_data-3.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/target_data-4.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/target_data-5.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/target_data-6.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/target_data-7.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/target_update-1.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/target_update-2.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/task_dep-1.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/task_dep-2.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/task_dep-3.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/task_dep-4.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/task_dep-5.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/teams-2.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/teams-3.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/teams-4.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/teams-5.f90: Likewise. ++ * testsuite/libgomp.fortran/examples-4/teams-6.f90: Likewise. ++ * testsuite/libgomp.fortran/lastprivate1.f90: Likewise. ++ * testsuite/libgomp.fortran/lastprivate2.f90: Likewise. ++ * testsuite/libgomp.fortran/lib1.f90: Likewise. ++ * testsuite/libgomp.fortran/lib2.f: Likewise. ++ * testsuite/libgomp.fortran/lib3.f: Likewise. ++ * testsuite/libgomp.fortran/lib4.f90: Likewise. ++ * testsuite/libgomp.fortran/lock-1.f90: Likewise. ++ * testsuite/libgomp.fortran/lock-2.f90: Likewise. ++ * testsuite/libgomp.fortran/nested1.f90: Likewise. ++ * testsuite/libgomp.fortran/nestedfn1.f90: Likewise. ++ * testsuite/libgomp.fortran/nestedfn2.f90: Likewise. ++ * testsuite/libgomp.fortran/nestedfn3.f90: Likewise. ++ * testsuite/libgomp.fortran/nestedfn4.f90: Likewise. ++ * testsuite/libgomp.fortran/nestedfn5.f90: Likewise. ++ * testsuite/libgomp.fortran/omp_atomic1.f90: Likewise. ++ * testsuite/libgomp.fortran/omp_atomic2.f90: Likewise. ++ * testsuite/libgomp.fortran/omp_atomic3.f90: Likewise. ++ * testsuite/libgomp.fortran/omp_atomic4.f90: Likewise. ++ * testsuite/libgomp.fortran/omp_atomic5.f90: Likewise. ++ * testsuite/libgomp.fortran/omp_cond1.f: Likewise. ++ * testsuite/libgomp.fortran/omp_cond2.f: Likewise. ++ * testsuite/libgomp.fortran/omp_cond3.F90: Likewise. ++ * testsuite/libgomp.fortran/omp_cond4.F90: Likewise. ++ * testsuite/libgomp.fortran/omp_parse1.f90: Likewise. ++ * testsuite/libgomp.fortran/omp_parse2.f90: Likewise. ++ * testsuite/libgomp.fortran/omp_parse3.f90: Likewise. ++ * testsuite/libgomp.fortran/omp_parse4.f90: Likewise. ++ * testsuite/libgomp.fortran/openmp_version-1.f: Likewise. ++ * testsuite/libgomp.fortran/openmp_version-2.f90: Likewise. ++ * testsuite/libgomp.fortran/parloops-exit-first-loop-alt-2.f95: Likewise. ++ * testsuite/libgomp.fortran/parloops-exit-first-loop-alt.f95: Likewise. ++ * testsuite/libgomp.fortran/pointer1.f90: Likewise. ++ * testsuite/libgomp.fortran/pointer2.f90: Likewise. ++ * testsuite/libgomp.fortran/pr25162.f: Likewise. ++ * testsuite/libgomp.fortran/pr25219.f90: Likewise. ++ * testsuite/libgomp.fortran/pr27395-1.f90: Likewise. ++ * testsuite/libgomp.fortran/pr27395-2.f90: Likewise. ++ * testsuite/libgomp.fortran/pr27416-1.f90: Likewise. ++ * testsuite/libgomp.fortran/pr27916-1.f90: Likewise. ++ * testsuite/libgomp.fortran/pr27916-2.f90: Likewise. ++ * testsuite/libgomp.fortran/pr28390.f: Likewise. ++ * testsuite/libgomp.fortran/pr29629.f90: Likewise. ++ * testsuite/libgomp.fortran/pr32550.f90: Likewise. ++ * testsuite/libgomp.fortran/pr33880.f90: Likewise. ++ * testsuite/libgomp.fortran/pr34020.f90: Likewise. ++ * testsuite/libgomp.fortran/pr35130.f90: Likewise. ++ * testsuite/libgomp.fortran/pr42162.f90: Likewise. ++ * testsuite/libgomp.fortran/pr46753.f90: Likewise. ++ * testsuite/libgomp.fortran/pr48894.f90: Likewise. ++ * testsuite/libgomp.fortran/pr49792-1.f90: Likewise. ++ * testsuite/libgomp.fortran/pr49792-2.f90: Likewise. ++ * testsuite/libgomp.fortran/pr63938-1.f90: Likewise. ++ * testsuite/libgomp.fortran/pr63938-2.f90: Likewise. ++ * testsuite/libgomp.fortran/pr65597.f90: Likewise. ++ * testsuite/libgomp.fortran/pr66199-1.f90: Likewise. ++ * testsuite/libgomp.fortran/pr71014.f90: Likewise. ++ * testsuite/libgomp.fortran/pr81304.f90: Likewise. ++ * testsuite/libgomp.fortran/pr81841.f90: Likewise. ++ * testsuite/libgomp.fortran/pr84418-1.f90: Likewise. ++ * testsuite/libgomp.fortran/pr84418-2.f90: Likewise. ++ * testsuite/libgomp.fortran/procptr1.f90: Likewise. ++ * testsuite/libgomp.fortran/recursion1.f90: Likewise. ++ * testsuite/libgomp.fortran/reduction1.f90: Likewise. ++ * testsuite/libgomp.fortran/reduction2.f90: Likewise. ++ * testsuite/libgomp.fortran/reduction3.f90: Likewise. ++ * testsuite/libgomp.fortran/reduction4.f90: Likewise. ++ * testsuite/libgomp.fortran/reduction5.f90: Likewise. ++ * testsuite/libgomp.fortran/reduction6.f90: Likewise. ++ * testsuite/libgomp.fortran/reference1.f90: Likewise. ++ * testsuite/libgomp.fortran/reference2.f90: Likewise. ++ * testsuite/libgomp.fortran/retval1.f90: Likewise. ++ * testsuite/libgomp.fortran/retval2.f90: Likewise. ++ * testsuite/libgomp.fortran/sharing1.f90: Likewise. ++ * testsuite/libgomp.fortran/sharing2.f90: Likewise. ++ * testsuite/libgomp.fortran/simd1.f90: Likewise. ++ * testsuite/libgomp.fortran/simd2.f90: Likewise. ++ * testsuite/libgomp.fortran/simd3.f90: Likewise. ++ * testsuite/libgomp.fortran/simd4.f90: Likewise. ++ * testsuite/libgomp.fortran/simd5.f90: Likewise. ++ * testsuite/libgomp.fortran/simd6.f90: Likewise. ++ * testsuite/libgomp.fortran/simd7.f90: Likewise. ++ * testsuite/libgomp.fortran/stack.f90: Likewise. ++ * testsuite/libgomp.fortran/strassen.f90: Likewise. ++ * testsuite/libgomp.fortran/tabs1.f90: Likewise. ++ * testsuite/libgomp.fortran/tabs2.f: Likewise. ++ * testsuite/libgomp.fortran/target1.f90: Likewise. ++ * testsuite/libgomp.fortran/target2.f90: Likewise. ++ * testsuite/libgomp.fortran/target3.f90: Likewise. ++ * testsuite/libgomp.fortran/target4.f90: Likewise. ++ * testsuite/libgomp.fortran/target5.f90: Likewise. ++ * testsuite/libgomp.fortran/target6.f90: Likewise. ++ * testsuite/libgomp.fortran/target7.f90: Likewise. ++ * testsuite/libgomp.fortran/target8.f90: Likewise. ++ * testsuite/libgomp.fortran/task1.f90: Likewise. ++ * testsuite/libgomp.fortran/task2.f90: Likewise. ++ * testsuite/libgomp.fortran/task3.f90: Likewise. ++ * testsuite/libgomp.fortran/task4.f90: Likewise. ++ * testsuite/libgomp.fortran/taskgroup1.f90: Likewise. ++ * testsuite/libgomp.fortran/taskloop1.f90: Likewise. ++ * testsuite/libgomp.fortran/taskloop2.f90: Likewise. ++ * testsuite/libgomp.fortran/taskloop3.f90: Likewise. ++ * testsuite/libgomp.fortran/taskloop4.f90: Likewise. ++ * testsuite/libgomp.fortran/threadprivate1.f90: Likewise. ++ * testsuite/libgomp.fortran/threadprivate2.f90: Likewise. ++ * testsuite/libgomp.fortran/threadprivate3.f90: Likewise. ++ * testsuite/libgomp.fortran/threadprivate4.f90: Likewise. ++ * testsuite/libgomp.fortran/udr1.f90: Likewise. ++ * testsuite/libgomp.fortran/udr10.f90: Likewise. ++ * testsuite/libgomp.fortran/udr11.f90: Likewise. ++ * testsuite/libgomp.fortran/udr12.f90: Likewise. ++ * testsuite/libgomp.fortran/udr13.f90: Likewise. ++ * testsuite/libgomp.fortran/udr14.f90: Likewise. ++ * testsuite/libgomp.fortran/udr15.f90: Likewise. ++ * testsuite/libgomp.fortran/udr2.f90: Likewise. ++ * testsuite/libgomp.fortran/udr3.f90: Likewise. ++ * testsuite/libgomp.fortran/udr4.f90: Likewise. ++ * testsuite/libgomp.fortran/udr5.f90: Likewise. ++ * testsuite/libgomp.fortran/udr6.f90: Likewise. ++ * testsuite/libgomp.fortran/udr7.f90: Likewise. ++ * testsuite/libgomp.fortran/udr8.f90: Likewise. ++ * testsuite/libgomp.fortran/udr9.f90: Likewise. ++ * testsuite/libgomp.fortran/vla1.f90: Likewise. ++ * testsuite/libgomp.fortran/vla2.f90: Likewise. ++ * testsuite/libgomp.fortran/vla3.f90: Likewise. ++ * testsuite/libgomp.fortran/vla4.f90: Likewise. ++ * testsuite/libgomp.fortran/vla5.f90: Likewise. ++ * testsuite/libgomp.fortran/vla6.f90: Likewise. ++ * testsuite/libgomp.fortran/vla7.f90: Likewise. ++ * testsuite/libgomp.fortran/vla8.f90: Likewise. ++ * testsuite/libgomp.fortran/workshare1.f90: Likewise. ++ * testsuite/libgomp.fortran/workshare2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/abort-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/abort-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/acc_on_device-1-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/acc_on_device-1-2.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/acc_on_device-1-3.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/asyncwait-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/asyncwait-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/asyncwait-3.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/atomic_capture-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/atomic_rw-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/atomic_update-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/c2.pl: Likewise. ++ * testsuite/libgomp.oacc-fortran/clauses-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/collapse-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/collapse-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/collapse-3.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/collapse-4.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/collapse-5.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/collapse-6.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/collapse-7.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/collapse-8.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/combined-directives-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/combined-reduction.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-3.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-4-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/data-4.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/declare-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/declare-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/declare-3.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/declare-4.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/declare-5.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/default-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/firstprivate-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/gang-static-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/host_data-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/if-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/implicit-firstprivate-ref.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-loop-2.f95: Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-loop-data-2.f95: Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-loop-data-enter-exit-2.f95: Lik= ewise. ++ * testsuite/libgomp.oacc-fortran/kernels-loop-data-enter-exit.f95: Likew= ise. ++ * testsuite/libgomp.oacc-fortran/kernels-loop-data-update.f95: Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-loop-data.f95: Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-loop.f95: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-10.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-2.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-3.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-32-1.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-32-2.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-4.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-5.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-6.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-7.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/lib-8.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/map-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/nested-function-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/nested-function-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/nested-function-3.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/non-scalar-data.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/openacc_version-1.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/openacc_version-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/par-reduction-2-1.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/par-reduction-2-2.f: Likewise. ++ * testsuite/libgomp.oacc-fortran/parallel-reduction.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/pointer-align-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/pr70643.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/pr81352.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/pr83920.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/pr84028.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/private-variables.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/pset-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/reduction-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/reduction-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/reduction-3.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/reduction-4.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/reduction-5.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/reduction-6.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/reduction-7.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/reduction-8.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/routine-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/routine-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/routine-3.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/routine-4.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/routine-5.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/routine-7.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/routine-9.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/subarrays-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/subarrays-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/update-1.f90: Likewise. ++ ++2018-03-20 Richard Biener ++ ++ * testsuite/libgomp.graphite/force-parallel-4.c: XFAIL one ++ parallelizable loop. ++ ++2018-02-19 Igor Tsimbalist ++ ++ PR target/84148 ++ * configure: Regenerate. +=20 +- Backported from mainline +- 2018-02-16 Jakub Jelinek ++2018-02-16 Jakub Jelinek +=20 + PR fortran/84418 + * libgomp.fortran/pr84418-1.f90: New test. + * libgomp.fortran/pr84418-2.f90: New test. +=20 +- 2018-01-29 Christoph Spiel +- Jakub Jelinek ++2018-02-14 Jakub Jelinek ++ ++ PR fortran/84313 ++ * testsuite/libgomp.fortran/threadprivate4.f90: Add ++ -std=3Df2003 -fall-intrinsics into dg-additional-options. ++ ++2018-02-08 Martin Jambor ++ ++ * testsuite/libgomp.hsa.c/pr82416.c: Make the function with target ++ clonable. ++ ++2018-02-08 Martin Jambor ++ ++ * testsuite/libgomp.hsa.c/staticvar.c: New test. ++ ++2018-02-07 Rainer Orth ++ ++ * testsuite/libgomp.oacc-c-c++-common/pr84217.c (abort) ++ [__cplusplus]: Declare extern "C". ++ ++2018-02-07 Tom de Vries ++ ++ PR libgomp/84217 ++ * testsuite/libgomp.oacc-c-c++-common/pr84217.c: New test. ++ ++2018-01-29 Christoph Spiel ++ Jakub Jelinek +=20 + PR libgomp/84096 + * omp.h.in (omp_init_nest_lock_with_hint): Use omp_nest_lock_t + instead of omp_lock_t. +=20 +-2018-02-09 Martin Jambor ++2018-01-25 Tom de Vries +=20 +- Backport from mainline +- 2018-02-08 Martin Jambor ++ PR target/84028 ++ * testsuite/libgomp.oacc-fortran/pr84028.f90: New test. +=20 +- * testsuite/libgomp.hsa.c/staticvar.c: New test. ++2018-01-24 Tom de Vries ++ ++ PR target/83589 ++ * testsuite/libgomp.oacc-c-c++-common/pr83589.c: New test. ++ ++2018-01-24 Tom de Vries ++ ++ PR target/81352 ++ * testsuite/libgomp.oacc-fortran/pr81352.f90: New test. ++ ++2018-01-19 Tom de Vries ++ Cesar Philippidis ++ ++ PR target/83920 ++ * testsuite/libgomp.oacc-c-c++-common/pr83920.c: New test. ++ * testsuite/libgomp.oacc-fortran/pr83920.f90: New test. ++ ++2018-01-03 Jakub Jelinek ++ ++ Update copyright years. ++ ++ * libgomp.texi: Bump @copying's copyright year. +=20 +-2018-01-25 Release Manager ++2017-12-30 Tom de Vries +=20 +- * GCC 7.3.0 released. ++ PR libgomp/83046 ++ * testsuite/libgomp.oacc-c-c++-common/pr83046.c: New test. ++ * testsuite/libgomp.c-c++-common/pr83046.c: New test. +=20 +-2017-12-15 Jakub Jelinek ++2017-12-27 Tom de Vries +=20 +- Backported from mainline +- 2017-11-24 Jakub Jelinek ++ PR c++/83046 ++ * testsuite/libgomp.oacc-c-c++-common/gang-static-2.c (test_static) ++ (test_nonstatic): Fix return type to workaround PR83046. ++ ++2017-12-05 Jakub Jelinek ++ ++ PR testsuite/83281 ++ * testsuite/libgomp.oacc-c-c++-common/reduction-cplx-flt.c (main): Use ++ j suffix instead of i. ++ * testsuite/libgomp.oacc-c-c++-common/reduction-cplx-dbl.c (main): ++ Likewise. ++ ++2017-12-01 Cesar Philippidis ++ ++ * testsuite/libgomp.oacc-c-c++-common/data-2-lib.c: Add missing ++ call to acc_wait (1). ++ ++2017-11-24 Jakub Jelinek +=20 + PR fortran/81304 + * testsuite/libgomp.fortran/pr81304.f90: New test. +=20 +- 2017-11-23 Jakub Jelinek ++2017-11-23 Jakub Jelinek +=20 + PR fortran/81841 + * libgomp.fortran/pr81841.f90: New test. +=20 +-2017-12-10 Tom de Vries ++2017-11-22 Jakub Jelinek ++ ++ PR libgomp/83106 ++ * target.c (gomp_target_init): Compute lengths just once and ++ use them in both malloc size and subsequent copying. ++ ++2017-11-17 Igor Tsimbalist ++ ++ * configure.ac: Set CET_FLAGS, update XCFLAGS and FCFLAGS. ++ * acinclude.m4: Add cet.m4. ++ * configure: Regenerate. ++ * Makefile.in: Likewise. ++ * testsuite/Makefile.in: Likewise. ++ ++2017-11-15 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/f-asyncwait-1.c: New test, copied ++ from asyncwait-1.f90. Rewrite into C. Rewrite from float to int. ++ * testsuite/libgomp.oacc-c-c++-common/f-asyncwait-2.c: New test, copied ++ from asyncwait-2.f90. Rewrite into C. Rewrite from float to int. ++ * testsuite/libgomp.oacc-c-c++-common/f-asyncwait-3.c: New test, copied ++ from asyncwait-3.f90. Rewrite into C. Rewrite from float to int. ++ ++2017-11-14 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/asyncwait-1.c: Allow to run for ++ non-nvidia devices. ++ ++2017-11-07 Jakub Jelinek ++ ++ PR c++/82835 ++ * testsuite/libgomp.c++/pr82835.C: New test. ++ ++2017-11-06 Martin Liska ++ ++ * testsuite/libgomp.c++/loop-2.C: Return a value ++ for functions with non-void return type, or change type to void, ++ or add -Wno-return-type for test. ++ * testsuite/libgomp.c++/loop-4.C: Likewise. ++ * testsuite/libgomp.c++/parallel-1.C: Likewise. ++ * testsuite/libgomp.c++/shared-1.C: Likewise. ++ * testsuite/libgomp.c++/single-1.C: Likewise. ++ * testsuite/libgomp.c++/single-2.C: Likewise. ++ ++2017-10-31 Tom de Vries ++ ++ * plugin/plugin-hsa.c (HSA_LOG): Remove semicolon after ++ "do {} while (false)". ++ (init_single_kernel, GOMP_OFFLOAD_async_run): Add missing semicolon ++ after HSA_DEBUG call. ++ ++2017-10-28 Jakub Jelinek ++ ++ * target.c (struct gomp_coalesce_buf): New type. ++ (MAX_COALESCE_BUF_SIZE, MAX_COALESCE_BUF_GAP): Define. ++ (gomp_coalesce_buf_add, gomp_to_device_kind_p): New functions. ++ (gomp_copy_host2dev): Add CBUF argument, if copying into ++ the cached ranges, memcpy into buffer instead of copying ++ into device. ++ (gomp_map_vars_existing, gomp_map_pointer, gomp_map_fields_existing): ++ Add CBUF argument, pass it through to other calls. ++ (gomp_map_vars): Aggregate copies from host to device if small enough ++ and with small enough gaps in between into memcpy into a buffer and ++ fewer host to device copies from the buffer. ++ (gomp_update): Adjust gomp_copy_host2dev caller. ++ ++2017-10-17 Thomas Schwinge ++ ++ * testsuite/libgomp.oacc-fortran/declare-1.f90: Restore "dg-do ++ run" directive. ++ * testsuite/libgomp.oacc-fortran/declare-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/declare-3.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/declare-4.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/declare-5.f90: Likewise. ++ ++2017-10-16 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/declare-1.c: Don't require ++ openacc_nvidia_accel_selected. ++ * testsuite/libgomp.oacc-c-c++-common/declare-2.c: Same. ++ * testsuite/libgomp.oacc-c-c++-common/declare-4.c: Same. ++ * testsuite/libgomp.oacc-fortran/declare-2.f90: Same. ++ * testsuite/libgomp.oacc-fortran/declare-4.f90: Same ++ * testsuite/libgomp.oacc-fortran/declare-5.f90: Same. ++ * testsuite/libgomp.oacc-c-c++-common/declare-5.c: Don't require ++ openacc_nvidia_accel_selected. Skip for shared memory device. ++ * testsuite/libgomp.oacc-fortran/declare-1.f90: Same. ++ * testsuite/libgomp.oacc-fortran/declare-3.f90: Same. ++ ++2017-10-09 Martin Jambor ++ ++ PR hsa/82416 ++ * testsuite/libgomp.hsa.c/pr82416.c: New test. ++ ++2017-10-07 Tom de Vries ++ ++ * testsuite/libgomp.oacc-fortran/firstprivate-1.f90 (firstprivate): ++ Remove acc_device_nvidia references. ++ * testsuite/libgomp.oacc-fortran/parallel-reduction.f90 (reduction): ++ Same. ++ ++2017-10-05 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/loop-red-g-1.c (main): Remove ++ vector_length(32) clause from acc parallel directive. ++ * testsuite/libgomp.oacc-c-c++-common/routine-g-1.c (main): Same. ++ ++2017-10-04 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/par-loop-comb-reduction-3.c ++ (main): Reduce sum of arr elements. Assert that hres is exactly ++ representable in 32-bit floating point. ++ * testsuite/libgomp.oacc-c-c++-common/par-loop-comb-reduction-4.c ++ (main): Reduce sum of arr elements. Assert that hres and hmres are ++ exactly representable in 32-bit floating point. ++ * testsuite/libgomp.oacc-c-c++-common/reduction-7.c (gwv_np_4): Same. ++ ++2017-09-28 Tom de Vries ++ ++ * testsuite/libgomp.c++/for-12.C: Remove superfluous -fopenmp option ++ setting. ++ * testsuite/libgomp.c++/pr69393.C: Same. ++ * testsuite/libgomp.c++/taskloop-1.C: Same. ++ * testsuite/libgomp.c++/taskloop-3.C: Same. ++ * testsuite/libgomp.c++/taskloop-4.C: Same. ++ * testsuite/libgomp.c/for-4.c: Same. ++ * testsuite/libgomp.c/pr66199-3.c: Same. ++ * testsuite/libgomp.c/pr66199-4.c: Same. ++ * testsuite/libgomp.c/pr66199-6.c: Same. ++ * testsuite/libgomp.c/taskloop-1.c: Same. ++ * testsuite/libgomp.c/taskloop-3.c: Same. ++ * testsuite/libgomp.c/taskloop-4.c: Same. ++ * testsuite/libgomp.fortran/aligned1.f03: Same. ++ * testsuite/libgomp.fortran/condinc1.f: Same. ++ * testsuite/libgomp.fortran/condinc3.f90: Same. ++ * testsuite/libgomp.fortran/crayptr1.f90: Same. ++ * testsuite/libgomp.fortran/crayptr2.f90: Same. ++ * testsuite/libgomp.fortran/crayptr3.f90: Same. ++ * testsuite/libgomp.fortran/omp_cond1.f: Same. ++ * testsuite/libgomp.fortran/omp_cond3.F90: Same. ++ * testsuite/libgomp.fortran/pr66199-1.f90: Same. ++ * testsuite/libgomp.fortran/pr66199-2.f90: Same. ++ * testsuite/libgomp.fortran/recursion1.f90: Same. ++ * testsuite/libgomp.fortran/target2.f90: Same. ++ * testsuite/libgomp.fortran/target5.f90: Same. ++ * testsuite/libgomp.fortran/task3.f90: Same. ++ ++2017-09-28 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/loop-g-1.c (main): Remove ++ vector_length(32) clause from acc parallel directive. ++ * testsuite/libgomp.oacc-c-c++-common/loop-g-2.c (main): Same. ++ ++2017-09-27 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c-c++-common/parallel-reduction.c (main): ++ Remove acc_device_nvidia references. ++ ++2017-09-16 Tom de Vries +=20 +- backport from trunk: + PR c/81875 +- 2017-09-16 Tom de Vries ++ * testsuite/libgomp.c-c++-common/pr81875.c: New test. +=20 +- * testsuite/libgomp.c/pr81875.c: New test. ++2017-09-14 Tom de Vries +=20 +-2017-09-15 Jakub Jelinek ++ * testsuite/libgomp.c++/cancel-taskgroup-1.C: Remove. ++ * testsuite/libgomp.c/cancel-taskgroup-1.c: Move to ... ++ * testsuite/libgomp.c-c++-common/cancel-taskgroup-1.c: ... here. ++ * testsuite/libgomp.c/c.exp: Include test-cases from ++ libgomp.c-c++-common. ++ * testsuite/libgomp.c++/c++.exp: Same. Force c++-mode compilation of .c ++ files. +=20 +- Backported from mainline +- 2017-09-14 Jakub Jelinek ++2017-09-14 Jakub Jelinek +=20 + PR c++/81314 + * testsuite/libgomp.c++/pr81314.C: New test. +=20 +-2017-09-07 Jakub Jelinek +- +- Backported from mainline +- 2017-08-09 Jakub Jelinek ++2017-09-03 Gerald Pfeifer ++ ++ * libgomp.texi (Top): www.openacc.org now uses https. ++ (Enabling OpenACC): Ditto. ++ (acc_get_num_devices): Ditto. ++ (acc_set_device_type): Ditto. ++ (acc_get_device_type): Ditto. ++ (acc_set_device_num): Ditto. ++ (acc_get_device_num): Ditto. ++ (acc_async_test): Ditto. ++ (acc_async_test_all): Ditto. ++ (acc_wait): Ditto. ++ (acc_wait_all): Ditto. ++ (acc_wait_all_async): Ditto. ++ (acc_wait_async): Ditto. ++ (acc_init): Ditto. ++ (acc_shutdown): Ditto. ++ (acc_on_device): Ditto. ++ (acc_malloc): Ditto. ++ (acc_free): Ditto. ++ (acc_copyin): Ditto. ++ (acc_present_or_copyin): Ditto. ++ (acc_create): Ditto. ++ (acc_present_or_create): Ditto. ++ (acc_copyout): Ditto. ++ (acc_delete): Ditto. ++ (acc_update_device): Ditto. ++ (acc_update_self): Ditto. ++ (acc_map_data): Ditto. ++ (acc_unmap_data): Ditto. ++ (acc_deviceptr): Ditto. ++ (acc_hostptr): Ditto. ++ (acc_is_present): Ditto. ++ (acc_memcpy_to_device): Ditto. ++ (acc_memcpy_from_device): Ditto. ++ (acc_get_current_cuda_device): Ditto. ++ (acc_get_current_cuda_context): Ditto. ++ (acc_get_cuda_stream): Ditto. ++ (acc_set_cuda_stream): Ditto. ++ (ACC_DEVICE_TYPE): Ditto. ++ (ACC_DEVICE_NUM): Ditto. ++ (OpenACC Library Interoperability): Ditto. ++ ++2017-08-09 Jakub Jelinek +=20 + PR c/81687 + * testsuite/libgomp.c/pr81687-1.c: New test. + * testsuite/libgomp.c/pr81687-2.c: New test. +=20 +- 2017-07-27 Jakub Jelinek ++2017-08-07 Jakub Jelinek ++ ++ PR c/69389 ++ * testsuite/libgomp.c/pr69389.c: New test. ++ * testsuite/libgomp.c++/pr69389.C: New test. ++ ++2017-08-07 Tom de Vries ++ ++ PR middle-end/78266 ++ * testsuite/libgomp.oacc-c-c++-common/vprop-2.c: New test. ++ * testsuite/libgomp.oacc-c-c++-common/vprop.c: Remove xfail. ++ ++2017-07-27 Jakub Jelinek +=20 + PR c/45784 + * testsuite/libgomp.c/pr45784.c: New test. + * testsuite/libgomp.c++/pr45784.C: New test. +=20 +-2017-08-14 Release Manager ++2017-07-19 Tom de Vries ++ ++ * testsuite/libgomp.oacc-c/vec.c: New test. ++ ++2017-07-03 Tom de Vries ++ ++ * plugin/plugin-hsa.c: Fix secure_getenv.h include. ++ ++2017-06-27 Tom de Vries ++ ++ * plugin/plugin-nvptx.c (notify_var): New function. ++ (nvptx_exec): Use notify_var for GOMP_OPENACC_DIM. +=20 +- * GCC 7.2.0 released. ++2017-06-27 Tom de Vries ++ ++ * env.c (parse_unsigned_long_1): Factor out of ... ++ (parse_unsigned_long): ... here. ++ (parse_int_1): Factor out of ... ++ (parse_int): ... here. ++ (parse_int_secure): New function. ++ (initialize_env): Use parse_int_secure for GOMP_DEBUG. ++ * secure_getenv.h: Factor out of ... ++ * plugin/plugin-hsa.c: ... here. ++ * testsuite/libgomp.oacc-c-c++-common/gomp-debug-env.c: New test. +=20 + 2017-06-21 Jakub Jelinek +=20 + PR c++/81130 + * testsuite/libgomp.c++/pr81130.C: New test. +=20 +-2017-06-02 Jakub Jelinek ++2017-06-17 Rainer Orth ++ ++ * testsuite/libgomp.fortran/strassen.f90: Remove dg-skip-if ++ default args. ++ * testsuite/libgomp.oacc-c-c++-common/vprop.c: Remove ++ dg-xfail-run-if default args. ++ ++2017-06-02 Bernd Edlinger ++ ++ * testsuite/libgomp.c/pr39591-2.c: Fix test case. ++ * testsuite/libgomp.c/pr39591-3.c: Likewise. +=20 +- Backported from mainline +- 2017-05-30 Jakub Jelinek ++2017-05-30 Jakub Jelinek +=20 + PR libgomp/80822 + * config/linux/affinity.c (gomp_affinity_init_level_1): New function. +@@ -157,10 +4377,63 @@ + sibling lists, depending on level just pick up what CPUs to put + together into a place vs. whether add multiple ordered places. +=20 +-2017-05-26 Jakub Jelinek ++2017-05-24 Thomas Schwinge ++ ++ * openacc.h (acc_async_wait, acc_async_wait_all): New prototypes. ++ * libgomp.map (OACC_2.0.1): Add these. ++ * oacc-async.c (acc_async_wait, acc_async_wait_all): New aliases ++ for "acc_wait", and "acc_wait_all", respectively. ++ * openacc.f90 (acc_async_wait, acc_async_wait_all): New interfaces ++ for "acc_wait", and "acc_wait_all", respectively. ++ * openacc_lib.h (acc_async_wait, acc_async_wait_all): Likewise. ++ * libgomp.texi (acc_wait, acc_wait_all): Update. ++ * testsuite/libgomp.oacc-c-c++-common/par-reduction-2.c: Update. ++ * testsuite/libgomp.oacc-fortran/par-reduction-2-1.f: New file. ++ * testsuite/libgomp.oacc-fortran/par-reduction-2-2.f: Likewise. ++ ++ * openacc_lib.h (acc_pcopyin, acc_pcreate): Route to ++ acc_present_or_copyin and acc_present_or_create procedures, ++ respectively. ++ * testsuite/libgomp.oacc-fortran/lib-32-1.f: Exercise these, and ++ generally different variants of OpenACC Runtime Library functions. ++ * testsuite/libgomp.oacc-fortran/lib-32-2.f: Likewise. ++ ++ * testsuite/libgomp.oacc-fortran/lib-32-1.f: New file. ++ * testsuite/libgomp.oacc-fortran/lib-32-2.f: Likewise. ++ ++ * openacc.h (acc_pcopyin, acc_pcreate): Provide prototypes instead ++ of preprocessor definitions. ++ * libgomp.h (strong_alias): Guard by "#ifdef ++ HAVE_ATTRIBUTE_ALIAS". ++ * oacc-mem.c: Provide "acc_pcreate" as alias for ++ "acc_present_or_create", and "acc_pcopyin" as alias for ++ "acc_present_or_copyin". ++ * libgomp.map: New version "OACC_2.0.1". ++ (OACC_2.0.1): Add "acc_pcopyin", and "acc_pcreate". ++ * testsuite/libgomp.oacc-c-c++-common/lib-38.c: Remove, merging ++ its content into... ++ * testsuite/libgomp.oacc-c-c++-common/lib-32.c: ... this file. ++ Extend testing. ++ ++ * plugin/plugin-nvptx.c (nvptx_get_num_devices): Debugging output ++ when disabling nvptx offloading. ++ ++2017-05-23 Thomas Schwinge ++ ++ * testsuite/libgomp.oacc-c-c++-common/kernels-loop-2.c: Update. ++ * testsuite/libgomp.oacc-c-c++-common/parallel-dims.c: Likewise. ++ * testsuite/libgomp.oacc-fortran/kernels-loop-2.f95: Likewise. ++ ++ * testsuite/libgomp.oacc-c-c++-common/parallel-dims.c: Rewrite. ++ * testsuite/lib/libgomp.exp ++ (check_effective_target_openacc_nvidia_accel_configured): New ++ proc. ++ * testsuite/libgomp.oacc-c++/c++.exp (check_effective_target_c) ++ (check_effective_target_c++): New procs. ++ * testsuite/libgomp.oacc-c/c.exp (check_effective_target_c) ++ (check_effective_target_c++): Likewise. +=20 +- Backported from mainline +- 2017-05-22 Jakub Jelinek ++2017-05-22 Jakub Jelinek +=20 + PR middle-end/80809 + * testsuite/libgomp.c/pr80809-2.c: New test. +@@ -172,9 +4445,20 @@ + PR middle-end/80853 + * testsuite/libgomp.c/pr80853.c: New test. +=20 +-2017-05-02 Release Manager ++2017-05-19 Thomas Schwinge ++ ++ * testsuite/libgomp.oacc-c++/template-reduction.C: Update. ++ * testsuite/libgomp.oacc-c-c++-common/nested-2.c: Update. ++ * testsuite/libgomp.oacc-fortran/data-4-2.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/default-1.f90: Likewise. ++ * testsuite/libgomp.oacc-fortran/non-scalar-data.f90: Likewise. ++ ++ * plugin/plugin-hsa.c (DLSYM_FN, init_hsa_runtime_functions): ++ Debug output for failure. ++ ++2017-05-12 Rainer Orth +=20 +- * GCC 7.1.0 released. ++ * testsuite/lib/libgomp.exp: Load scanlang.exp. +=20 + 2017-04-27 Jakub Jelinek +=20 +@@ -184,9 +4468,6 @@ +=20 + 2017-04-20 Alexander Monakov +=20 +- Backport from mainline +- 2017-04-20 Alexander Monakov +- + * testsuite/libgomp.c/target-36.c: New testcase. +=20 + 2017-04-13 Jakub Jelinek +@@ -431,7 +4712,7 @@ + * config/nvptx/affinity.c: Delete to use fallback implementation. +=20 + 2016-11-23 Alexander Monakov +- Jakub Jelinek ++ Jakub Jelinek + Dmitry Melnik +=20 + * Makefile.am (libgomp_la_SOURCES): Add atomic.c, icv.c, icv-device.c. +@@ -533,7 +4814,7 @@ + * testsuite/libgomp.hsa.c/tiling-2.c: Likewise. +=20 + 2016-11-23 Martin Liska +- Martin Jambor ++ Martin Jambor +=20 + * plugin/hsa.h: New file. + * plugin/hsa_ext_finalize.h: New file. +@@ -583,7 +4864,7 @@ + * testsuite/Makefile.in: Likewise. +=20 + 2016-11-15 Martin Jambor +- Alexander Monakov ++ Alexander Monakov +=20 + * testsuite/libgomp.fortran/examples-4/device-1.f90 (e_57_1): Add + mapping clauses to target constructs. +@@ -973,7 +5254,7 @@ +=20 + 2016-05-16 Martin Jambor +=20 +- * testsuite/libgomp.hsa.c/complex-align-2.c: New test. ++ * testsuite/libgomp.hsa.c/complex-align-2.c: New test. +=20 + 2016-05-02 Nathan Sidwell +=20 +@@ -2639,7 +6920,7 @@ + * libgomp_g.h (GOACC_parallel): Remove. + (GOACC_parallel_keyed): Declare. + * plugin/plugin-nvptx.c (struct targ_fn_launch): New struct. +- (stuct targ_gn_descriptor): Replace name field with launch field. ++ (struct targ_gn_descriptor): Replace name field with launch field. + (nvptx_exec): Lose separate geometry args, take array. Process + dynamic dimensions and adjust. + (struct nvptx_tdata): Replace fn_names field with fn_descs. +@@ -2660,7 +6941,7 @@ + 2015-09-08 Aditya Kumar + Sebastian Pop +=20 +- * testsuite/libgomp.graphite/bounds.c (int foo): Modifed test case to ++ * testsuite/libgomp.graphite/bounds.c (int foo): Modified test case to + match o/p. + * testsuite/libgomp.graphite/force-parallel-1.c (void parloop): Same. + * testsuite/libgomp.graphite/force-parallel-4.c: Same. +@@ -2937,7 +7218,7 @@ + * target.c (struct offload_image_descr): Constify target_data. + (gomp_offload_image_to_device): Likewise. + (GOMP_offload_register): Likewise. +- (GOMP_offload_unrefister): Likewise. ++ (GOMP_offload_unregister): Likewise. + * plugin/plugin-host.c (GOMP_OFFLOAD_load_image, + GOMP_OFFLOAD_unload_image): Constify target data. + * plugin/plugin-nvptx.c (struct ptx_image_data): Constify target data. +@@ -4263,7 +8544,7 @@ + 2014-12-12 Kyrylo Tkachov +=20 + * testsuite/lib/libgomp.exp: Load target-utils.exp. +- Move load of target-supportes.exp earlier. ++ Move load of target-supports.exp earlier. +=20 + 2014-12-10 Ilya Verbin +=20 +@@ -4750,7 +9031,7 @@ +=20 + 2013-12-17 Andreas Tobler +=20 +- * testsuite/libgomp.c/affinity-1.c: Remove alloca.h inlcude. Replace ++ * testsuite/libgomp.c/affinity-1.c: Remove alloca.h include. Replace + alloca () with __builtin_alloca (). + * testsuite/libgomp.c/icv-2.c: Add FreeBSD coverage. + * testsuite/libgomp.c/lock-3.c: Likewise. +@@ -4910,7 +9191,7 @@ + (gomp_team_end): Use gomp_managed_threads_lock instead of + gomp_remaining_threads_lock. Use gomp_team_barrier_wait_final instead + of gomp_team_barrier_wait. If team->team_cancelled, call +- gomp_fini_worshare on ws chain starting at team->work_shares_to_free ++ gomp_fini_workshare on ws chain starting at team->work_shares_to_free + rather than thr->ts.work_share. + (initialize_team): Don't call gomp_sem_init here. + * sections.c (GOMP_parallel_sections_start): Adjust gomp_team_start +@@ -7381,7 +11662,7 @@ + PR libgomp/30546 + * configure.ac: Add check for makeinfo + * Makefile.am: Redefined target libgomp.info, build libgomp.info only +- if an appropiate version of makeinfo is found. ++ if an appropriate version of makeinfo is found. + * aclocal.m4: Regenerated. + * configure: Regenerated. + * Makefile.in: Regenerated. +@@ -8285,7 +12566,7 @@ +=20 + * configure.ac: Determine whether -pthread or -lpthread is needed. + * Makefile.am (libgomp_la_LDFLAGS): Remove explicit -lpthread. +- * Makefine.in, configure: Rebuild. ++ * Makefile.in, configure: Rebuild. +=20 + 2005-09-28 Richard Henderson +=20 +@@ -8717,7 +12998,7 @@ +=20 + Initial implementation and checkin. + +-Copyright (C) 2005-2017 Free Software Foundation, Inc. ++Copyright (C) 2005-2020 Free Software Foundation, Inc. +=20 + Copying and distribution of this file, with or without modification, + are permitted in any medium without royalty provided the copyright +diff --git a/libgomp/Makefile.in b/libgomp/Makefile.in +index 920d29d1c4c..9deafc4e0ce 100644 +--- a/libgomp/Makefile.in ++++ b/libgomp/Makefile.in +@@ -101,6 +101,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4= \ + $(top_srcdir)/../config/lthostflags.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/stdint.m4 \ + $(top_srcdir)/../config/tls.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libgomp/aclocal.m4 b/libgomp/aclocal.m4 +index a1f51f27651..c244c2549e5 100644 +--- a/libgomp/aclocal.m4 ++++ b/libgomp/aclocal.m4 +@@ -998,6 +998,7 @@ m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) + m4_include([../config/tls.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libgomp/configure b/libgomp/configure +index 06166c66120..6b3beae0f63 100755 +--- a/libgomp/configure ++++ b/libgomp/configure +@@ -782,6 +782,7 @@ enable_option_checking + enable_version_specific_runtime_libs + enable_generated_files_in_srcdir + enable_multilib ++with_toolexeclibdir + enable_dependency_tracking + enable_shared + enable_static +@@ -1455,6 +1456,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -3338,6 +3342,22 @@ fi + ac_config_commands=3D"$ac_config_commands default-1" +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -3353,7 +3373,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -11155,7 +11182,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11158 "configure" ++#line 11185 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11261,7 +11288,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11264 "configure" ++#line 11295 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libgomp/configure.ac b/libgomp/configure.ac +index a42d4f08b4b..a3500d71480 100644 +--- a/libgomp/configure.ac ++++ b/libgomp/configure.ac +@@ -65,6 +65,8 @@ target_alias=3D${target_alias-$host_alias} + AM_INIT_AUTOMAKE([1.9.0 foreign no-dist -Wall -Wno-portability -Wno-overr= ide]) + AM_ENABLE_MULTILIB(, ..) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -80,7 +82,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libgomp/testsuite/Makefile.in b/libgomp/testsuite/Makefile.in +index 6edb7ae7ade..0492e7788ab 100644 +--- a/libgomp/testsuite/Makefile.in ++++ b/libgomp/testsuite/Makefile.in +@@ -63,6 +63,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lthostflags.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/stdint.m4 \ + $(top_srcdir)/../config/tls.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libhsail-rt/ChangeLog b/libhsail-rt/ChangeLog +index 4976473f831..5f32d42e9d7 100644 +--- a/libhsail-rt/ChangeLog ++++ b/libhsail-rt/ChangeLog +@@ -1,30 +1,66 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * Makefile.in: Regenerate. ++ * aclocal.m4: Regenerate. ++ * configure: Regenerate. ++ ++2020-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++2019-09-27 Maciej W. Rozycki ++ ++ * configure: Regenerate. ++ ++2019-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++2018-10-31 Joseph Myers ++ ++ PR bootstrap/82856 ++ * configure.ac: Remove AC_PREREQ. ++ * Makefile.in, aclocal.m4, configure: Regenerate. +=20 +-2018-12-06 Release Manager ++2018-05-04 Pekka J=C3=A4=C3=A4skel=C3=A4inen +=20 +- * GCC 7.4.0 released. ++ * include/internal/phsa-rt.h: Whitespace cleanup. ++ * include/internal/workitems.h: Store work item ID data to easily ++ accessible locations. ++ * rt/workitems.c: Same. +=20 +-2018-06-22 Jakub Jelinek ++2018-05-04 Pekka J=C3=A4=C3=A4skel=C3=A4inen +=20 +- Backported from mainline +- 2018-04-18 David Malcolm ++ * rt/workitems.c: Fix an alloca stack underflow. ++ ++2018-04-18 David Malcolm +=20 + PR jit/85384 + * configure: Regenerate. +=20 +-2018-01-25 Release Manager ++2018-01-03 Jakub Jelinek +=20 +- * GCC 7.3.0 released. ++ Update copyright years. ++ ++2017-09-27 Pekka J=C3=A4=C3=A4skel=C3=A4inen ++ ++ * include/internal/phsa-rt.h: Support for improved group segment ++ handling with a stack-like allocation scheme. ++ * include/internal/workitems.h: Likewise. ++ * rt/workitems.c: Likewise. +=20 +-2017-08-14 Release Manager ++2017-09-25 Pekka J=C3=A4=C3=A4skel=C3=A4inen +=20 +- * GCC 7.2.0 released. ++ * rt/workitems.c: Assume the host runtime allocates the work group ++ memory. +=20 +-2017-05-02 Release Manager ++2017-05-03 Pekka J=C3=A4=C3=A4skel=C3=A4inen +=20 +- * GCC 7.1.0 released. ++ * rt/workitems.c: Removed a leftover comment. ++ * rt/arithmetic.c (__hsail_class_f32, __hsail_class_f64): Fix the ++ check for signaling/non-signalling NaN. Add class_f64 default ++ implementation. +=20 + 2017-02-01 Jakub Jelinek +=20 +@@ -108,7 +144,7 @@ + * rt/segment.c: Likewise. + * rt/workitems.c: Likewise. + +-Copyright (C) 2017 Free Software Foundation, Inc. ++Copyright (C) 2017-2020 Free Software Foundation, Inc. +=20 + Copying and distribution of this file, with or without modification, + are permitted in any medium without royalty provided the copyright +diff --git a/libhsail-rt/Makefile.in b/libhsail-rt/Makefile.in +index 528cdb0b423..0b6596b79bc 100644 +--- a/libhsail-rt/Makefile.in ++++ b/libhsail-rt/Makefile.in +@@ -106,6 +106,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4= \ + $(top_srcdir)/../config/depstand.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/configure.ac +diff --git a/libhsail-rt/aclocal.m4 b/libhsail-rt/aclocal.m4 +index 505744c695a..05de587bda2 100644 +--- a/libhsail-rt/aclocal.m4 ++++ b/libhsail-rt/aclocal.m4 +@@ -992,6 +992,7 @@ m4_include([../config/acx.m4]) + m4_include([../config/depstand.m4]) + m4_include([../config/lead-dot.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/libhsail-rt/configure b/libhsail-rt/configure +index a4fcc10c1f9..1b4f2a953d0 100755 +--- a/libhsail-rt/configure ++++ b/libhsail-rt/configure +@@ -737,6 +737,7 @@ enable_option_checking + enable_maintainer_mode + enable_dependency_tracking + enable_version_specific_runtime_libs ++with_toolexeclibdir + enable_shared + enable_static + with_pic +@@ -1395,6 +1396,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -4418,6 +4422,22 @@ fi + { $as_echo "$as_me:${as_lineno-$LINENO}: result: $enable_version_specific= _runtime_libs" >&5 + $as_echo "$enable_version_specific_runtime_libs" >&6; } +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -4433,7 +4453,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -10973,7 +11000,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10976 "configure" ++#line 11003 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11079,7 +11106,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11082 "configure" ++#line 11113 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libhsail-rt/configure.ac b/libhsail-rt/configure.ac +index ed7e3041994..88afd5b56d6 100644 +--- a/libhsail-rt/configure.ac ++++ b/libhsail-rt/configure.ac +@@ -70,6 +70,8 @@ ler-specific directory]), + [enable_version_specific_runtime_libs=3Dno]) + AC_MSG_RESULT($enable_version_specific_runtime_libs) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -85,7 +87,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libitm/ChangeLog b/libitm/ChangeLog +index 414361ba337..feccd160330 100644 +--- a/libitm/ChangeLog ++++ b/libitm/ChangeLog +@@ -1,47 +1,179 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * Makefile.in: Regenerate. ++ * aclocal.m4: Regenerate. ++ * configure: Regenerate. ++ * testsuite/Makefile.in: Regenerate. +=20 +-2019-09-28 Oleg Endo ++2020-01-01 Jakub Jelinek +=20 +- Backport from mainline +- 2018-08-03 Sergei Trofimovich ++ Update copyright years. +=20 +- PR target/86712 +- * config/sh/sjlj.S: Adjust to use PIC vs normal code to avoid +- absolute relocation in a shared library. ++ * libitm.texi: Bump @copying's copyright year. +=20 +-2018-12-13 Peter Bergner ++2019-12-03 Szabolcs Nagy ++ ++ PR libgomp/91938 ++ * configure.tgt: Avoid IE tls on *-*-musl*. ++ ++2019-09-27 Maciej W. Rozycki ++ ++ * configure: Regenerate. ++ ++2019-09-10 Christophe Lyon ++ ++ * config/arm/sjlj.S (ldaddr): Add FDPIC support. ++ ++2019-09-10 Christophe Lyon ++ ++ * configure.tgt: Handle *-*-uclinux*. ++ * configure: Regenerate. +=20 +- Backport from mainline +- 2018-12-13 Peter Bergner ++2019-09-06 Florian Weimer ++ ++ * configure: Regenerate. ++ ++2019-09-03 Chung-Lin Tang ++ ++ PR other/79543 ++ * acinclude.m4 (LIBITM_CHECK_LINKER_FEATURES): Fix GNU ld --version ++ scanning to conform to the GNU Coding Standards. ++ * configure: Regenerate. ++ ++2019-05-03 Jakub Jelinek ++ ++ * Makefile.am (finclude): Remove. ++ * Makefile.in: Regenerated. ++ ++2019-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++2019-01-01 Jakub Jelinek ++ ++ * libitm.texi: Bump @copying's copyright year. ++ ++2018-12-16 Jakub Jelinek ++ ++ PR c++/88482 ++ * eh_cpp.cc (__cxa_throw): Change DEST argument type from ++ void * to void (*) (void *). ++ (_ITM_cxa_throw): Likewise. ++ * libitm.h (_ITM_cxa_throw): Likewise. ++ * libitm.texi (_ITM_cxa_throw): Likewise. ++ ++2018-12-13 Peter Bergner +=20 + * config/powerpc/target.h (htm_available): Add support for + PPC_FEATURE2_HTM_NO_SUSPEND. Use __builtin_cpu_supports if available. +=20 +-2018-12-06 Release Manager ++2018-10-31 Joseph Myers +=20 +- * GCC 7.4.0 released. ++ PR bootstrap/82856 ++ * Makefile.am: Include multilib.am. ++ (AUTOMAKE_OPTIONS): Add info-in-builddir. ++ (CLEANFILES): Remove libitm.info. ++ * configure.ac: Remove AC_PREREQ. ++ * testsuite/Makefile.am (RUNTEST): Remove quotes. ++ * Makefile.in, aclocal.m4, configure, testsuite/Makefile.in: ++ Regenerate. +=20 +-2018-06-22 Jakub Jelinek ++2018-10-30 Nicholas Krause +=20 +- Backported from mainline +- 2018-04-18 David Malcolm ++ PR libitm/86293 ++ * method-serial.cc: Mark varible as potentially unused ++ to silence warning. ++ ++2018-08-03 Sergei Trofimovich ++ ++ * config/sh/sjlj.S: Adjust to use PIC vs normal code to avoid ++ absolute relocation in a shared library. ++ ++2018-06-12 H.J. Lu ++ ++ PR libitm/85988 ++ * config/linux/x86/tls.h (SEG_READ): Use the offset of ++ __private_tm as base. ++ (SEG_WRITE): Likewise. ++ (SEG_ENCODE_WRITE): Correct the offset of pointer_guard for x32. ++ (gtm_thr): Replace SEG_READ(10) with SEG_READ(0). ++ (set_gtm_thr): Replace SEG_WRITE(10) with SEG_WRITE(0). ++ (abi_disp): Replace SEG_DECODE_READ(11) with SEG_DECODE_READ(1). ++ (set_abi_disp): Replace SEG_ENCODE_WRITE(11) with ++ ++2018-05-17 Jason Merrill ++ ++ * beginend.cc (save): Disable -Werror=3Ddeprecated-copy. ++ ++2018-05-02 Tom de Vries ++ ++ PR testsuite/85106 ++ * testsuite/lib/libitm.exp: Include scanltranstree.exp. ++ ++2018-05-02 Tom de Vries ++ ++ PR testsuite/85106 ++ * testsuite/lib/libitm.exp: Include scanwpaipa.exp. ++ ++2018-04-24 H.J. Lu ++ ++ * config/x86/sjlj.S (_ITM_beginTransaction): Add ++ (__CET__ & 2) !=3D 0 check for shadow stack. ++ (GTM_longjmp): Likewise. ++ ++2018-04-24 H.J. Lu ++ ++ * configure: Regenerated. ++ ++2018-04-23 H.J. Lu ++ ++ PR target/85489 ++ * config/x86/sjlj.S (GTM_longjmp): Replace jle/jg with jbe/ja. ++ ++2018-04-19 Jakub Jelinek ++ ++ * configure: Regenerated. ++ ++2018-04-18 David Malcolm +=20 + PR jit/85384 + * configure: Regenerate. +=20 +-2018-01-25 Release Manager ++2018-02-14 Igor Tsimbalist ++ ++ PR target/84148 ++ * configure: Regenerate. ++ ++2018-01-03 Jakub Jelinek +=20 +- * GCC 7.3.0 released. ++ Update copyright years. ++ ++ * libitm.texi: Bump @copying's copyright year. ++ ++2017-11-17 Igor Tsimbalist ++ ++ * Makefile.in: Regenerate. ++ * acinclude.m4: Add enable.m4 and cet.m4. ++ * config/x86/sjlj.S: Include cet.h. ++ (_ITM_beginTransaction): Add _CET_ENDBR. ++ Save Shadow Stack pointer. ++ (GTM_longjmp): Add _CET_ENDBR. Restore Shadow Stack pointer. ++ * config/x86/target.h (struct gtm_jmpbuf): ++ Add new field for Shadow Stack pointer. ++ * configure: Regenerate. ++ * configure.ac: Set CET_FLAGS. Update XCFLAGS. ++ * configure.ac: Update libtool_VERSION for x86. ++ * testsuite/Makefile.in: Regenerate. +=20 +-2017-08-14 Release Manager ++2017-11-17 Igor Tsimbalist +=20 +- * GCC 7.2.0 released. ++ * libitm/config/x86/target.h: Add new field (ssp). ++ * libitm/config/x86/sjlj.S: Change offsets. +=20 +-2017-05-02 Release Manager ++2017-05-12 Rainer Orth +=20 +- * GCC 7.1.0 released. ++ * testsuite/lib/libitm.exp: Load scanlang.exp. +=20 + 2017-04-03 Jonathan Wakely +=20 +@@ -2081,7 +2213,7 @@ +=20 + * Initial commit. + +-Copyright (C) 2008-2017 Free Software Foundation, Inc. ++Copyright (C) 2008-2020 Free Software Foundation, Inc. +=20 + Copying and distribution of this file, with or without modification, + are permitted in any medium without royalty provided the copyright +diff --git a/libitm/Makefile.in b/libitm/Makefile.in +index bd16ce0cfb8..851c6b37f0b 100644 +--- a/libitm/Makefile.in ++++ b/libitm/Makefile.in +@@ -74,6 +74,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ + $(top_srcdir)/../config/tls.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/weakref.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ +diff --git a/libitm/aclocal.m4 b/libitm/aclocal.m4 +index 26de26b7808..3b67780342a 100644 +--- a/libitm/aclocal.m4 ++++ b/libitm/aclocal.m4 +@@ -1022,6 +1022,7 @@ m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) + m4_include([../config/tls.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../config/weakref.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/libitm/configure b/libitm/configure +index 96c494d4a3f..ed47fab3c83 100644 +--- a/libitm/configure ++++ b/libitm/configure +@@ -766,6 +766,7 @@ enable_option_checking + enable_version_specific_runtime_libs + enable_generated_files_in_srcdir + enable_multilib ++with_toolexeclibdir + enable_dependency_tracking + enable_shared + enable_static +@@ -1430,6 +1431,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -3371,6 +3375,22 @@ fi + ac_config_commands=3D"$ac_config_commands default-1" +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -3386,7 +3406,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -11794,7 +11821,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11797 "configure" ++#line 11824 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11900,7 +11927,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11903 "configure" ++#line 11934 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libitm/configure.ac b/libitm/configure.ac +index c5ecd394a43..ebd888fbd42 100644 +--- a/libitm/configure.ac ++++ b/libitm/configure.ac +@@ -79,6 +79,8 @@ target_alias=3D${target_alias-$host_alias} + AM_INIT_AUTOMAKE([1.9.0 foreign no-dist -Wall -Wno-portability -Wno-overr= ide]) + AM_ENABLE_MULTILIB(, ..) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -94,7 +96,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libitm/testsuite/Makefile.in b/libitm/testsuite/Makefile.in +index eb9e992279d..88d2120c156 100644 +--- a/libitm/testsuite/Makefile.in ++++ b/libitm/testsuite/Makefile.in +@@ -66,6 +66,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ + $(top_srcdir)/../config/tls.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/weakref.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ +diff --git a/libobjc/ChangeLog b/libobjc/ChangeLog +index 67485568728..db7fce7df17 100644 +--- a/libobjc/ChangeLog ++++ b/libobjc/ChangeLog +@@ -1,30 +1,102 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. ++ * Makefile.in (aclocal_deps): Add `toolexeclibdir.m4'. ++ * aclocal.m4: Include `toolexeclibdir.m4'. ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * configure: Regenerate. ++ ++2020-01-01 Andrew Pinski ++ ++ PR libobjc/93099 ++ * objc/objc-decls.h (objc_EXPORT): Define it to ++ extern for DLL_EXPORT define case. ++ ++2020-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++2019-11-26 Tobias Burnus ++ ++ * Makefile.in (aclocal_deps): Fix path to cet.m4. ++ ++2019-09-27 Maciej W. Rozycki ++ ++ * configure: Regenerate. ++ ++2019-04-23 Ramana Radhakrishnan ++ Bernd Edlinger ++ Jakub Jelinek ++ ++ PR target/89093 ++ * exception.c (PERSONALITY_FUNCTION): Add general-regs-only target ++ attribute for ARM. ++ ++2019-03-06 Uro=C5=A1 Bizjak ++ ++ * encoding.c (DFmode): #undef before #define. ++ ++2019-01-09 Sandra Loosemore ++ ++ PR other/16615 ++ * objc/runtime.h: Change "can not" to "cannot". ++ ++2019-01-09 Sandra Loosemore ++ ++ PR other/16615 ++ ++ * class.c: Mechanically replace "can not" with "cannot". ++ * objc/runtime.h: Likewise. ++ * sendmsg.c: Likewise. ++ ++2019-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++2018-10-31 Joseph Myers ++ ++ PR bootstrap/82856 ++ * configure.ac: Remove AC_PREREQ. ++ * aclocal.m4, config.h.in, configure: Regenerate. ++ ++2018-04-24 H.J. Lu +=20 +-2018-12-06 Release Manager ++ * configure: Regenerated. +=20 +- * GCC 7.4.0 released. ++2018-04-19 Jakub Jelinek +=20 +-2018-06-22 Jakub Jelinek ++ * configure: Regenerated. +=20 +- Backported from mainline +- 2018-04-18 David Malcolm ++2018-04-18 David Malcolm +=20 + PR jit/85384 + * configure: Regenerate. +=20 +-2018-01-25 Release Manager ++2018-02-14 Igor Tsimbalist ++ ++ PR target/84148 ++ * configure: Regenerate. ++ ++2018-01-03 Jakub Jelinek ++ ++ Update copyright years. ++ ++2017-11-23 Tom de Vries +=20 +- * GCC 7.3.0 released. ++ * class.c (CLASS_TABLE_HASH): Wrap in "do {} while (0)". +=20 +-2017-08-14 Release Manager ++2017-11-17 Igor Tsimbalist +=20 +- * GCC 7.2.0 released. ++ * Makefile.in: Regenerate. ++ * aclocal.m4: Likeiwse. ++ * configure: Likewise. ++ * configure.ac: Set CET_FLAGS. Update XCFLAGS. +=20 +-2017-05-02 Release Manager ++2017-08-30 Richard Sandiford ++ Alan Hayward ++ David Sherwood +=20 +- * GCC 7.1.0 released. ++ * encoding.c (_darwin_rs6000_special_round_type_align): Prefix mode ++ names with E_ in case statements. +=20 + 2017-02-07 Richard Biener +=20 +@@ -35,11 +107,11 @@ +=20 + 2017-01-18 Matthias Klose +=20 +- PR libobjc/78697 ++ PR libobjc/78697 + * configure.ac: Allow default for --with-target-bdw-gc-include. + * configure: Regenerate. +=20 +- PR libobjc/78698 ++ PR libobjc/78698 + * configure.ac: Use the libgc.la file when available. + * configure: Regenerate. +=20 +@@ -282,7 +354,7 @@ + clang which seems to emit calls to it. +=20 + 2011-10-08 Richard Frith-Macdonald +- Nicola Pero ++ Nicola Pero +=20 + PR libobjc/50428 + * sendmsg.c (__objc_send_initialize): If a class does not have an +@@ -307,7 +379,7 @@ + 2011-08-06 Nicola Pero +=20 + * class.c (class_getSuperclass): Fixed typo in comment. +-=09 ++ + 2011-08-06 Nicola Pero +=20 + PR libobjc/49882 +@@ -333,7 +405,7 @@ +=20 + * objc/README: Updated. + * objc-private/selector.h: Updated comments. +-=09 ++ + 2011-06-07 Nicola Pero +=20 + * sendmsg.c (class_get_instance_method): Removed. +@@ -395,7 +467,7 @@ + * objc/deprecated/struct_objc_protocol_list.h: Removed. + * objc/deprecated/struct_objc_category.h: Removed. + * objc/deprecated/MetaClass.h: Removed. +- * objc/deprecated/objc_msg_sendv.h: Removed.=20=20 ++ * objc/deprecated/objc_msg_sendv.h: Removed. + * objc/deprecated/README: Removed. + * objc/deprecated/struct_objc_class.h: Removed. + * objc/deprecated/struct_objc_protocol.h: Removed. +@@ -441,16 +513,16 @@ + (arglist_t, retval_t): New. (class_get_class_method): Take a + 'Class', not 'MetaClass', argument. + * thr.c: Include module-abi-8.h. +-=09 ++ + 2011-06-03 Nicola Pero +=20 + * Makefile.in (OBJC_DEPRECATED_H): Removed struct_objc_static_instances.h + and objc_get_uninstalled_dtable.h. + * objc/deprecated/struct_objc_static_instances.h: Removed. +- * objc/deprecated/objc_get_uninstalled_dtable.h: Removed.=09 ++ * objc/deprecated/objc_get_uninstalled_dtable.h: Removed. + * objc/objc-api.h: Do not include deprecated/objc_static_instances.h + and deprecated/objc_get_uninstalled_dtable.h. +-=09 ++ + 2011-06-03 Nicola Pero +=20 + * Makefile.in (OBJC_DEPRECATED_H): Removed objc_object_alloc.h. +@@ -460,13 +532,13 @@ + _objc_object_copy): Removed. + * libobjc.def (__objc_object_alloc, __objc_object_copy, + __objc_object_dispose): Removed. +-=09 ++ + 2011-06-03 Nicola Pero +=20 + * Makefile.in (OBJC_DEPRECATED_H): Removed METHOD_NULL.h. + * objc/objc-api.h: Do not include deprecated/METHOD_NULL.h. + * objc/deprecated/METHOD_NULL.h: Removed. +-=09 ++ + 2011-06-03 Nicola Pero +=20 + * Makefile.in (OBJC_DEPRECATED_H): Removed objc_valloc.h, +@@ -483,15 +555,15 @@ + (objc_exception_throw): Do not check for + _objc_unexpected_exception. + * memory.c (objc_valloc, _objc_malloc, _objc_atomic_malloc, +- _objc_valloc, _objc_realloc, _objc_calloc, _objc_free): Removed.=09 ++ _objc_valloc, _objc_realloc, _objc_calloc, _objc_free): Removed. + * libobjc.def (_objc_unexpected_exception, objc_valloc): Removed. +-=09 ++ + 2011-06-03 Nicola Pero +=20 + * objc/objc.h: Do not include deprecated/STR.h. + * objc/deprecated/STR.h: Removed. + * Makefile.in (OBJC_DEPRECATED_H): removed STR.h. +-=09 ++ + 2011-06-03 Nicola Pero +=20 + * Makefile.in (OBJC_H): Removed hash.h and sarray.h. +@@ -517,7 +589,7 @@ + * Object.m ([-forward::]): Removed. + * objc/deprecated/Object.h ([-forward::]): Removed. + * sendmsg.c (__objc_forward): Updated comments. +-=09 ++ + 2011-06-03 Nicola Pero +=20 + * Makefile.in (OBJC_H): Removed objc-list.h. +@@ -558,7 +630,7 @@ + objc_write_types, objc_write_unsigned_char, + objc_write_unsigned_int, objc_write_unsigned_long, + objc_write_unsigned_short): Removed. +-=09 ++ + 2011-06-02 Nicola Pero +=20 + * Makefile.in (OBJC_DEPRECATED_H): Removed objc_error.h. +@@ -574,7 +646,7 @@ + * objc/deprecated/Object.h: Removed the same methods. + * sendmsg.c (__objc_forward): Do not try to invoke the "error:" + method after trying to invoke the "doesNotRecognize:" method. +-=09 ++ + 2011-05-26 Nicola Pero +=20 + * sendmsg.c: Reindented part of the file. No non-trivial changes +@@ -606,11 +678,11 @@ + new +initialize dispatch table logic. + (__objc_forward): Call get_implementation instead of get_imp. + (prepared_dtable_table): New. +- (__objc_prepare_dtable_for_class): New.=09 ++ (__objc_prepare_dtable_for_class): New. + (__objc_prepared_dtable_for_class): New. + (__objc_get_prepared_imp): New. + (__objc_install_prepared_dtable_for_class): New. +-=09 ++ + 2011-05-24 Nicola Pero +=20 + PR libobjc/48177 +@@ -627,11 +699,11 @@ + * configure: Regenerate. +=20 + 2011-02-28 Nicola Pero +-=09 ++ + * selector.c (sel_getTypedSelector): Return NULL if there are + multiple selectors with conflicting types. + * objc/runtime.h (sel_getTypedSelector): Updated documentation. +-=09 ++ + 2011-02-28 Richard Frith-Macdonald +=20 + PR libobjc/47922 +@@ -652,7 +724,7 @@ + (objc_tree_insert_class): Tidied up loop; return immediately upon + inserting a class. + (__objc_exec_class): Do not set __objc_class_tree_list. +-=09 ++ + 2010-12-24 Nicola Pero +=20 + * selector.c (sel_getTypedSelector): Return NULL if given a NULL +@@ -660,14 +732,14 @@ + (sel_registerTypedName): Same. + (sel_registerName): Same. + * objc/runtime.h: Updated documentation. +-=09 ++ + 2010-12-24 Nicola Pero +=20 + * objc/runtime.h (class_addIvar): Updated documentation. The + alignment is actually the log_2 of the alignment in bytes. + * ivars.c (class_addIvar): Corresponding change to the + implementation. +-=09 ++ + 2010-12-24 Nicola Pero +=20 + * objc/runtime.h (sel_getType): Renamed to sel_getTypeEncoding to +@@ -677,7 +749,7 @@ + * selector.c (sel_getType): Renamed to sel_getTypeEncoding. + (sel_copyTypedSelectorList, sel_getTypedSelector): New. + (sel_get_type): Updated call to sel_getType. +-=09 ++ + 2010-12-24 Nicola Pero +=20 + * objc/runtime.h (class_conformsToProtocol, +@@ -697,7 +769,7 @@ + (__objc_update_dispatch_table_for_class): Added DEBUG_PRINTFs for + tracking updates of dispatch tables. + (__objc_install_dispatch_table_for_class): Same. +-=09 ++ + 2010-12-23 Rainer Orth +=20 + * Makefile.in (libobjc$(libsuffix).la): Link with -Wc,-shared-libgcc. +@@ -747,14 +819,14 @@ + * objc-private/runtime.h (__objc_add_class_to_hash): Updated + declaration. +=20 +-2010-12-21 Nicola Pero =09 ++2010-12-21 Nicola Pero +=20 + * init.c (_objc_load_callback): Initialize with 0. + (__objc_call_callback): Renamed to __objc_call_load_callback. + Check _objc_load_callback only once, and if it is not set, return + immediately. + (objc_send_load): Updated call to __objc_call_callback. +-=09 ++ + 2010-12-21 Nicola Pero +=20 + PR libobjc/16110 +@@ -766,14 +838,14 @@ + (__objc_create_classes_tree): Add the class of any claimed + category that was loaded in the module to the list of classes for + which we try to execute +load. +-=09 ++ + 2010-12-21 Nicola Pero +=20 + * objc-private/common.h: When DEBUG is defined, include . + Updated comments. + * init.c (__objc_tree_insert_class): Use %p, not %x, when printing + a pointer using DEBUG_PRINTF. +-=09 ++ + 2010-12-21 Nicola Pero +=20 + PR libobjc/45953 +@@ -794,17 +866,17 @@ + __sel_register_typed_name. + * selector.c (__objc_register_selectors_from_module): New. + (__sel_register_typed_name): Made static. +-=09 ++ + 2010-12-21 Nicola Pero +=20 + * linking.m: Do not include objc/NXConstStr.h. +=20 + 2010-12-21 Nicola Pero +-=09 ++ + * objc-private/runtime.h (DEBUG_PRINTF): Moved from here ... + * objc-private/common.h (DEBUG_PRINTF): To here. + * hash.c: Do not include objc-private/runtime.h and objc/thr.h. +-=09 ++ + 2010-12-21 Nicola Pero +=20 + * hash.c: Tidied up comments and indentation. No code changes. +@@ -829,7 +901,7 @@ + (__objc_print_dtable_stats): Removed. + (__sel_register_typed_name): Removed. + * sendmsg.c (__objc_print_dtable_stats): Use 'void' as argument. +-=09 ++ + 2010-12-19 Nicola Pero +=20 + * init.c (__objc_exec_class): Call __objc_resolve_class_links (), +@@ -843,7 +915,7 @@ +=20 + * objc/message.h: Updated comments. + * objc/runtime.h: Updated comments. +-=09 ++ + 2010-12-19 Nicola Pero +=20 + * class.c (objc_lookupClass): Renamed to objc_lookUpClass. +@@ -859,7 +931,7 @@ + * objc/runtime.h (class_ivar_set_gcinvisible): Declare. + * sendmsg.c (_CLS_IN_CONSTRUCTION, CLS_IS_IN_CONSTRUCTION): Do not + define. Updated comments. +-=09 ++ + 2010-12-19 Nicola Pero +=20 + * objc/encoding.h: Updated comments. +@@ -878,13 +950,13 @@ + (objc_layout_structure_next_member): Same. + (objc_layout_finish_structure): Same. + (objc_layout_structure_get_info): Same. +-=09 ++ + 2010-12-19 Nicola Pero +=20 + * init.c: Updated comments. + * objc/objc-api.h: Updated comments. + * objc/runtime.h (_objc_load_callback): Declare. +-=09 ++ + 2010-12-19 Nicola Pero +=20 + * objc/Object.h: Include deprecated/typedstream.h and +@@ -901,7 +973,7 @@ + objc/deprecated/objc_msg_sendv.h instead. Tidied up comments. + * sendmsg.c: Include objc/message.h. + * thr.c: Include objc/message.h. +-=09 ++ + 2010-12-19 Nicola Pero +=20 + * objc/objc-exception.h: Include objc-decls.h. Mark all +@@ -916,14 +988,14 @@ + objc/deprecated/Protocol.h. Include objc/deprecated/Protocol.h. + * objc/deprecated/Protocol.h: New. + * Makefile.in (OBJC_DEPRECATED_H): Added Protocol.h. +-=09 ++ + 2010-12-19 Nicola Pero +=20 + * init.c: Include objc-private/selector.h. Do not declare + __sel_register_typed_name. + * objc-private/selector.h (__sel_register_typed_name): Declare. + * selector.c: Include objc-private/selector.h. +-=09 ++ + 2010-12-18 Nicola Pero +=20 + * class.c: Tidied up comments and indentation. No code changes. +@@ -971,7 +1043,7 @@ + instead of 'Module_t'. Use 'struct objc_symtab *' instead of + 'Symtab_t'. Use objc_getClass() instead of objc_lookup_class(). + Use 'struct objc_category *' instead of 'Category_t'. +-=09 ++ + 2010-12-16 Nicola Pero +=20 + * sendmsg.c: Include objc/runtime.h instead of objc/objc-api.h. +@@ -993,7 +1065,7 @@ +=20 + * objc/message.h (objc_super): When using the modern API, do not + define Super and Super_t, and always use 'super_class' for the +- super class field.=09 ++ super class field. + (objc_msg_lookup_super): Updated prototype to use 'struct + objc_super *' instead of 'Super_t'. + * sendmsg.c (objc_msg_lookup_super): Updated prototype to use +@@ -1010,12 +1082,12 @@ + * ivars.c (class_addIvar): Use the 'size' argument instead of + trying to calculate it using objc_sizeof_type(). + * objc/runtime.h (class_addIvar): Updated comments. +-=09 ++ + 2010-12-15 Nicola Pero +=20 + * sendmsg.c: Reindented some code and tidied up comments. No + actual code changes. +-=09 ++ + 2010-12-14 Nicola Pero +=20 + * objc/Object.h: Moved all the methods, with the exception of +@@ -1039,7 +1111,7 @@ + (__objc_register_instance_methods_to_class): Use struct + objc_method_list * instead of MethodList_t and Method instead of + Method_t. +-=09 ++ + 2010-12-14 Nicola Pero +=20 + * selector.c: Reindented some code and tidied up comments. No +@@ -1059,19 +1131,19 @@ + (get_imp): Call __objc_resolve_class_method or + __objc_resolve_instance_method at the appropriate time. + (objc_msg_lookup): Same. +- (class_getClassMethod): Same.=09 ++ (class_getClassMethod): Same. + (class_getInstanceMethod): Same. + (__objc_init_dispatch_tables): Initialize + selector_resolveClassMethod and selector_resolveInstanceMethod. + * objc/runtime.h: Updated documentation of class_getClassMethod, + class_getInstanceMethod and class_getMethodImplementation. +-=09 ++ + 2010-12-11 Nicola Pero +=20 + * objc-private/module-abi-8.h (struct objc_symtab): Updated + description of sel_ref_cnt and refs. + * objc/deprecated/struct_objc_symtab.h (objc_symtab): Same change. +-=09 ++ + 2010-12-06 Dave Korn +=20 + PR target/40125 +@@ -1081,7 +1153,7 @@ + * aclocal.m4: Regenerate. + * configure: Regenerate. +=20 +-2010-12-03 Matthias Klose =20 ++2010-12-03 Matthias Klose +=20 + * configure.ac (VERSION): Bump the version to 3:0:0. + * configure: Regenerate. +@@ -1091,7 +1163,7 @@ + * sendmsg.c (get_imp): Fixed call to __objc_get_forward_imp to + pass nil as the receiver since we don't know the receiver at this + point. +-=09 ++ + 2010-11-18 Nicola Pero +=20 + * ivars.c: Include stdlib.h. +@@ -1153,7 +1225,7 @@ + * class.c (class_getSuperclass): Call __objc_resolve_class_links + if the class is not resolved yet. + * ivars.c (class_getInstanceVariable): Use class_getSuperclass. +-=09 ++ + 2010-10-16 Nicola Pero +=20 + * objc/runtime.h (class_getIvarLayout): New. +@@ -1163,10 +1235,10 @@ + * ivars.c (class_getIvarLayout): New. + (class_getWeakIvarLayout): New. + (class_setIvarLayout): New. +- (class_setWeakIvarLayout): New.=09 ++ (class_setWeakIvarLayout): New. +=20 + 2010-10-15 Nicola Pero +-=09 ++ + * objc/runtime.h (class_copyPropertyList): New. + (class_getProperty): New. + (property_getAttributes): New. +@@ -1175,7 +1247,7 @@ + (class_getProperty): New. + (property_getAttributes): New. + (property_getName): New. +-=09 ++ + 2010-10-15 Nicola Pero +=20 + * objc-private/runtime.h (__objc_update_classes_with_methods): New. +@@ -1185,7 +1257,7 @@ + (method_setImplementation): New. + * objc/runtime.h (method_setImplementation): New. + (method_exchangeImplementations): New. +-=09 ++ + 2010-10-15 Nicola Pero +=20 + * Protocol.m: Include objc/runtime.h and +@@ -1201,7 +1273,7 @@ + to compare selectors directly instead of getting names and then + using strcmp. + * objc/Protocol.h: Updated comments. +-=09 ++ + 2010-10-15 Nicola Pero +=20 + * init.c (__objc_init_protocol): New function which fixes up a +@@ -1222,7 +1294,7 @@ + * protocols.c (protocol_getMethodDescription): Same change. + * objc/runtime.h: Updated comments. + (sel_registerTypedName): Fixed typo in function name. +-=09 ++ + 2010-10-13 Nicola Pero +=20 + PR libobjc/23214 +@@ -1249,7 +1321,7 @@ + (method_getReturnType): New. + (method_getArgumentType): New. + (method_getDescription): New. +-=09 ++ + 2010-10-12 Nicola Pero +=20 + * encoding.c: Tidied up comments. +@@ -1266,8 +1338,8 @@ + there is no offset: check that the first offset digit is actually + a digit before skipping it. + (objc_skip_type_qualifiers): Mark as inline. +- (objc_skip_typespec): Mark as inline.=09 +-=09 ++ (objc_skip_typespec): Mark as inline. ++ + 2010-10-12 Nicola Pero +=20 + * Makefile.in (C_SOURCE_FILES): Added methods.c. +@@ -1298,7 +1370,7 @@ + (method_getTypeEncoding): New. + (class_copyMethodList): New. + (method_getNumberOfArguments): New. +-=09 ++ + 2010-10-12 Nicola Pero +=20 + * class.c: Include objc/runtime.h and objc-private/module-abi-8.h +@@ -1362,7 +1434,7 @@ + * sarray.c: Include objc/runtime.h instead of objc/objc-api.h. Do + not include objc/objc.h. + * selector.c: Do not include objc/objc.h. +- * sendmsg.c: Do not include objc/objc.h.=09 ++ * sendmsg.c: Do not include objc/objc.h. + * thr.c: Include objc/runtime.h instead of objc/objc-api.h. + Do not include objc/objc.h. + * objc/objc-decls.h: Reindented code. +@@ -1373,7 +1445,7 @@ + (objc_realloc): New. + (objc_free): New. + * objc-private/runtime.h: Updated comments. +-=09 ++ + 2010-10-12 Nicola Pero +=20 + * Makefile.in (C_SOURCE_FILES): Added protocols.c. +@@ -1406,7 +1478,7 @@ + (protocol_copyProtocolList): New. + * class.c (class_getName): New. + * selector.c (sel_isEqual): New. +-=09 ++ + 2010-10-12 Nicola Pero +=20 + * selector.c (sel_getName): Return "" for a NULL +@@ -1418,7 +1490,7 @@ + removed. + (module_hash_table): Same. + * objc/deprecated/hash.h: Same changes. +-=09 ++ + 2010-10-11 Nicola Pero +=20 + * class.c (objc_getClassList): New. +@@ -1442,7 +1514,7 @@ + * objc-private/runtime.h: Use __objc_private_runtime_INCLUDE_GNU + instead of __objc_runtime_INCLUDE_GNU as include guard. + * objc-private/error.h (_objc_abort): Mark as noreturn. +-=09 ++ + 2010-10-11 Nicola Pero +=20 + * Makefile.in (C_SOURCE_FILES): Added ivars.c. +@@ -1456,14 +1528,14 @@ + (object_getInstanceVariable): New. + (object_setInstanceVariable): New. + (object_getIvar): New. +- (object_setIvar): New.=09 ++ (object_setIvar): New. + (ivar_getName): New. + (ivar_getOffset): New. + (ivar_getTypeEncoding): New. + * objc-private/module-abi-8.h (struct objc_class): Added. + * objects.c (object_getClassName): New. + (object_setClass): New. +-=09 ++ + 2010-10-11 Nicola Pero +=20 + * objc/objc.h: Updated comments. +@@ -1508,7 +1580,7 @@ + (sel_register_typed_name): Call sel_registerTypedName. + (sel_getUid): New. + (sel_get_uid): Call sel_getUid. +-=09 ++ + 2010-10-10 Nicola Pero +=20 + * objc/objc-api.h: Define Method, Method_t, Category and +@@ -1532,7 +1604,7 @@ + objc_layout_structure_next_member, objc_layout_finish_structure, + objc_layout_structure_get_info. Prevent including this file at + the same time as objc/objc-api.h. +-=09 ++ + 2010-10-10 Nicola Pero +=20 + * Makefile.in (OBJC_DEPRECATED_H): Added struct_objc_category.h, +@@ -1596,7 +1668,7 @@ + (OBJC_H): Added runtime.h + * objc-foreach.c: New file. + * objc/runtime.h: New file. +-=09 ++ + 2010-09-30 Kai Tietz +=20 + * objc/deprecated/struct_objc_class.h: Add padding +@@ -1605,13 +1677,13 @@ + 2010-09-26 Nicola Pero +=20 + * encoding.c (objc_sizeof_type): Added support for vector type and +- for double long types.=09 ++ for double long types. + (objc_alignof_type): Same change. + (objc_skip_typespec): Same change. + * objc/encoding.h (_C_GCINVISIBLE): Use '|' for _C_GCINVISIBLE + instead of '!' since '!' is already used for _C_VECTOR. + * objc/objc-api.h (_C_LNG_DBL): Added. +-=09 ++ + 2010-09-26 Nicola Pero +=20 + * libobjc_entry.c: File removed. +@@ -1655,14 +1727,14 @@ + objc/sarray.h. + * sendmsg.c: Include . Include objc-private/sarray.h + instead of objc/sarray.h. +- * Makefile.in (OBJC_DEPRECATED_H): Added sarray.h.=09 ++ * Makefile.in (OBJC_DEPRECATED_H): Added sarray.h. +=20 + 2010-09-17 Nicola Pero +=20 + * objc-private/objc-list.h (list_remove_elem): Unused function + removed. (list_nth): Unused function removed. (list_find): + Unused function removed. (list_lenght): Unused function removed. +-=09 ++ + 2010-09-17 Nicola Pero +=20 + * objc/hash.h: Moved into objc/deprecated/hash.h; objc/hash.h +@@ -1700,7 +1772,7 @@ + * acinclude.m4: Include ../config/enable.m4 and ../config/tls.m4. + * configure: Regenerated. + * config.h.in: Regenerated. +-=09 ++ + 2010-09-12 Nicola Pero +=20 + * Makefile.in (%_gc.lo): New pattern rules to build the +@@ -1712,16 +1784,16 @@ + (INCLUDES): Removed the unused include -I$(srcdir)/objc. +=20 + 2010-09-12 Nicola Pero +-=09 ++ + * memory.c (objc_calloc): Fixed call to GC_malloc when building + with Garbage Colletion. +-=09 ++ + 2010-09-12 Nicola Pero +=20 + * memory.c: Do not include objc-private/runtime.h. +=20 + 2010-09-12 Nicola Pero +-=09 ++ + * objc/deprecated/objc_malloc.h: New file. + * objc/deprecated/objc_valloc.h: New file. + * objc/objc-api.h: Include the files instead of defining +@@ -1732,8 +1804,8 @@ + and similar. + (objc_calloc): Use GC_malloc in the garbage-collected + implementation as GC_malloc returns memory that is already freed. +- (objc_valloc): Deprecated.=09 +-=09 ++ (objc_valloc): Deprecated. ++ + 2010-09-12 Nicola Pero +=20 + * objc/deprecated/objc_error.h: New file. +@@ -1760,7 +1832,7 @@ + (misc_gc.lo): Rule removed. + (error_gc.lo): Rule added. + (memory_gc.lo): Rule added. +-=09 ++ + 2010-09-12 Nicola Pero +=20 + * objc/objc.h (__GNU_LIBOBJC__): New #define providing an easy way +@@ -1820,7 +1892,7 @@ + * selector.c: Same change. + * sendmsg.c: Same change. + * thr.c: Same change. +-=09 ++ + 2010-09-11 Nicola Pero +=20 + * objc/deprecated/struct_objc_selector.h: New file. Definition of +@@ -1831,7 +1903,7 @@ + 'struct objc_class' moved here. + * objc/deprecated/MetaClass.h: New file. Definition of MetClass + moved here. +- * objc/deprecated/STR.h: New file. Definition of STR moved here.=09 ++ * objc/deprecated/STR.h: New file. Definition of STR moved here. + * objc/message.h: New file. Definitions for relval_t, apply_t, + arglist, arglist_t and objc_msg_lookup were moved here. + * objc/objc.h: Include the above files instead of defining the +@@ -1848,7 +1920,7 @@ + * objc/objc-exception.h: Updated comments. + * Makefile.in (OBJC_H, OBJC_DEPRECATED_H): Added the new header + files. Reindented list of files. +-=09 ++ + 2010-09-10 Nicola Pero +=20 + * objc/objc-api.h (objc_trace): Unused variable removed. +@@ -1862,7 +1934,7 @@ + objc/typedstream.h replaced with a placeholder including the file + from the deprecated/ directory. + * objc/deprecated/objc-unexpected-exception.h: New file with the +- definition of _objc_unexpected_exception.=09 ++ definition of _objc_unexpected_exception. + * objc/objc-api.h: Include deprecated/objc-unexcepted-exception.h + instead of defining _objc_unexpected_exception. + * objc/deprecated/Object.h: New file with the deprecated Object +@@ -1879,7 +1951,7 @@ + 2010-09-10 Nicola Pero +=20 + * objc/objc-exception.h: Fixed include of objc.h. +-=09 ++ + 2010-09-08 Nicola Pero +=20 + * objc/objc-exception.h: New file. +@@ -1944,7 +2016,7 @@ + 2010-09-06 Nicola Pero +=20 + * makefile.dos: Obsolete file removed. +-=09 ++ + 2010-04-02 Ralf Wildenhues +=20 + * aclocal.m4: Regenerate. +@@ -2064,7 +2136,7 @@ + copyright dates. + * libobjc.def (_objc_unexpected_exception): Export hook. + Update copyright dates. +-=09 ++ + 2009-03-01 Ralf Wildenhues +=20 + * configure: Regenerate. +@@ -2086,18 +2158,18 @@ + for noreturn. +=20 + 2008-09-26 Peter O'Gorman +- Steve Ellcey ++ Steve Ellcey +=20 + * configure: Regenerate for new libtool. + * config.h.in: Regenerate for new libtool. +=20 +-2008-07-18 Matthias Klose =20 ++2008-07-18 Matthias Klose +=20 +- * Makefile.in: Ignore missing ../boehm-gc/threads.mk.=20 ++ * Makefile.in: Ignore missing ../boehm-gc/threads.mk. +=20 +-2008-07-18 Matthias Klose =20 ++2008-07-18 Matthias Klose +=20 +- * Makefile.in: Include ../boehm-gc/threads.mk.=20 ++ * Makefile.in: Include ../boehm-gc/threads.mk. + (OBJC_BOEHM_GC_LIBS): Define, (libobjc_gc$(libsuffix).la): Use it. +=20 + 2008-07-06 Ralf Wildenhues +@@ -2225,7 +2297,7 @@ +=20 + * objc/objc-list.h (list_free): Add keyword 'inline' to avoid + unused warning. +-=09 ++ + 2006-10-31 Geoffrey Keating +=20 + * encoding.c (darwin_rs6000_special_round_type_align): New. +@@ -2284,7 +2356,7 @@ + PR libobjc/14382 + * README (+load,+initialize): Fix documentation to reflect + intended and implemented semantics for +load and +initialize. +-=09 ++ + 2005-12-12 Andrew Pinski +=20 + * encoding.c (TYPE_FIELDS): Fix to skip over just _C_STRUCT_B and +@@ -2334,7 +2406,7 @@ + global scope. +=20 + 2005-09-04 Andrew Pinski +- Rasmus Hahn ++ Rasmus Hahn +=20 + PR libobjc/23108 + * archive.c (objc_write_type): Correct the element offset. +@@ -2345,7 +2417,7 @@ + * All files: Update FSF address. +=20 + 2005-08-13 Marcin Koziej +- Andrew Pinski ++ Andrew Pinski +=20 + PR libobjc/22492 + * exception.c (PERSONALITY_FUNCTION): Fix the PC with finally. +@@ -2369,7 +2441,7 @@ +=20 + * objc/NXConstStr.h, objc/Object.h, objc/Protocol.h, + objc/encoding.h, objc/hash.h, objc/objc-api.h, +- objc/runtime.h, objc/sarray.h, objc/thr.h,=20 ++ objc/runtime.h, objc/sarray.h, objc/thr.h, + objc/typedstream.h: Do not include Objective-C headers as + system headers. +=20 +@@ -3495,7 +3567,7 @@ Mon Sep 21 23:27:10 1998 Ovidiu Predescu +=20 + * New directory. Moved files from ../gcc/objc. + +-Copyright (C) 1998-2017 Free Software Foundation, Inc. ++Copyright (C) 1998-2020 Free Software Foundation, Inc. +=20 + Copying and distribution of this file, with or without modification, + are permitted in any medium without royalty provided the copyright +diff --git a/libobjc/Makefile.in b/libobjc/Makefile.in +index febc92d4b3c..1a12ebec592 100644 +--- a/libobjc/Makefile.in ++++ b/libobjc/Makefile.in +@@ -291,6 +291,7 @@ aclocal_deps =3D \ + $(srcdir)/../config/multi.m4 \ + $(srcdir)/../config/override.m4 \ + $(srcdir)/../config/proginstall.m4 \ ++ $(srcdir)/../config/toolexeclibdir.m4 \ + $(srcdir)/../ltoptions.m4 \ + $(srcdir)/../ltsugar.m4 \ + $(srcdir)/../ltversion.m4 \ +diff --git a/libobjc/aclocal.m4 b/libobjc/aclocal.m4 +index 174f9b7d0d8..58e4dfce6b6 100644 +--- a/libobjc/aclocal.m4 ++++ b/libobjc/aclocal.m4 +@@ -204,4 +204,5 @@ m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) + m4_include([../lt~obsolete.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([acinclude.m4]) +diff --git a/libobjc/configure b/libobjc/configure +index 84862a82864..b766980e0a5 100755 +--- a/libobjc/configure ++++ b/libobjc/configure +@@ -714,6 +714,7 @@ with_target_subdir + with_cross_host + enable_version_specific_runtime_libs + enable_multilib ++with_toolexeclibdir + enable_maintainer_mode + enable_shared + enable_static +@@ -1368,6 +1369,9 @@ Optional Packages: + --with-target-subdir=3DSUBDIR + configuring in a subdirectory + --with-cross-host=3DHOST configuring with a cross compiler ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -2461,6 +2465,22 @@ case $srcdir in + esac +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -2476,7 +2496,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_noncanonical)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_noncanonical)' + toolexeclibdir=3D'$(libdir)' +@@ -10594,7 +10621,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10597 "configure" ++#line 10628 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -10700,7 +10727,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10703 "configure" ++#line 10738 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libobjc/configure.ac b/libobjc/configure.ac +index c6d48f787ae..79c31562e97 100644 +--- a/libobjc/configure.ac ++++ b/libobjc/configure.ac +@@ -77,6 +77,8 @@ case $srcdir in + esac + AC_SUBST(glibcpp_srcdir) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -92,7 +94,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_noncanonical)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_noncanonical)' + toolexeclibdir=3D'$(libdir)' +diff --git a/liboffloadmic/ChangeLog b/liboffloadmic/ChangeLog +index afe01993539..2c3cfffef2d 100644 +--- a/liboffloadmic/ChangeLog ++++ b/liboffloadmic/ChangeLog +@@ -1,31 +1,64 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. ++ * plugin/configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * plugin/Makefile.in: Regenerate. ++ * plugin/aclocal.m4: Regenerate. ++ * plugin/configure: Regenerate. ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * Makefile.in: Regenerate. ++ * aclocal.m4: Regenerate. ++ * configure: Regenerate. +=20 +-2018-12-06 Release Manager ++2020-01-10 Thomas Schwinge +=20 +- * GCC 7.4.0 released. ++ * plugin/libgomp-plugin-intelmic.cpp (GOMP_OFFLOAD_get_property): ++ Remove. +=20 +-2018-06-22 Jakub Jelinek ++2019-12-22 Maciej W. Rozycki ++ Frederik Harwath ++ Thomas Schwinge +=20 +- Backported from mainline +- 2018-04-18 David Malcolm ++ liboffloadmic/ ++ * plugin/libgomp-plugin-intelmic.cpp (GOMP_OFFLOAD_get_property): ++ New function. ++ ++2019-10-01 Maciej W. Rozycki ++ ++ * plugin/configure: Regenerate. ++ ++2019-09-27 Maciej W. Rozycki +=20 +- PR jit/85384 + * configure: Regenerate. +- * plugin/confugure: Regenerate. +=20 +-2018-01-25 Release Manager ++2019-01-09 Sandra Loosemore +=20 +- * GCC 7.3.0 released. ++ PR other/16615 +=20 +-2017-08-14 Release Manager ++ * include/coi/common/COIResult_common.h: Mechanically replace ++ "can not" with "cannot". ++ * include/coi/source/COIBuffer_source.h: Likewise. ++ ++2018-12-14 Thomas Schwinge ++ ++ * runtime/offload.h (omp_target_is_present, omp_target_memcpy) ++ (omp_target_memcpy_rect, omp_target_associate_ptr) ++ (omp_target_disassociate_ptr): Adjust to libgomp changes. +=20 +- * GCC 7.2.0 released. ++2018-10-31 Joseph Myers +=20 +-2017-05-02 Release Manager ++ PR bootstrap/82856 ++ * Makefile.am: Include multilib.am. ++ * configure.ac: Remove AC_PREREQ. ++ * plugin/Makefile.am: Include multilib.am. ++ * plugin/configure.ac: Remove AC_PREREQ. ++ * Makefile.in, aclocal.m4, configure, plugin/Makefile.in, ++ plugin/aclocal.m4, plugin/configure: Regenerate. +=20 +- * GCC 7.1.0 released. ++2018-04-18 David Malcolm ++ ++ PR jit/85384 ++ * configure: Regenerate. ++ * plugin/configure: Regenerate. +=20 + 2017-01-31 Thomas Schwinge +=20 +@@ -666,7 +699,7 @@ + * runtime/orsl-lite/version.txt: Ditto. + * runtime/use_mpss2.txt: Ditto. + +-Copyright (C) 2014-2017 Free Software Foundation, Inc. ++Copyright (C) 2014-2018 Free Software Foundation, Inc. +=20 + Copying and distribution of this file, with or without modification, + are permitted in any medium without royalty provided the copyright +diff --git a/liboffloadmic/Makefile.in b/liboffloadmic/Makefile.in +index f4470c6e4d4..d42745a49e0 100644 +--- a/liboffloadmic/Makefile.in ++++ b/liboffloadmic/Makefile.in +@@ -94,6 +94,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/configure.ac +diff --git a/liboffloadmic/aclocal.m4 b/liboffloadmic/aclocal.m4 +index 4bb1d43a5e5..c62ed26f6b1 100644 +--- a/liboffloadmic/aclocal.m4 ++++ b/liboffloadmic/aclocal.m4 +@@ -993,6 +993,7 @@ m4_include([../config/depstand.m4]) + m4_include([../config/lead-dot.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/liboffloadmic/configure b/liboffloadmic/configure +index f873716991b..6dfe9e37642 100644 +--- a/liboffloadmic/configure ++++ b/liboffloadmic/configure +@@ -739,6 +739,7 @@ enable_maintainer_mode + enable_dependency_tracking + enable_multilib + enable_version_specific_runtime_libs ++with_toolexeclibdir + enable_shared + enable_static + with_pic +@@ -1397,6 +1398,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -5003,6 +5007,22 @@ else + fi +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir. + # Also toolexecdir, though it's only used in toolexeclibdir. + case ${enable_version_specific_runtime_libs} in +@@ -5018,7 +5038,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -11108,7 +11135,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11111 "configure" ++#line 11138 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11214,7 +11241,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11217 "configure" ++#line 11248 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/liboffloadmic/configure.ac b/liboffloadmic/configure.ac +index 64728f1a1a7..14efcdd3290 100644 +--- a/liboffloadmic/configure.ac ++++ b/liboffloadmic/configure.ac +@@ -80,6 +80,8 @@ case "$enable_liboffloadmic" in + esac + AM_CONDITIONAL(LIBOFFLOADMIC_HOST, [test x"$enable_liboffloadmic" =3D xho= st]) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir. + # Also toolexecdir, though it's only used in toolexeclibdir. + case ${enable_version_specific_runtime_libs} in +@@ -95,7 +97,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/liboffloadmic/plugin/Makefile.in b/liboffloadmic/plugin/Makef= ile.in +index 2a7c8d2ec6c..6e180f6a23c 100644 +--- a/liboffloadmic/plugin/Makefile.in ++++ b/liboffloadmic/plugin/Makefile.in +@@ -90,6 +90,7 @@ DIST_COMMON =3D $(srcdir)/Makefile.in $(srcdir)/Makefile= .am \ + ACLOCAL_M4 =3D $(top_srcdir)/aclocal.m4 + am__aclocal_m4_deps =3D $(top_srcdir)/../../config/acx.m4 \ + $(top_srcdir)/../../config/depstand.m4 \ ++ $(top_srcdir)/../../config/toolexeclibdir.m4 \ + $(top_srcdir)/../../config/lead-dot.m4 \ + $(top_srcdir)/../../config/multi.m4 \ + $(top_srcdir)/../../config/override.m4 \ +diff --git a/liboffloadmic/plugin/aclocal.m4 b/liboffloadmic/plugin/acloca= l.m4 +index a4179ef40ac..6d90e5d6e16 100644 +--- a/liboffloadmic/plugin/aclocal.m4 ++++ b/liboffloadmic/plugin/aclocal.m4 +@@ -990,6 +990,7 @@ AC_SUBST([am__untar]) +=20 + m4_include([../../config/acx.m4]) + m4_include([../../config/depstand.m4]) ++m4_include([../../config/toolexeclibdir.m4]) + m4_include([../../config/lead-dot.m4]) + m4_include([../../config/multi.m4]) + m4_include([../../config/override.m4]) +diff --git a/liboffloadmic/plugin/configure b/liboffloadmic/plugin/configu= re +index c031eb3e7fa..570758344b4 100644 +--- a/liboffloadmic/plugin/configure ++++ b/liboffloadmic/plugin/configure +@@ -735,6 +735,7 @@ enable_maintainer_mode + enable_dependency_tracking + enable_multilib + enable_version_specific_runtime_libs ++with_toolexeclibdir + enable_shared + enable_static + with_pic +@@ -1394,6 +1395,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -4311,6 +4315,22 @@ fi + $as_echo "$enable_version_specific_runtime_libs" >&6; } +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir. + # Also toolexecdir, though it's only used in toolexeclibdir. + case ${enable_version_specific_runtime_libs} in +@@ -4326,7 +4346,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -10815,7 +10842,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10818 "configure" ++#line 10845 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -10921,7 +10948,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10924 "configure" ++#line 10955 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/liboffloadmic/plugin/configure.ac b/liboffloadmic/plugin/conf= igure.ac +index 9c48cafd38b..fdac290c5f1 100644 +--- a/liboffloadmic/plugin/configure.ac ++++ b/liboffloadmic/plugin/configure.ac +@@ -96,6 +96,8 @@ AC_ARG_ENABLE([version-specific-runtime-libs], + AC_MSG_RESULT($enable_version_specific_runtime_libs) +=20 +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir. + # Also toolexecdir, though it's only used in toolexeclibdir. + case ${enable_version_specific_runtime_libs} in +@@ -111,7 +113,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libquadmath/ChangeLog b/libquadmath/ChangeLog +index aac13bda194..0b1db14d8d6 100644 +--- a/libquadmath/ChangeLog ++++ b/libquadmath/ChangeLog +@@ -1,35 +1,223 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * Makefile.in: Regenerate. ++ * aclocal.m4: Regenerate. ++ * configure: Regenerate. ++ ++2020-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++ * libquadmath.texi: Bump @copying's copyright year. ++ ++2019-09-27 Maciej W. Rozycki ++ ++ * configure: Regenerate. ++ ++2019-08-02 Jakub Jelinek ++ ++ * quadmath.h (M_Eq, M_LOG2Eq, M_LOG10Eq, M_LN2q, M_LN10q, M_PIq, ++ M_PI_2q, M_PI_4q, M_1_PIq, M_2_PIq, M_2_SQRTPIq, M_SQRT2q, ++ M_SQRT1_2q): Use two more decimal places. ++ ++2019-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++ * libquadmath.texi: Bump @copying's copyright year. +=20 +-2018-12-06 Release Manager ++2018-12-11 Jakub Jelinek +=20 +- * GCC 7.4.0 released. ++ PR c/88430 ++ * quadmath_weak.h (__qmath2): Add __quadmath_throw. +=20 +-2018-06-22 Jakub Jelinek ++2018-11-07 Joseph Myers +=20 +- Backported from mainline +- 2018-04-18 David Malcolm ++ * quadmath-imp.h (ieee854_float128): Use mantissa0, mantissa1, ++ mantissa2 and mantissa3 fields instead of mant_high and mant_low. ++ Change nan field to ieee_nan. ++ * update-quadmath.py (update_sources): Also update fmaq.c. ++ * math/nanq.c (nanq): Use ieee_nan field of union. ++ Zero-initialize f. Set quiet_nan field. ++ * printf/flt1282mpn.c, printf/printf_fphex.c, strtod/mpn2flt128.c, ++ strtod/strtoflt128.c: Use mantissa0, mantissa1, mantissa2 and ++ mantissa3 fields. Use ieee_nan and quiet_nan field. ++ * math/fmaq.c: Regenerate from glibc sources with ++ update-quadmath.py. ++ ++2018-11-05 Joseph Myers ++ ++ PR libquadmath/68686 ++ * Makefile.am: (libquadmath_la_SOURCES): Remove math/isinf_nsq.c. ++ Add math/exp2q.c math/issignalingq.c math/lgammaq_neg.c ++ math/lgammaq_product.c math/tanq_kernel.c math/tgammaq_product.c ++ math/casinhq_kernel.c. ++ * Makefile.in: Regenerate. ++ * libquadmath.texi (exp2q, issignalingq): Document. ++ * quadmath-imp.h: Include , , and ++ . ++ (HIGH_ORDER_BIT_IS_SET_FOR_SNAN, FIX_FLT128_LONG_CONVERT_OVERFLOW) ++ (FIX_FLT128_LLONG_CONVERT_OVERFLOW, __quadmath_kernel_tanq) ++ (__quadmath_gamma_productq, __quadmath_gammaq_r) ++ (__quadmath_lgamma_negq, __quadmath_lgamma_productq) ++ (__quadmath_lgammaq_r, __quadmath_kernel_casinhq, mul_splitq) ++ (math_check_force_underflow_complex, __glibc_likely) ++ (__glibc_unlikely, struct rm_ctx, SET_RESTORE_ROUNDF128) ++ (libc_feholdsetround_ctx, libc_feresetround_ctx): New. ++ (feraiseexcept, fenv_t, feholdexcept, fesetround, feupdateenv) ++ (fesetenv, fetestexcept, feclearexcept): Define if not supported ++ through . ++ (__quadmath_isinf_nsq): Remove. ++ * quadmath.h (exp2q, issignalingq): New. ++ * quadmath.map (QUADMATH_1.2): New. ++ * quadmath_weak.h (exp2q, issignalingq): New. ++ * update-quadmath.py: New file. ++ * math/isinf_nsq.c: Remove file. ++ * math/casinhq_kernel.c, math/exp2q.c, math/expq_table.h, ++ math/issignalingq.c, math/lgammaq_neg.c, math/lgammaq_product.c, ++ math/tanq_kernel.c, math/tgammaq_product.c: New files. Generated ++ from glibc sources with update-quadmath.py. ++ * math/acoshq.c, math/acosq.c, math/asinhq.c, math/asinq.c, ++ math/atan2q.c, math/atanhq.c, math/atanq.c, math/cacoshq.c, ++ math/cacosq.c, math/casinhq.c, math/casinq.c, math/catanhq.c, ++ math/catanq.c, math/cbrtq.c, math/ccoshq.c, math/ceilq.c, ++ math/cexpq.c, math/cimagq.c, math/clog10q.c, math/clogq.c, ++ math/conjq.c, math/copysignq.c, math/coshq.c, math/cosq.c, ++ math/cosq_kernel.c, math/cprojq.c, math/crealq.c, math/csinhq.c, ++ math/csinq.c, math/csqrtq.c, math/ctanhq.c, math/ctanq.c, ++ math/erfq.c, math/expm1q.c, math/expq.c, math/fabsq.c, ++ math/fdimq.c, math/finiteq.c, math/floorq.c, math/fmaxq.c, ++ math/fminq.c, math/fmodq.c, math/frexpq.c, math/hypotq.c, ++ math/ilogbq.c, math/isinfq.c, math/isnanq.c, math/j0q.c, ++ math/j1q.c, math/jnq.c, math/ldexpq.c, math/lgammaq.c, ++ math/llrintq.c, math/llroundq.c, math/log10q.c, math/log1pq.c, ++ math/log2q.c, math/logbq.c, math/logq.c, math/lrintq.c, ++ math/lroundq.c, math/modfq.c, math/nearbyintq.c, ++ math/nextafterq.c, math/powq.c, math/remainderq.c, math/remquoq.c, ++ math/rintq.c, math/roundq.c, math/scalblnq.c, math/scalbnq.c, ++ math/signbitq.c, math/sincos_table.c, math/sincosq.c, ++ math/sincosq_kernel.c, math/sinhq.c, math/sinq.c, ++ math/sinq_kernel.c, math/tanhq.c, math/tanq.c, math/tgammaq.c, ++ math/truncq.c, math/x2y2m1q.c: Regenerate from glibc sources with ++ update-quadmath.py. ++ ++2018-10-31 Joseph Myers ++ ++ PR bootstrap/82856 ++ * Makefile.am: Include multilib.am. ++ (AUTOMAKE_OPTIONS): Remove 1.8. Add info-in-builddir. ++ (all-local): Define outside conditional code. ++ (CLEANFILES): Remove libquadmath.info. ++ * configure.ac: Remove AC_PREREQ. ++ * Makefile.in, aclocal.m4, config.h.in, configure: Regenerate. ++ ++2018-04-24 H.J. Lu ++ ++ * configure: Regenerated. ++ ++2018-04-19 Jakub Jelinek ++ ++ * configure: Regenerated. ++ ++2018-04-18 David Malcolm +=20 + PR jit/85384 + * configure: Regenerate. +=20 +-2018-01-25 Release Manager ++2018-02-14 Igor Tsimbalist +=20 +- * GCC 7.3.0 released. ++ PR target/84148 ++ * configure: Regenerate. +=20 +-2017-08-14 Release Manager ++2018-01-03 Jakub Jelinek +=20 +- * GCC 7.2.0 released. ++ * libquadmath.texi: Bump @copying's copyright year. +=20 +-2017-07-20 Jakub Jelinek ++2017-11-17 Igor Tsimbalist +=20 +- PR libquadmath/65757 +- * math/roundq.c: Cherry-pick upstream glibc 2015-04-28 change. ++ * Makefile.am: Update AM_CFLAGS. ++ * Makefile.in: Regenerate: ++ * acinclude.m4: Add enable.m4 and cet.m4. ++ * configure: Regenerate. ++ * configure.ac: Set CET_FLAGS. Update XCFLAGS. ++ ++2017-11-05 Tom de Vries ++ ++ PR other/82784 ++ * printf/gmp-impl.h (MPN_MUL_N_RECURSE): Remove semicolon after ++ "do {} while (0)". +=20 +-2017-05-02 Release Manager ++2017-09-01 Michael Meissner ++ ++ PR libquadmath/81848 ++ * configure.ac (powerpc*-linux*): Use attribute mode KC to create ++ complex __float128 on PowerPC instead of attribute mode TC. ++ * quadmath.h (__complex128): Likewise. ++ * configure: Regenerate. ++ * math/cbrtq.c (CBRT2): Use __float128 not long double. ++ (CBRT4): Likewise. ++ (CBRT2I): Likewise. ++ (CBRT4I): Likewise. ++ * math/j0q.c (U0): Likewise. ++ * math/sqrtq.c (sqrtq): Don't depend on implicit conversion ++ between __float128, instead explicitly convert the __float128 ++ value to long double because the PowerPC does not allow __float128 ++ and long double in the same expression. +=20 +- * GCC 7.1.0 released. ++2017-07-19 Gerald Pfeifer ++ ++ * math/powq.c (powq): Use uint32_t instead of u_int32_t. ++ ++2017-07-19 Jakub Jelinek ++ ++ PR libquadmath/65757 ++ * quadmath-imp.h (math_opt_barrier, math_force_eval, ++ math_narrow_eval, math_check_force_underflow, ++ math_check_force_underflow_nonneg): Define. ++ * math/ceilq.c: Backport changes from upstream glibc ++ between 2012-11-01 and 2017-07-13. ++ * math/remquoq.c: Likewise. ++ * math/expq.c: Likewise. ++ * math/llroundq.c: Likewise. ++ * math/logq.c: Likewise. ++ * math/atanq.c: Likewise. ++ * math/nearbyintq.c: Likewise. ++ * math/scalblnq.c: Likewise. ++ * math/finiteq.c: Likewise. ++ * math/atanhq.c: Likewise. ++ * math/expm1q.c: Likewise. ++ * math/sinhq.c: Likewise. ++ * math/log10q.c: Likewise. ++ * math/rintq.c: Likewise. ++ * math/roundq.c: Likewise. ++ * math/fmaq.c: Likewise. ++ * math/erfq.c: Likewise. ++ * math/log2q.c: Likewise. ++ * math/lroundq.c: Likewise. ++ * math/j1q.c: Likewise. ++ * math/scalbnq.c: Likewise. ++ * math/truncq.c: Likewise. ++ * math/frexpq.c: Likewise. ++ * math/sincosq.c: Likewise. ++ * math/tanhq.c: Likewise. ++ * math/asinq.c: Likewise. ++ * math/coshq.c: Likewise. ++ * math/j0q.c: Likewise. ++ * math/asinhq.c: Likewise. ++ * math/floorq.c: Likewise. ++ * math/sinq_kernel.c: Likewise. ++ * math/powq.c: Likewise. ++ * math/hypotq.c: Likewise. ++ * math/sincos_table.c: Likewise. ++ * math/rem_pio2q.c: Likewise. ++ * math/nextafterq.c: Likewise. ++ * math/log1pq.c: Likewise. ++ * math/sincosq_kernel.c: Likewise. ++ * math/tanq.c: Likewise. ++ * math/acosq.c: Likewise. ++ * math/lrintq.c: Likewise. ++ * math/llrintq.c: Likewise. +=20 + 2017-02-09 Gerald Pfeifer +=20 +@@ -796,7 +984,7 @@ + PR fortran/32049 + Initial implementation and checkin. + +-Copyright (C) 2010-2017 Free Software Foundation, Inc. ++Copyright (C) 2010-2018 Free Software Foundation, Inc. +=20 + Copying and distribution of this file, with or without modification, + are permitted in any medium without royalty provided the copyright +diff --git a/libquadmath/Makefile.in b/libquadmath/Makefile.in +index 428e0158aca..e5c7aba84b7 100644 +--- a/libquadmath/Makefile.in ++++ b/libquadmath/Makefile.in +@@ -67,6 +67,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libquadmath/aclocal.m4 b/libquadmath/aclocal.m4 +index b9ebb8a9ed4..59009468a47 100644 +--- a/libquadmath/aclocal.m4 ++++ b/libquadmath/aclocal.m4 +@@ -1030,6 +1030,7 @@ m4_include([../config/lthostflags.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/no-executables.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libquadmath/configure b/libquadmath/configure +index 76a2c20b7e1..e887071aeb2 100755 +--- a/libquadmath/configure ++++ b/libquadmath/configure +@@ -749,6 +749,7 @@ enable_fast_install + with_gnu_ld + enable_libtool_lock + enable_maintainer_mode ++with_toolexeclibdir + enable_symvers + enable_generated_files_in_srcdir + with_gcc_major_version_only +@@ -1408,6 +1409,9 @@ Optional Packages: + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-gcc-major-version-only + use only GCC major number in filesystem paths +=20 +@@ -10572,7 +10576,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10575 "configure" ++#line 10579 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -10678,7 +10682,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10681 "configure" ++#line 10689 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11917,6 +11921,22 @@ ac_link=3D'$CC -o conftest$ac_exeext $CFLAGS $CPP= FLAGS $LDFLAGS conftest.$ac_ext $ + ac_compiler_gnu=3D$ac_cv_c_compiler_gnu +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -11932,7 +11952,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libquadmath/configure.ac b/libquadmath/configure.ac +index 41fbe1259ee..e27aa8d0389 100644 +--- a/libquadmath/configure.ac ++++ b/libquadmath/configure.ac +@@ -83,6 +83,8 @@ if test "x$GCC" !=3D "xyes"; then + fi + AC_PROG_CPP +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -98,7 +100,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libsanitizer/ChangeLog b/libsanitizer/ChangeLog +index 019919d2908..16b45a48b6f 100644 +--- a/libsanitizer/ChangeLog ++++ b/libsanitizer/ChangeLog +@@ -1,41 +1,428 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * Makefile.in: Regenerate. ++ * aclocal.m4: Regenerate. ++ * configure: Regenerate. ++ * asan/Makefile.in: Regenerate. ++ * interception/Makefile.in: Regenerate. ++ * libbacktrace/Makefile.in: Regenerate. ++ * lsan/Makefile.in: Regenerate. ++ * sanitizer_common/Makefile.in: Regenerate. ++ * tsan/Makefile.in: Regenerate. ++ * ubsan/Makefile.in: Regenerate. +=20 +-2018-12-06 Release Manager ++2019-11-26 Jakub Jelinek +=20 +- * GCC 7.4.0 released. ++ PR sanitizer/92154 ++ * sanitizer_common/sanitizer_platform_limits_posix.h: Cherry-pick ++ llvm-project revision 947f9692440836dcb8d88b74b69dd379d85974ce. ++ * sanitizer_common/sanitizer_platform_limits_posix.cpp: Likewise. +=20 +-2018-08-16 Martin Liska ++2019-11-20 Martin Liska +=20 +- Backport from mainline +- 2018-08-02 Martin Liska ++ * libtool-version: Remove. ++ * lsan/libtool-version: Upate comment to not mention libmudflap. ++ * tsan/libtool-version: Likewise. ++ * ubsan/libtool-version: Likewise. +=20 +- PR sanitizer/86022 +- * sanitizer_common/sanitizer_linux_libcdep.cc (ThreadDescriptorSize): +- Cherry-pick compiler-rt revision 338606. ++2019-11-13 Andreas Schwab +=20 +-2018-06-22 Jakub Jelinek ++ * configure.tgt (riscv64-*-linux*): Enable build. +=20 +- Backported from mainline +- 2018-04-18 David Malcolm ++2019-11-07 Martin Liska ++ ++ * all source files: Reapply all revisions mentioned in LOCAL_PATCHES. ++ ++2019-11-07 Martin Liska ++ ++ * merge.sh: Update to use llvm-project git repository. ++ * all source files: Merge from upstream ++ 82588e05cc32bb30807e480abd4e689b0dee132a. ++ ++2019-11-05 Martin Liska ++ ++ * ubsan/ubsan_flags.cpp (InitializeFlags): Trunk decided to print ++ summary for all sanitizers, but we want to have UBSAN without it. ++ ++2019-11-05 Martin Liska ++ ++ * asan/asan_globals.cpp (CheckODRViolationViaIndicator): Reapply from ++ LOCAL_PATCHES. ++ (CheckODRViolationViaPoisoning): Likewise. ++ (RegisterGlobal): Likewise. ++ * asan/asan_interceptors.h (ASAN_INTERCEPT___CXA_RETHROW_PRIMARY_EXCEPTI= ON): Likewise. ++ (defined): Likewise. ++ * asan/asan_mapping.h: Likewise. ++ * sanitizer_common/sanitizer_linux_libcdep.cpp (defined): Likewise. ++ * sanitizer_common/sanitizer_mac.cpp (defined): Likewise. ++ * sanitizer_common/sanitizer_platform_limits_linux.cpp (defined): Likewi= se. ++ * sanitizer_common/sanitizer_platform_limits_posix.h: Likewise. ++ * sanitizer_common/sanitizer_stacktrace.cpp (GetCanonicFrame): Likewise. ++ * tsan/tsan_rtl_ppc64.S: Likewise. ++ * ubsan/ubsan_handlers.cpp (__ubsan::__ubsan_handle_cfi_bad_icall): Like= wise. ++ (__ubsan::__ubsan_handle_cfi_bad_icall_abort): Likewise. ++ * ubsan/ubsan_handlers.h (struct CFIBadIcallData): Likewise. ++ (struct CFICheckFailData): Likewise. ++ (RECOVERABLE): Likewise. ++ * ubsan/ubsan_platform.h: Likewise. ++ ++2019-11-05 Martin Liska ++ ++ * tsan/Makefile.am: Rename tsan_interceptors.cpp to ++ tsan_interceptors_posix. ++ * tsan/Makefile.in: Regenerate. ++ ++2019-11-05 Martin Liska ++ ++ * all source files: Merge from upstream r375507. ++ ++2019-10-22 Tamar Christina ++ ++ PR sanitizer/92154 ++ * sanitizer_common/sanitizer_platform_limits_posix.cpp: ++ Cherry-pick compiler-rt revision r375220. ++ ++2019-09-27 Maciej W. Rozycki +=20 +- PR jit/85384 + * configure: Regenerate. +=20 +-2018-06-07 Richard Biener ++2019-09-10 Christophe Lyon ++ Micka=C3=ABl Gu=C3=AAn=C3=A9 +=20 +- Backport from mainline +- 2018-03-19 Jakub Jelinek ++ * configure.tgt (arm*-*-*fdpiceabi): Sanitizers are ++ unsupported in this configuration. +=20 +- PR sanitizer/84761 +- * sanitizer_common/sanitizer_linux_libcdep.cc (__GLIBC_PREREQ): +- Define if not defined. +- (DL_INTERNAL_FUNCTION): Don't define. +- (InitTlsSize): For __i386__ if not compiled against glibc 2.27+ +- determine at runtime whether to use regparm(3), stdcall calling +- convention for older glibcs or normal calling convention for +- newer glibcs for call to _dl_get_tls_static_info. ++2019-08-16 Iain Sandoe ++ ++ * LOCAL_PATCHES: Add r274585. ++ ++2019-08-16 Iain Sandoe ++ ++ * asan/asan_interceptors.h: Reapply r272406. ++ ++2019-08-15 Martin Liska ++ ++ * LOCAL_PATCHES: Add r274540 ++ ++2019-08-15 Martin Liska ++ ++ * tsan/tsan_rtl_ppc64.S: Reapply. ++ ++2019-08-15 Iain Sandoe ++ ++ PR bootstrap/91455 ++ * Makefile.in: Regenerated. ++ * aclocal.m4: Likewise. ++ * asan/Makefile.in: Likewise. ++ * configure: Likewise. ++ * interception/Makefile.in: Likewise. ++ * libbacktrace/Makefile.in: Likewise. ++ * lsan/Makefile.in: Likewise. ++ * sanitizer_common/Makefile.am: Include top_srcdir unconditionally. ++ * sanitizer_common/Makefile.in: Regenerated. ++ * tsan/Makefile.in: Likewise. ++ * ubsan/Makefile.in: Likewise. ++ ++2019-08-14 Martin Liska ++ ++ * LOCAL_PATCHES: Refresh based on what was committed. ++ ++2019-08-14 Martin Liska ++ ++ * asan/asan_globals.cpp (CheckODRViolationViaIndicator): Reapply ++ patch from trunk. ++ (CheckODRViolationViaPoisoning): Likewise. ++ (RegisterGlobal): Likewise. ++ * asan/asan_mapping.h: Likewise. ++ * sanitizer_common/sanitizer_linux_libcdep.cpp (defined): Likewise. ++ * sanitizer_common/sanitizer_mac.cpp (defined): Likewise. ++ * sanitizer_common/sanitizer_platform_limits_linux.cpp (defined): Likewi= se. ++ * sanitizer_common/sanitizer_platform_limits_posix.h (defined): Likewise. ++ * sanitizer_common/sanitizer_stacktrace.cpp (GetCanonicFrame): Likewise. ++ * ubsan/ubsan_handlers.cpp (__ubsan::__ubsan_handle_cfi_bad_icall): Like= wise. ++ (__ubsan::__ubsan_handle_cfi_bad_icall_abort): Likewise. ++ * ubsan/ubsan_handlers.h (struct CFIBadIcallData): Likewise. ++ (struct CFICheckFailData): Likewise. ++ (RECOVERABLE): Likewise. ++ * ubsan/ubsan_platform.h: Likewise. ++ ++2019-08-14 Martin Liska ++ ++ PR sanitizer/89832 ++ PR sanitizer/91325 ++ * All source files: Merge from upstream 368656. ++ ++2019-06-26 Rainer Orth ++ ++ * sanitizer_common/sanitizer_posix_libcdep.cc: Cherry-pick ++ compiler-rt revision 363778. ++ ++2019-06-18 Iain Sandoe ++ ++ PR libsanitizer/87880 ++ * asan/asan_interceptors.h: ++ (ASAN_INTERCEPT___CXA_RETHROW_PRIMARY_EXCEPTION): New. ++ * asan/Makefile.am (DEFS): Add=20 ++ ASAN_HAS_CXA_RETHROW_PRIMARY_EXCEPTION, defined to 0. ++ * asan/Makefile.in: Regenerated. ++ * asan/libtool-version: Bump version. ++ ++2019-05-27 Segher Boessenkool ++ ++ PR target/90639 ++ * tsan/tsan_rtl_ppc64.S: Add ".machine altivec". ++ ++2019-05-14 Rainer Orth ++ ++ * configure.ac (have_dl_iterate_phdr): Remove *-*-solaris2.10* ++ handling. ++ * configure: Regenerate. ++ ++2019-04-08 Martin Liska ++ ++ * LOCAL_PATCHES: Add revision. ++ ++2019-04-08 Martin Liska ++ ++ PR sanitizer/89941 ++ * sanitizer_common/sanitizer_platform_limits_linux.cc (defined): ++ Reapply patch from r259664. ++ * sanitizer_common/sanitizer_platform_limits_posix.h (defined): ++ Likewise. ++ ++2019-03-13 Eric Botcazou ++ ++ PR sanitizer/80953 ++ Merge from LLVM revision 355980 ++ * asan/asan_allocator.h (kAllocatorSpace): Define for SPARC. ++ (kAllocatorSize): Likewise. ++ (DefaultSizeClassMap): Likewise. ++ * asan/asan_mapping.h (kSPARC64_ShadowOffset64): Define. ++ (SHADOW_OFFSET): Define for SPARC. ++ Include asan_mapping_sparc64.h for SPARC 64-bit. ++ * asan/asan_mapping_sparc64.h: New file. ++ ++2019-03-13 Eric Botcazou ++ ++ PR sanitizer/80953 ++ Merge from LLVM revision 355979 ++ * asan/asan_globals.c (GetGlobalsForAddress): Use internal_memcpy to ++ copy Global objects for SPARC with GCC. ++ ++2019-03-13 Eric Botcazou ++ ++ PR sanitizer/80953 ++ Merge from LLVM revision 355978 ++ * sanitizer_common/sanitizer_allocator_primary32.h ++ (class SizeClassAllocator32): Assert that kSpaceSize is power of 2 if ++ SANITIZER_SIGN_EXTENDED_ADDRESSES is set. ++ (PointerIsMine): Deal with SANITIZER_SIGN_EXTENDED_ADDRESSES. ++ (ComputeRegionId): Likewise. ++ * sanitizer_common/sanitizer_linux.cc (GetMaxVirtualAddress): Return ++ appropriate value for SPARC 64-bit. ++ * sanitizer_common/sanitizer_platform.h (SANITIZER_MMAP_RANGE_SIZE): ++ Define for SPARC. ++ (SANITIZER_SIGN_EXTENDED_ADDRESSES): Define to 1 for SPARC 64-bit. ++ ++2019-03-13 Eric Botcazou ++ ++ PR sanitizer/80953 ++ Merge from LLVM revision 355965 ++ * sanitizer_common/sanitizer_linux.cc (GetWriteFlag): Implement for ++ SPARC/Linux. ++ (GetPcSpBp): Likewise. ++ * sanitizer_common/sanitizer_stacktrace.cc (GetNextInstructionPc): ++ Adjust for SPARC. ++ * sanitizer_common/sanitizer_stacktrace.h (SANITIZER_CAN_FAST_UNWIND): ++ Define to 1 for SPARC. ++ * sanitizer_common/sanitizer_stacktrace_sparc.cc: Rewrite. ++ * sanitizer_common/sanitizer_unwind_linux_libcdep.cc (SlowUnwindStack): ++ Adjust the PC address for SPARC with GCC. ++ ++2019-03-06 Martin Liska ++ ++ PR sanitizer/88684 ++ * sanitizer_common/sanitizer_platform.h (defined): Cherry pick. ++ (SANITIZER_NON_UNIQUE_TYPEINFO): Likewise. ++ * ubsan/ubsan_type_hash_itanium.cc (isDerivedFromAtOffset): ++ Likewise. ++ ++2019-02-20 H.J. Lu ++ ++ PR sanitizer/89409 ++ * sanitizer_common/sanitizer_linux.cc (internal_readlink): ++ Cherry-pick compiler-rt r354451. ++ ++2019-01-23 Jonny Grant ++ ++ PR sanitizer/89010 ++ * libsanitizer/README.gcc: Update to current https URLs. ++ ++2018-12-27 Martin Liska ++ ++ PR sanitizer/86229 ++ * asan/asan_errors.cc (ErrorAllocTypeMismatch::Print): Cherry ++ pick rL350085. ++ * asan/asan_errors.h (struct ErrorAllocTypeMismatch): Likewise. ++ ++2018-11-09 Martin Liska ++ ++ * LOCAL_PATCHES: Include one local patch. ++ ++2018-11-09 Martin Liska ++ ++ PR sanitizer/87892 ++ * sanitizer_common/sanitizer_linux_libcdep.cc (defined): Return ++ 1 when CPU_COUNT macro is not defined. ++ ++2018-11-08 Bill Seurer ++ ++ * libsanitizer/sanitizer_common/sanitizer_linux.cc (CheckASLR): ++ Disable ASLR for powerpc64 when using sanitizers. ++ ++2018-11-06 Rainer Orth ++ ++ PR sanitizer/80953 ++ * configure.tgt (sparc*-*-solaris2.11*): Enable. ++ (x86_64-*-solaris2.11* | i?86-*-solaris2.11*): Enable. ++ ++2018-11-06 Rainer Orth ++ ++ PR sanitizer/80953 ++ * sanitizer_common/sanitizer_internal_defs.h, ++ sanitizer_common/sanitizer_platform_limits_solaris.h, ++ sanitizer_common/sanitizer_procmaps_solaris.cc, ++ sanitizer_common/sanitizer_solaris.cc: Cherry-pick compiler-rt ++ revision 346153. ++ * sanitizer_common/sanitizer_stacktrace.h, ++ sanitizer_common/sanitizer_stacktrace_sparc.cc: Cherry-pick ++ compiler-rt revision 346155. ++ ++2018-11-05 Segher Boessenkool ++ ++ * LOCAL_PATCHES: Add r258525. ++ * sanitizer_common/sanitizer_stacktrace.cc ++ (BufferedStackTrace::FastUnwindStack): Use the correct frame offset ++ for PowerPC SYSV ABI. ++ ++2018-11-05 Martin Liska ++ ++ PR sanitizer/87860 ++ * sanitizer_common/sanitizer_linux.cc: Cherry-pick upstream ++ r346129. ++ ++2018-10-31 Joseph Myers ++ ++ PR bootstrap/82856 ++ * Makefile.am: Include multilib.am. ++ * configure.ac: Remove AC_PREREQ. Use AC_LANG_SOURCE. ++ * Makefile.in, aclocal.m4, asan/Makefile.in, configure, ++ interception/Makefile.in, libbacktrace/Makefile.in, ++ lsan/Makefile.in, sanitizer_common/Makefile.in, tsan/Makefile.in, ++ ubsan/Makefile.in: Regenerate. ++ ++2018-10-31 Martin Liska ++ ++ * LOCAL_PATCHES: Update to installed revisions. ++ ++2018-10-31 Martin Liska ++ ++ * ubsan/ubsan_platform.h: Add ifndef as we define it with ++ -DCAN_SANITIZE_UB CFLAGS. ++ ++2018-10-31 Martin Liska ++ ++ * asan/asan_mapping.h: Revert shadow memory offset to 1 << 41. ++ ++2018-10-31 Martin Liska ++ ++ * LOCAL_PATCHES: Update patch list. ++ * asan/asan_globals.cc (CheckODRViolationViaIndicator): Apply ++ patches from GCC's trunk. ++ (CheckODRViolationViaPoisoning): Likewise. ++ (RegisterGlobal): Likewise. ++ * sanitizer_common/sanitizer_mac.cc (defined): Likewise. ++ * sanitizer_common/sanitizer_stacktrace.cc (GetCanonicFrame): Likewise. ++ * ubsan/ubsan_handlers.cc (__ubsan::__ubsan_handle_cfi_bad_icall): Likew= ise. ++ (__ubsan::__ubsan_handle_cfi_bad_icall_abort): Likewise. ++ * ubsan/ubsan_handlers.h (struct CFIBadIcallData): Likewise. ++ (struct CFICheckFailData): Likewise. ++ (RECOVERABLE): Likewise. ++ ++2018-10-31 Martin Liska ++ ++ * config.h.in: Regenerate. ++ * configure: Likewise. ++ * sanitizer_common/Makefile.am: Include new files, remove old ++ files. ++ * sanitizer_common/Makefile.in: Regenerate. ++ * ubsan/Makefile.am: Include new files, remove old ++ files. ++ * ubsan/Makefile.in: Likewise. ++ * asan/Makefile.am: Include new files. ++ * asan/Makefile.in: Regenerate. ++ ++2018-10-31 Martin Liska ++ ++ * All source files: Merge from upstream 345033. ++ ++2018-10-31 Martin Liska ++ ++ * HOWTO_MERGE: Enhance documentation. ++ * merge.sh: Add support for git as well. ++ ++2018-08-02 Martin Liska ++ ++ PR sanitizer/86022 ++ * sanitizer_common/sanitizer_linux_libcdep.cc (ThreadDescriptorSize): ++ Cherry-pick compiler-rt revision 338606. ++ ++2018-08-01 Marek Polacek ++ ++ PR sanitizer/86759 ++ * tsan/tsan_platform.h: Cherry-pick compiler-rt revision 318044. ++ * tsan/tsan_platform_linux.cc: Cherry-pick compiler-rt revision ++ 319180. ++ ++2018-07-25 H.J. Lu ++ ++ PR target/86560 ++ * asan/asan_interceptors.cc (swapcontext) Cherry-pick ++ compiler-rt revision 337603. ++ * sanitizer_common/sanitizer_internal_defs.h (__has_attribute): ++ Likewise. ++ ++2018-07-05 Jakub Jelinek ++ ++ Revert ++ 2018-07-04 Maxim Ostapenko ++ ++ PR sanitizer/84250 ++ * Makefile.am: Reorder libs. ++ * Makefile.in: Regenerate. ++ * asan/Makefile.am: Define DCAN_SANITIZE_UB=3D1, add dependancy from ++ libsanitizer_ubsan.la. ++ * asan/Makefile.in: Regenerate. ++ * ubsan/Makefile.am: Define new libsanitizer_ubsan.la library. ++ * ubsan/Makefile.in: Regenerate. ++ ++2018-07-04 Maxim Ostapenko ++ ++ PR sanitizer/84250 ++ * Makefile.am: Reorder libs. ++ * Makefile.in: Regenerate. ++ * asan/Makefile.am: Define DCAN_SANITIZE_UB=3D1, add dependancy from ++ libsanitizer_ubsan.la. ++ * asan/Makefile.in: Regenerate. ++ * ubsan/Makefile.am: Define new libsanitizer_ubsan.la library. ++ * ubsan/Makefile.in: Regenerate. ++ ++2018-06-13 Denis Khalikov ++ ++ PR sanitizer/86090 ++ * configure.ac: Check for lstat and readlink. ++ * configure, config.h.in: Rebuild. +=20 + 2018-05-31 Matthias Klose +=20 +@@ -51,49 +438,186 @@ + (SIZEOF_STRUCT_USTAT): New. + (struct_ustat_sz): Use SIZEOF_STRUCT_USTAT for Linux. +=20 +-2018-04-24 Martin Liska ++2018-04-26 Hans-Peter Nilsson ++ ++ * configure.tgt : Enable build, excluding ++ mips*64*-*-linux*. ++ ++ * sanitizer_common/sanitizer_platform_limits_linux.cc: Do not ++ take the shortcut to #include for MIPS instead of ++ the kernel . Explain why sys/stat.h is misleading ++ or wrong to get the kernel struct stat. ++ * sanitizer_common/sanitizer_platform_limits_posix.h [__mips__]: ++ Correct the value for 32-bit non-android struct_kernel_stat_sz. +=20 +- Backport from mainline +- 2018-04-18 Bill Seurer ++ * sanitizer_common/sanitizer_atomic_clang_other.h [_MIPS_SIM ++ && _MIPS_SIM =3D=3D _ABIO32] (lock): Add initializer for .pad member. ++ ++2018-04-24 H.J. Lu ++ ++ * configure: Regenerated. ++ ++2018-04-19 Jakub Jelinek ++ ++ * configure: Regenerated. ++ ++2018-04-18 David Malcolm ++ ++ PR jit/85384 ++ * configure: Regenerate. ++ ++2018-04-18 Bill Seurer +=20 + PR sanitizer/85389 + * asan/asan_allocator.h (kAllocatorSpace): For __powerpc64__ change + from 0xa0000000000ULL to ~(uptr)0. +=20 +-2018-01-25 Release Manager ++2018-03-19 Jakub Jelinek +=20 +- * GCC 7.3.0 released. ++ PR sanitizer/84761 ++ * sanitizer_common/sanitizer_linux_libcdep.cc (__GLIBC_PREREQ): ++ Define if not defined. ++ (DL_INTERNAL_FUNCTION): Don't define. ++ (InitTlsSize): For __i386__ if not compiled against glibc 2.27+ ++ determine at runtime whether to use regparm(3), stdcall calling ++ convention for older glibcs or normal calling convention for ++ newer glibcs for call to _dl_get_tls_static_info. ++ ++2018-03-14 Segher Boessenkool ++ ++ * sanitizer_common/sanitizer_stacktrace.cc ++ (BufferedStackTrace::FastUnwindStack): Use the correct frame offset ++ for PowerPC SYSV ABI. ++ ++2018-02-14 Igor Tsimbalist ++ ++ PR target/84148 ++ * configure: Regenerate. ++ ++2018-02-05 Martin Liska ++ ++ * asan/asan_flags.inc: Cherry-pick upstream r323995. ++ * asan/asan_report.cc (CheckForInvalidPointerPair): ++ Cherry-pick upstream r323995. ++ ++2018-01-17 Rainer Orth ++ ++ PR sanitizer/82825 ++ * sanitizer_common/sanitizer_internal_defs.h: Cherry-pick upstream ++ r324284. ++ ++2018-01-13 Rainer Orth ++ ++ PR sanitizer/82824 ++ * lsan/lsan_common_mac.cc: Cherry-pick upstream r322437. ++ ++2017-12-05 Martin Liska ++ Jakub Jelinek ++ ++ * asan/asan_descriptions.cc: Cherry-pick upstream r319668. ++ * asan/asan_descriptions.h: Likewise. ++ * asan/asan_report.cc: Likewise. ++ * asan/asan_thread.cc: Likewise. ++ * asan/asan_thread.h: Likewise. ++ ++2017-11-17 Igor Tsimbalist ++ ++ * acinclude.m4: Add enable.m4 and cet.m4. ++ * Makefile.in: Regenerate. ++ * asan/Makefile.am: Update AM_CXXFLAGS. ++ * asan/Makefile.in: Regenerate. ++ * configure: Likewise. ++ * configure.ac: Set CET_FLAGS. Update EXTRA_CFLAGS, ++ EXTRA_CXXFLAGS, EXTRA_ASFLAGS. ++ * interception/Makefile.am: Update AM_CXXFLAGS. ++ * interception/Makefile.in: Regenerate. ++ * libbacktrace/Makefile.am: Update AM_CFLAGS, AM_CXXFLAGS. ++ * libbacktrace/Makefile.in: Regenerate. ++ * lsan/Makefile.am: Update AM_CXXFLAGS. ++ * lsan/Makefile.in: Regenerate. ++ * sanitizer_common/Makefile.am: Update AM_CXXFLAGS, ++ AM_CCASFLAGS. ++ * sanitizer_common/sanitizer_linux_x86_64.S: Include cet.h. ++ Add _CET_ENDBR macro. ++ * sanitizer_common/Makefile.in: Regenerate. ++ * tsan/Makefile.am: Update AM_CXXFLAGS. ++ * tsan/Makefile.in: Regenerate. ++ * tsan/tsan_rtl_amd64.S Include cet.h. Add _CET_ENDBR macro. ++ * ubsan/Makefile.am: Update AM_CXXFLAGS. ++ * ubsan/Makefile.in: Regenerate. ++ ++2017-11-08 Jakub Jelinek ++ ++ PR bootstrap/82670 ++ * ubsan/Makefile.am (ubsan_files): Remove ubsan_init_standalone.cc ++ and ubsan_signals_standalone.cc. ++ * ubsan/Makefile.in: Regenerated. ++ ++2017-11-05 Tom de Vries ++ ++ PR other/82784 ++ * asan/asan_poisoning.cc (CHECK_SMALL_REGION): Remove semicolon after ++ "do {} while (0)". ++ * lsan/lsan_common.cc (LOG_POINTERS, LOG_THREADS): Same. +=20 + 2017-10-20 Jakub Jelinek +=20 + PR sanitizer/82595 +- * lsan/Makefile.am (lsan_files): Remove lsan_preinit.cc. ++ * lsan/lsan.h (__lsan_init): Add SANITIZER_INTERFACE_ATTRIBUTE. ++ * lsan/Makefile.am (nodist_toolexeclib_HEADERS): Add ++ liblsan_preinit.o. ++ (lsan_files): Remove lsan_preinit.cc. ++ (liblsan_preinit.o): New rule. + * lsan/Makefile.in: Regenerated. +=20 +-2017-10-05 H.J. Lu ++2017-10-19 Jakub Jelinek +=20 +- Backported from mainline +- 2017-10-05 H.J. Lu ++ * All source files: Merge from upstream 315899. ++ * asan/Makefile.am (nodist_saninclude_HEADERS): Add ++ include/sanitizer/tsan_interface.h. ++ * asan/libtool-version: Bump the libasan SONAME. ++ * lsan/Makefile.am (sanitizer_lsan_files): Add lsan_common_mac.cc. ++ (lsan_files): Add lsan_linux.cc, lsan_mac.cc and lsan_malloc_mac.cc. ++ * sanitizer_common/Makefile.am (sanitizer_common_files): Add ++ sancov_flags.cc, sanitizer_allocator_checks.cc, ++ sanitizer_coverage_libcdep_new.cc, sanitizer_errno.cc, ++ sanitizer_file.cc, sanitizer_mac_libcdep.cc and ++ sanitizer_stoptheworld_mac.cc. Remove sanitizer_coverage_libcdep.cc ++ and sanitizer_coverage_mapping_libcdep.cc. ++ * tsan/Makefile.am (tsan_files): Add tsan_external.cc. ++ * ubsan/Makefile.am (DEFS): Add -DUBSAN_CAN_USE_CXXABI=3D1. ++ (ubsan_files): Add ubsan_init_standalone.cc and ++ ubsan_signals_standalone.cc. ++ * ubsan/libtool-version: Bump the libubsan SONAME. ++ * asan/Makefile.in: Regenerate. ++ * lsan/Makefile.in: Regenerate. ++ * sanitizer_common/Makefile.in: Regenerate. ++ * tsan/Makefile.in: Regenerate. ++ * ubsan/Makefile.in: Regenerate. ++ ++2017-10-05 H.J. Lu +=20 + PR sanitizer/82379 + * configure.tgt (SANITIZER_COMMON_TARGET_DEPENDENT_OBJECTS): Set + to sanitizer_linux_x86_64.lo if __x86_64__ is defined by $CC. +=20 +-2017-09-07 Jakub Jelinek ++2017-10-02 Jakub Jelinek +=20 +- Backported from mainline +- 2017-08-07 Jakub Jelinek ++ * libbacktrace/backtrace-rename.h (backtrace_uncompress_zdebug): ++ Define. +=20 +- * include/system/sys/ptrace.h: New file. ++2017-08-07 Jakub Jelinek +=20 +-2017-08-14 Release Manager ++ * include/system/sys/ptrace.h: New file. +=20 +- * GCC 7.2.0 released. ++2017-07-28 Jakub Jelinek +=20 +-2017-07-17 Jakub Jelinek ++ PR sanitizer/80998 ++ * ubsan/ubsan_handlers.cc: Cherry-pick upstream r304461. ++ * ubsan/ubsan_checks.inc: Likewise. ++ * ubsan/ubsan_handlers.h: Likewise. +=20 +- Backported from mainline +- 2017-07-14 Jakub Jelinek ++2017-07-14 Jakub Jelinek +=20 + PR sanitizer/81066 + * sanitizer_common/sanitizer_linux.h: Cherry-pick upstream r307969. +@@ -101,10 +625,6 @@ + * sanitizer_common/sanitizer_stoptheworld_linux_libcdep.cc: Likewise. + * tsan/tsan_platform_linux.cc: Likewise. +=20 +-2017-05-02 Release Manager +- +- * GCC 7.1.0 released. +- + 2017-04-06 Martin Liska +=20 + PR sanitizer/80166 +@@ -883,7 +1403,7 @@ +=20 + 2013-12-19 Kostya Serebryany +=20 +- * sanitizer_common/sanitizer_platform_limits_posix.cc: ++ * sanitizer_common/sanitizer_platform_limits_posix.cc: + workaround for missing definition of EOWNERDEAD, backport + from upstream r196779. +=20 +@@ -986,10 +1506,10 @@ + 2013-11-15 Kostya Serebryany +=20 + PR sanitizer/58994 +- Backport from upstream revision 194573 +- * asan/asan_interceptors.cc (COMMON_INTERCEPTOR_ENTER): Fall +- back to the original functions in the common libsanitizer +- interceptors and the __cxa_atexit() interceptor on Darwin. ++ Backport from upstream revision 194573 ++ * asan/asan_interceptors.cc (COMMON_INTERCEPTOR_ENTER): Fall ++ back to the original functions in the common libsanitizer ++ interceptors and the __cxa_atexit() interceptor on Darwin. +=20 + 2013-11-13 Peter Bergner +=20 +diff --git a/libsanitizer/Makefile.in b/libsanitizer/Makefile.in +index 1f4bb8cd6bb..fb533c253ea 100644 +--- a/libsanitizer/Makefile.in ++++ b/libsanitizer/Makefile.in +@@ -71,6 +71,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/aclocal.m4 b/libsanitizer/aclocal.m4 +index 55e063530f6..f51347671e3 100644 +--- a/libsanitizer/aclocal.m4 ++++ b/libsanitizer/aclocal.m4 +@@ -1017,6 +1017,7 @@ m4_include([../config/libstdc++-raw-cxx.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libsanitizer/asan/Makefile.in b/libsanitizer/asan/Makefile.in +index 4dad60ba1ae..f079e07f0da 100644 +--- a/libsanitizer/asan/Makefile.in ++++ b/libsanitizer/asan/Makefile.in +@@ -66,6 +66,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/configure b/libsanitizer/configure +index a3a08d635f4..5f4cdcad38d 100755 +--- a/libsanitizer/configure ++++ b/libsanitizer/configure +@@ -767,6 +767,7 @@ enable_multilib + enable_version_specific_runtime_libs + enable_dependency_tracking + enable_maintainer_mode ++with_toolexeclibdir + enable_shared + enable_static + with_pic +@@ -1425,6 +1426,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -4773,6 +4777,22 @@ fi +=20 +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -4788,7 +4808,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -12032,7 +12059,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 12035 "configure" ++#line 12062 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -12138,7 +12165,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 12141 "configure" ++#line 12168 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libsanitizer/configure.ac b/libsanitizer/configure.ac +index b0c485b0f7b..d69d5aa1c9a 100644 +--- a/libsanitizer/configure.ac ++++ b/libsanitizer/configure.ac +@@ -30,6 +30,8 @@ GCC_LIBSTDCXX_RAW_CXX_FLAGS + AM_INIT_AUTOMAKE(foreign no-dist) + AM_MAINTAINER_MODE +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -45,7 +47,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libsanitizer/interception/Makefile.in b/libsanitizer/intercep= tion/Makefile.in +index c71fb57b8b8..ed9c996b5eb 100644 +--- a/libsanitizer/interception/Makefile.in ++++ b/libsanitizer/interception/Makefile.in +@@ -62,6 +62,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/libbacktrace/Makefile.in b/libsanitizer/libbackt= race/Makefile.in +index dff04cfa3ea..22655306594 100644 +--- a/libsanitizer/libbacktrace/Makefile.in ++++ b/libsanitizer/libbacktrace/Makefile.in +@@ -94,6 +94,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/lsan/Makefile.in b/libsanitizer/lsan/Makefile.in +index baa8367cd40..efae691d3ef 100644 +--- a/libsanitizer/lsan/Makefile.in ++++ b/libsanitizer/lsan/Makefile.in +@@ -63,6 +63,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/sanitizer_common/Makefile.in b/libsanitizer/sani= tizer_common/Makefile.in +index c375f63a380..27c8b410ef7 100644 +--- a/libsanitizer/sanitizer_common/Makefile.in ++++ b/libsanitizer/sanitizer_common/Makefile.in +@@ -68,6 +68,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/tsan/Makefile.in b/libsanitizer/tsan/Makefile.in +index 770c053e64f..a77cda3d0f3 100644 +--- a/libsanitizer/tsan/Makefile.in ++++ b/libsanitizer/tsan/Makefile.in +@@ -65,6 +65,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/ubsan/Makefile.in b/libsanitizer/ubsan/Makefile.= in +index 1664ce9497e..108505c3c67 100644 +--- a/libsanitizer/ubsan/Makefile.in ++++ b/libsanitizer/ubsan/Makefile.in +@@ -64,6 +64,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libssp/ChangeLog b/libssp/ChangeLog +index 39bcae0cfd1..f1ccde4e36f 100644 +--- a/libssp/ChangeLog ++++ b/libssp/ChangeLog +@@ -1,30 +1,61 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * Makefile.in: Regenerate. ++ * aclocal.m4: Regenerate. ++ * configure: Regenerate. ++ ++2020-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++2019-09-27 Maciej W. Rozycki ++ ++ * configure: Regenerate. ++ ++2019-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++2018-10-31 Joseph Myers ++ ++ PR bootstrap/82856 ++ * Makefile.am: Include multilib.am. ++ (AUTOMAKE_OPTIONS): Remove 1.9.5. ++ * configure.ac: Remove AC_PREREQ. Quote argument to ++ AC_RUN_IFELSE. ++ * Makefile.in, aclocal.m4, configure: Regenerate. +=20 +-2018-12-06 Release Manager ++2018-04-24 H.J. Lu +=20 +- * GCC 7.4.0 released. ++ * configure: Regenerated. ++ ++2018-04-19 Jakub Jelinek +=20 +-2018-06-22 Jakub Jelinek ++ * configure: Regenerated. +=20 +- Backported from mainline +- 2018-04-18 David Malcolm ++2018-04-18 David Malcolm +=20 + PR jit/85384 + * configure: Regenerate. +=20 +-2018-01-25 Release Manager ++2018-02-14 Igor Tsimbalist +=20 +- * GCC 7.3.0 released. ++ PR target/84148 ++ * configure: Regenerate. +=20 +-2017-08-14 Release Manager ++2018-01-03 Jakub Jelinek +=20 +- * GCC 7.2.0 released. ++ Update copyright years. +=20 +-2017-05-02 Release Manager ++2017-11-17 Igor Tsimbalist +=20 +- * GCC 7.1.0 released. ++ * Makefile.am: Update AM_CFLAGS, update ++ libssp_nonshared_la_CFLAGS. ++ * Makefile.in: Regenerate. ++ * configure: Likewise. ++ * aclocal.m4: Likewise. ++ * configure.ac: Set CET_FLAGS. Update XCFLAGS. +=20 + 2017-04-01 Jonathan Yong <10walls@gmail.com> +=20 +@@ -248,7 +279,7 @@ + * configure: Regenerate. +=20 + 2008-09-26 Peter O'Gorman +- Steve Ellcey ++ Steve Ellcey +=20 + * configure: Regenerate for new libtool. + * Makefile.in: Ditto. +diff --git a/libssp/Makefile.in b/libssp/Makefile.in +index 96b03ae1248..c119ef3e8a2 100644 +--- a/libssp/Makefile.in ++++ b/libssp/Makefile.in +@@ -67,6 +67,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/configure.ac +diff --git a/libssp/aclocal.m4 b/libssp/aclocal.m4 +index 927988e5814..46585360592 100644 +--- a/libssp/aclocal.m4 ++++ b/libssp/aclocal.m4 +@@ -995,6 +995,7 @@ m4_include([../config/lthostflags.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/no-executables.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/libssp/configure b/libssp/configure +index ee1751d20db..3273cd40ab1 100755 +--- a/libssp/configure ++++ b/libssp/configure +@@ -743,6 +743,7 @@ with_pic + enable_fast_install + with_gnu_ld + enable_libtool_lock ++with_toolexeclibdir + with_gcc_major_version_only + ' + ac_precious_vars=3D'build_alias +@@ -1389,6 +1390,9 @@ Optional Packages: + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-gcc-major-version-only + use only GCC major number in filesystem paths +=20 +@@ -10671,7 +10675,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10674 "configure" ++#line 10678 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -10777,7 +10781,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10780 "configure" ++#line 10784 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11039,6 +11043,22 @@ esac +=20 +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -11054,7 +11074,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libssp/configure.ac b/libssp/configure.ac +index 9e4a22a24d4..63538cb8f4e 100644 +--- a/libssp/configure.ac ++++ b/libssp/configure.ac +@@ -159,6 +159,8 @@ ACX_LT_HOST_FLAGS + AC_SUBST(enable_shared) + AC_SUBST(enable_static) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -174,7 +176,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libstdc++-v3/ChangeLog b/libstdc++-v3/ChangeLog +index 10173a719f5..2e96d56c12c 100644 +--- a/libstdc++-v3/ChangeLog ++++ b/libstdc++-v3/ChangeLog +@@ -1,3753 +1,302 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. +- +-2019-10-24 Jonathan Wakely +- +- Backport from mainline +- 2019-10-18 Jonathan Wakely +- +- PR libstdc++/92143 +- * libsupc++/new_opa.cc (operator new) [__APPLE__]: Increase alignment +- to at least sizeof(void*). +- +- Backport from mainline +- 2019-10-08 Jonathan Wakely +- +- * doc/Makefile.am (doc-html-docbook-regenerate): New target. +- (${docbook_outdir}/html): Do not create unused 'html/ext' directory. +- * doc/Makefile.in: Regenerate. +- * doc/xml/manual/documentation_hacking.xml: Document new target. +- * doc/html/*: Regenerate. +- +- * doc/xml/manual/allocator.xml: Use archived copy of CUJ article. +- +- Backport from mainline +- 2019-05-31 Gerald Pfeifer +- +- * doc/xml/manual/allocator.xml: Move hoard.org back to http. +- +-2019-09-11 Jonathan Wakely +- +- * python/libstdcxx/v6/xmethods.py (SharedPtrUseCountWorker.__call__): +- Fix syntax error. +- +-2019-09-02 Jonathan Wakely +- +- PR middle-end/89303 +- * testsuite/20_util/enable_shared_from_this/89303.cc: New test. +- +-2019-09-02 Jonathan Wakely +- +- * testsuite/20_util/unique_ptr/assign/48635_neg.cc: Replace dg-error +- with dg-prune-output for enable_if failure. +- * testsuite/20_util/unique_ptr/cons/cv_qual_neg.cc: Add +- dg-prune-output for enable_if failure. +- +- Backport from mainline +- 2019-07-31 Jonathan Wakely +- +- PR libstdc++/91308 +- * include/bits/unique_ptr.h (unique_ptr::__safe_conversion_up): Remove +- constraints on deleter that should only apply to the constructor. +- (unique_ptr::__safe_conversion_up): Likewise. +- (unique_ptr::unique_ptr(unique_ptr&&)): Restore +- constraints on deleter here. +- * testsuite/20_util/unique_ptr/assign/91308.cc: New test. +- +-2019-09-02 Jonathan Wakely +- +- Backport from mainline +- 2019-07-29 Jonathan Wakely +- +- PR libstdc++/51333 +- * libsupc++/cxxabi.h (__gnu_cxx::recursive_init_error): Do not define +- constructor inline. +- * libsupc++/guard_error.cc (__gnu_cxx::recursive_init_error): Define +- constructor. +- * testsuite/18_support/51333.cc: New test. +- +-2019-09-02 Jonathan Wakely +- +- Backport from mainline +- 2019-06-07 Jonathan Wakely +- +- PR libstdc++/90770 +- * src/Makefile.am (stamp-debug): Also test for missing makefile. +- * src/Makefile.in: Regenerate. +- +-2019-09-02 Jonathan Wakely +- +- Backport from mainline +- 2019-05-23 Jonathan Wakely +- +- * doc/xml/manual/status_cxx2017.xml: Add feature test macro for +- P0040R3. +- * doc/html/*: Regenerate. +- +- Backport from mainline +- 2019-06-20 Jonathan Wakely +- +- * doc/xml/manual/status_cxx2017.xml: Fix outdated reference to +- C++17 working draft. +- +- Backport from mainline +- 2019-05-21 Jonathan Wakely +- +- * doc/xml/manual/shared_ptr.xml: Fix names of lock policy constants. +- +-2019-09-02 Jonathan Wakely +- +- Backport from mainline +- 2019-05-17 Jonathan Wakely +- +- * include/bits/random.h (seed_seq::param): Fix non-reserved name. +- * include/experimental/type_traits (is_detected_exact) +- (is_detected_exact_v): Likewise. +- * testsuite/17_intro/names.cc: Check for more non-reserved names. +- * testsuite/experimental/names.cc: New test. +- +-2019-06-26 Jonathan Wakely +- +- Backport from mainline +- 2019-05-28 Jonathan Wakely +- +- PR libstdc++/90634 +- * include/experimental/bits/fs_path.h (path::path(path&&)): Only call +- _M_split_cmpts() for a path with multiple components. +- (path::_S_is_dir_sep()): Add missing 'static' keyword to function. +- * src/filesystem/path.cc (path::_M_split_cmpts()): Count number of +- components and reserve space in vector. Return early when there is +- only one component. +- * testsuite/experimental/filesystem/path/construct/90634.cc: New test. +- +-2019-05-23 Jonathan Wakely +- +- Backport from mainline +- 2019-02-27 Jonathan Wakely +- +- PR libstdc++/89466 +- * acinclude.m4 (GLIBCXX_CONFIGURE_DOCBOOK): Reorder check for local +- stylesheet directories before check for xsltproc. Try to use +- xmlcatalog to find local stylesheet directory before trying hardcoded +- paths. Add path used by suse to hardcoded paths. Adjust xsltproc +- check to look for the same stylesheet as doc/Makefile.am uses. Don't +- use xsltproc if xmlcatalog fails to find a local stylesheet. +- * configure.ac: Check for xmlcatalog. +- * Makefile.in: Regenerate. +- * configure: Likewise. +- * doc/Makefile.in: Likewise. +- * include/Makefile.in: Likewise. +- * libsupc++/Makefile.in: Likewise. +- * po/Makefile.in: Likewise. +- * python/Makefile.in: Likewise. +- * src/Makefile.in: Likewise. +- * src/c++11/Makefile.in: Likewise. +- * src/c++17/Makefile.in: Likewise. +- * src/c++98/Makefile.in: Likewise. +- * src/filesystem/Makefile.in: Likewise. +- * testsuite/Makefile.in: Likewise. +- +-2019-05-23 Jonathan Wakely +- +- Backport from mainline +- 2019-01-22 Jonathan Wakely +- +- PR libstdc++/88740 +- * testsuite/util/testsuite_hooks.h [stderr] (VERIFY): Use fprintf to +- write to stderr instead of using printf. +- +-2019-05-23 Jonathan Wakely +- +- Backport from mainline +- 2019-05-23 Jonathan Wakely +- +- * include/experimental/any (__any_caster): Use RTTI if comparing +- addresses fails, to support non-unique addresses in shared libraries. +- * include/std/any (__any_caster): Likewise. +- * testsuite/experimental/any/misc/any_cast_neg.cc: Use 0 for dg-error +- line number. +- +-2019-05-23 Jonathan Wakely +- +- Backport from mainline +- 2019-05-23 Jonathan Wakely +- +- PR libstdc++/90220 +- * include/experimental/any (__any_caster): Constrain to only be +- callable for object types. Use remove_cv_t instead of decay_t. +- If the type decays or isn't copy constructible, compare the manager +- function to a dummy specialization. +- (__any_caster): Add overload constrained for non-object types. +- (any::_Manager_internal<_Op>): Add dummy specialization. +- * testsuite/experimental/any/misc/any_cast.cc: Test function types +- and array types. +- +- Backport from mainline +- 2019-04-24 Jonathan Wakely +- +- PR libstdc++/90220 +- * include/std/any (__any_caster): Use remove_cv_t instead of decay_t. +- Avoid a runtime check for types that can never be stored in std::any. +- * testsuite/20_util/any/misc/any_cast.cc: Test std::any_cast with +- array types. +- +- Backport from mainline +- 2019-04-24 Jonathan Wakely +- +- PR libstdc++/90220 (partial) +- * include/std/any (any_cast(any*), any_cast(const any*)): Do +- not attempt ill-formed static_cast to pointers to non-object types. +- * testsuite/20_util/any/misc/any_cast.cc: Test std::any_cast with +- function types. +- +-2019-05-23 Jonathan Wakely +- +- Backported from mainline +- 2019-01-15 Jonathan Wakely +- +- * doc/xml/manual/status_cxx2017.xml: Document P0032R3 and P0307R2 +- status. +- * include/bits/stl_uninitialized.h (__cpp_lib_raw_memory_algorithms): +- Define. +- * include/std/any (__cpp_lib_any): Define as 201606L, because P0032R3 +- changes are supported. +- * include/std/optional (__cpp_lib_optional): Likewise. +- * include/std/variant (__cpp_lib_variant): Likewise. +- +-2019-05-08 Jonathan Wakely +- +- Backport from mainline +- 2019-04-17 Jonathan Wakely +- +- PR libstdc++/90105 +- * include/bits/forward_list.tcc (operator=3D=3D): Do not use operator!= =3D to +- compare elements. +- (forward_list::sort(Comp)): When elements are equal take the one +- earlier in the list, so that sort is stable. +- * testsuite/23_containers/forward_list/operations/90105.cc: New test. +- * testsuite/23_containers/forward_list/comparable.cc: Test with +- types that meet the minimum EqualityComparable and LessThanComparable +- requirements. Remove irrelevant comment. +- +- Backport from mainline +- 2019-03-11 Jonathan Wakely +- +- PR libstdc++/89629 +- * libsupc++/hash_bytes.cc [__SIZEOF_SIZE_T__ =3D=3D 8] (_Hash_bytes): +- Use correct type for len_aligned. +- * testsuite/20_util/hash/89629.cc: New test. +- +-2019-02-22 Jonathan Wakely +- +- PR libstdc++/89446 +- * include/bits/char_traits.h (__constant_char_array): Check index is +- in range before dereferencing. +- * testsuite/21_strings/basic_string_view/operators/char/89446.cc: +- New test. +- +-2018-12-24 Iain Sandoe +- +- Backport from mainline +- 2018-12-06 Iain Sandoe +- +- * scripts/make_exports.pl (check names): Don=E2=80=99t try to export +- construction vtable symbols. +- +-2018-12-24 Iain Sandoe +- +- Backport from mainline +- 2018-12-06 Jonathan Wakely +- Iain Sandoe +- +- PR libstdc++/64883 +- * testsuite/17_intro/headers/c++1998/all_attributes.cc: Don't test +- always_inline on Darwin. +- * testsuite/17_intro/headers/c++2011/all_attributes.cc: Likewise. +- * testsuite/17_intro/headers/c++2014/all_attributes.cc: Likewise. +- * testsuite/17_intro/headers/c++2017/all_attributes.cc: Likewise. +- * testsuite/17_intro/headers/c++2020/all_attributes.cc: Likewise. +- +-2018-12-24 Iain Sandoe +- +- Backport from mainline +- 2018-08-25 Iain Sandoe +- +- PR libstdc++/70694 +- * configure.host (OPT_LDFLAGS): Don't append +- -fvisibility-inlines-hidden for newer Darwin. +- +-2018-12-06 Release Manager +- +- * GCC 7.4.0 released. +- +-2018-11-28 Fran=C3=A7ois Dumont +- +- PR libstdc++/88199 +- * include/bits/hashtable.h +- (_Hashtable<>::_M_move_assign(_Hashtable&&, false_type)): Deallocate +- former buckets after assignment. +- * testsuite/23_containers/unordered_set/allocator/move_assign.cc +- (test03): New. +- +-2018-10-31 Jonathan Wakely +- +- Backport from mainline +- 2018-10-31 Jonathan Wakely +- +- PR libstdc++/87822 +- * include/bits/stl_pair.h (__pair_base): Change to class template. +- (pair): Make base class type depend on template parameters. +- * testsuite/20_util/pair/87822.cc: New test. +- +-2018-10-25 Jonathan Wakely +- +- PR libstdc++/87749 +- * include/bits/basic_string.h [_GLIBCXX_USE_CXX11_ABI] +- (basic_string::operator=3D(basic_string&&)): For short strings copy the +- buffer inline. Only fall back to using assign(const basic_string&) to +- do a deep copy when reallocation is needed. +- * testsuite/21_strings/basic_string/modifiers/assign/char/87749.cc: +- New test. +- * testsuite/21_strings/basic_string/modifiers/assign/char/ +- move_assign_optim.cc: New test. +- * testsuite/21_strings/basic_string/modifiers/assign/wchar_t/87749.cc: +- New test. +- * testsuite/21_strings/basic_string/modifiers/assign/wchar_t/ +- move_assign_optim.cc: New test. +- +-2018-10-23 Jonathan Wakely +- +- PR libstdc++/87704 +- * include/bits/unique_ptr.h (unique_ptr::unique_ptr(nullptr_t)): Do +- not delegate to default constructor. +- (unique_ptr::unique_ptr(nullptr_t)): Likewise. +- * testsuite/20_util/unique_ptr/cons/incomplete.cc: New test. +- +-2018-10-22 Jonathan Wakely +- +- Backport from mainline +- 2017-09-12 Jonathan Wakely +- +- PR libstdc++/79433 +- * include/Makefile.am: Remove . +- * include/Makefile.in: Regenerate. +- * include/bits/c++14_warning.h: Remove. +- * include/experimental/algorithm: Do not include . +- * include/experimental/any: Likewise. +- * include/experimental/array: Likewise. +- * include/experimental/bits/erase_if.h: Likewise. +- * include/experimental/bits/lfts_config.h: Likewise. +- * include/experimental/bits/shared_ptr.h: Likewise. +- * include/experimental/bits/string_view.tcc: Likewise. +- * include/experimental/chrono: Likewise. +- * include/experimental/deque: Likewise. +- * include/experimental/filesystem: Do not include . +- * include/experimental/forward_list: Do not include . +- * include/experimental/functional: Likewise. +- * include/experimental/iterator: Likewise. +- * include/experimental/list: Likewise. +- * include/experimental/map: Likewise. +- * include/experimental/memory: Likewise. +- * include/experimental/numeric: Likewise. +- * include/experimental/optional: Likewise. +- * include/experimental/propagate_const: Likewise. +- * include/experimental/ratio: Likewise. +- * include/experimental/regex: Likewise. +- * include/experimental/set: Likewise. +- * include/experimental/string: Likewise. +- * include/experimental/string_view: Likewise. +- * include/experimental/system_error: Likewise. +- * include/experimental/tuple: Likewise. +- * include/experimental/type_traits: Likewise. +- * include/experimental/unordered_map: Likewise. +- * include/experimental/unordered_set: Likewise. +- * include/experimental/vector: Likewise. +- * testsuite/experimental/any/misc/any_cast_neg.cc: Adjust dg-error +- line number. +- * testsuite/experimental/array/neg.cc: Likewise. +- * testsuite/experimental/propagate_const/assignment/move_neg.cc: +- Likewise. +- * testsuite/experimental/propagate_const/cons/move_neg.cc: Likewise. +- * testsuite/experimental/propagate_const/requirements2.cc: Likewise. +- * testsuite/experimental/propagate_const/requirements3.cc: Likewise. +- * testsuite/experimental/propagate_const/requirements4.cc: Likewise. +- * testsuite/experimental/propagate_const/requirements5.cc: Likewise. +- +-2018-10-18 Jonathan Wakely +- +- Backport from mainline +- 2018-10-18 Jonathan Wakely +- +- PR libstdc++/87641 +- * include/bits/valarray_array.h (__valarray_sum): Use first element +- to initialize accumulator instead of value-initializing it. +- * testsuite/26_numerics/valarray/87641.cc: New test. +- +-2018-10-15 Jonathan Wakely +- +- * testsuite/22_locale/numpunct/members/char/3.cc: Adjust test to +- account for change to glibc it_IT localedata (glibc bz#10797). +- +-2018-10-12 Jonathan Wakely +- +- Backport from mainline +- 2018-07-31 Jonathan Wakely +- +- PR libstdc++/86751 +- * include/bits/stl_pair.h (__pair_base): New class with deleted copy +- assignment operator. +- (pair): Derive from __pair_base. +- (pair::operator=3D): Remove deleted overload. +- * python/libstdcxx/v6/printers.py (StdPairPrinter): New pretty printer +- so that new base class isn't shown in GDB. +- * testsuite/20_util/pair/86751.cc: New test. +- * testsuite/20_util/pair/ref_assign.cc: New test. +- +-2018-10-12 Jonathan Wakely +- +- Backport from mainline +- 2018-09-03 Jonathan Wakely +- +- PR libstdc++/78595 +- * include/bits/stl_map.h (map::insert(_Pair&&)) +- (map::insert(const_iterator, _Pair&&)): Do emplace instead of insert. +- * include/bits/stl_multimap.h (multimap::insert(_Pair&&)) +- (multimap::insert(const_iterator, _Pair&&)): Likewise. +- * include/bits/unordered_map.h (unordered_map::insert(_Pair&&)) +- (unordered_map::insert(const_iterator, _Pair&&)) +- (unordered_multimap::insert(_Pair&&)) +- (unordered_multimap::insert(const_iterator, _Pair&&)): Likewise. +- * include/std/type_traits (__enable_if_t): Define for C++11. +- * testsuite/23_containers/map/modifiers/insert/78595.cc: New test. +- * testsuite/23_containers/multimap/modifiers/insert/78595.cc: New test. +- * testsuite/23_containers/unordered_map/modifiers/78595.cc: New test. +- * testsuite/23_containers/unordered_multimap/modifiers/78595.cc: New +- test. +- +-2018-10-12 Jonathan Wakely +- +- Backport from mainline +- 2018-08-30 Jonathan Wakely +- +- * include/ext/pointer.h (_Pointer_adapter): Define operators for +- pointer arithmetic using long long offsets. +- * testsuite/ext/ext_pointer/1.cc: Test pointer arithmetic using +- long long values. +- +-2018-10-12 Jonathan Wakely +- +- Backport from mainline +- 2018-08-23 Jonathan Wakely +- +- * testsuite/21_strings/basic_string/init-list.cc: +- Require cxx11-abi. +- * testsuite/experimental/polymorphic_allocator/pmr_typedefs_match.cc: +- Likewise. +- * testsuite/experimental/polymorphic_allocator/pmr_typedefs_string.cc: +- Likewise. +- +- Backport from mainline +- 2018-08-22 Jonathan Wakely +- +- PR libstdc++/87061 +- * include/experimental/regex [!_GLIBCXX_USE_CXX11_ABI] +- (experimental::pmr::match_results, experimental::pmr::cmatch) +- (experimental::pmr::smatch, experimental::pmr::wcmatch) +- (experimental::pmr::wsmatch): Do not declare for gcc4-compatible ABI, +- because COW strings don't support C++11 allocator model. +- * include/experimental/string [!_GLIBCXX_USE_CXX11_ABI] +- (experimental::pmr::basic_string, experimental::pmr::string) +- (experimental::pmr::u16string, experimental::pmr::u32string) +- (experimental::pmr::wstring): Likewise. +- +- Backport from mainline +- 2018-08-15 Jonathan Wakely +- +- * include/experimental/regex: Remove begin/end macros for namespace. +- * include/experimental/string: Likewise. +- * testsuite/experimental/polymorphic_allocator/pmr_typedefs_deque.cc: +- New test. +- * testsuite/experimental/polymorphic_allocator/ +- pmr_typedefs_forward_list.cc: New test. +- * testsuite/experimental/polymorphic_allocator/pmr_typedefs_list.cc: +- New test. +- * testsuite/experimental/polymorphic_allocator/pmr_typedefs_map.cc: +- New test. +- * testsuite/experimental/polymorphic_allocator/pmr_typedefs_match.cc: +- New test. +- * testsuite/experimental/polymorphic_allocator/ +- pmr_typedefs_multimap.cc: New test. +- * testsuite/experimental/polymorphic_allocator/ +- pmr_typedefs_multiset.cc: New test. +- * testsuite/experimental/polymorphic_allocator/pmr_typedefs_set.cc: +- New test. +- * testsuite/experimental/polymorphic_allocator/pmr_typedefs_string.cc: +- New test. +- * testsuite/experimental/polymorphic_allocator/ +- pmr_typedefs_unordered_map.cc: New test. +- * testsuite/experimental/polymorphic_allocator/ +- pmr_typedefs_unordered_multimap.cc: New test. +- * testsuite/experimental/polymorphic_allocator/ +- pmr_typedefs_unordered_multiset.cc: New test. +- * testsuite/experimental/polymorphic_allocator/ +- pmr_typedefs_unordered_set.cc: New test. +- * testsuite/experimental/polymorphic_allocator/pmr_typedefs_vector.cc: +- New test. +- +-2018-10-12 Jonathan Wakely +- +- Backport from mainline +- 2018-07-24 Jonathan Wakely +- +- PR libstdc++/70966 +- * include/experimental/memory_resource (__get_default_resource): Use +- placement new to create an object with dynamic storage duration. +- +- Backport from mainline +- 2018-06-20 Jonathan Wakely +- +- PR libstdc++/70966 +- * include/experimental/memory_resource (__resource_adaptor_imp): Add +- static assertions to enforce requirements on pointer types. +- (__resource_adaptor_imp::get_allocator()): Add noexcept. +- (new_delete_resource, null_memory_resource): Return address of an +- object with dynamic storage duration. +- (__null_memory_resource): Remove. +- * testsuite/experimental/memory_resource/70966.cc: New. +- +-2018-10-12 Jonathan Wakely +- +- PR libstdc++/77854 +- * doc/xml/manual/status_cxx1998.xml: Document size_type and +- difference_type for containers. +- * doc/html/*: Regenerate. +- +-2018-10-08 Joseph Myers +- +- Backport from mainline +- 2018-10-02 Joseph Myers +- +- * testsuite/lib/libstdc++.exp (libstdc++_init): Use +- -fno-show-column in default cxxflags. +- +-2018-10-08 Jonathan Wakely +- +- Backport from mainline +- 2018-10-08 Jonathan Wakely +- +- PR libstdc++/87538 +- * include/std/functional (_Not_fn::operator()): Check value of +- __is_nothrow_invocable as well. +- * testsuite/20_util/function_objects/not_fn/87538.cc: New test. +- * testsuite/experimental/functional/87538.cc: New test. +- +-2018-08-13 Jonathan Wakely +- +- Revert +- 2018-08-10 Sebastian Huber +- +- PR target/85904 +- * configure.ac: Define HAVE_ALIGNED_ALLOC if building for +- Newlib. +- * configure: Regenerate. +- +-2018-08-10 Sebastian Huber +- +- Backport from mainline +- 2018-08-10 Sebastian Huber +- +- PR target/85904 +- * configure.ac: Define HAVE_ALIGNED_ALLOC if building for +- Newlib. +- * configure: Regenerate. +- +-2018-08-08 Jonathan Wakely +- +- * libsupc++/new_opa.cc (aligned_alloc): Declare inside namespace to +- avoid clashing with an ::aligned_alloc function that was not detected +- by configure. +- +- * doc/xml/manual/using.xml: Remove empty table cell. +- * doc/html/*: Regenerate. +- +- * doc/xml/manual/using.xml: Add missing header to table and fix typo. +- Remove C++17 and C++2a headers not present on gcc-7-branch. +- * doc/html/*: Regenerate. +- +-2018-08-07 Jonathan Wakely +- +- Backport from mainline +- 2018-06-27 Jonathan Wakely +- +- PR libstdc++/86138 +- * include/bits/basic_string.tcc: [_GLIBCXX_EXTERN_TEMPLATE < 0] +- Declare explicit instantiations of COW empty reps and I/O functions. +- +- Backport from mainline +- 2018-05-08 Jonathan Wakely +- +- PR libstdc++/85672 +- * include/Makefile.am [!ENABLE_FLOAT128]: Change c++config.h entry +- to #undef _GLIBCXX_USE_FLOAT128 instead of defining it to zero. +- * include/Makefile.in: Regenerate. +- * include/bits/c++config (_GLIBCXX_USE_FLOAT128): Move definition +- within conditional block. +- +- Backport from mainline +- 2018-05-01 Tulio Magno Quites Machado Filho +- +- PR libstdc++/84654 +- * acinclude.m4: Set ENABLE_FLOAT128 instead of _GLIBCXX_USE_FLOAT128. +- * config.h.in: Remove references to _GLIBCXX_USE_FLOAT128. +- * configure: Regenerate. +- * include/Makefile.am: Replace the value of _GLIBCXX_USE_FLOAT128 +- based on ENABLE_FLOAT128. +- * include/Makefile.in: Regenerate. +- * include/bits/c++config: Define _GLIBCXX_USE_FLOAT128. +- [!defined(__FLOAT128__) && !defined(__SIZEOF_FLOAT128__)]: Undefine +- _GLIBCXX_USE_FLOAT128. +- +- Backport from mainline +- 2017-06-17 Jonathan Wakely +- +- PR libstdc++/80893 +- * testsuite/23_containers/vector/bool/80893.cc: Add { target c++11 }. +- +- Backport from mainline +- 2017-05-31 Jonathan Wakely +- +- PR libstdc++/80893 +- * include/bits/stl_bvector.h (vector::_M_initialize): Avoid +- null pointer dereference when size is zero. +- * testsuite/23_containers/vector/bool/80893.cc: New. +- * testsuite/util/testsuite_allocator.h (PointerBase::PointerBase): +- Add non-explicit constructor from nullptr. +- (PointerBase::derived() const): Add const-qualified overload. +- +- Backport from mainline +- 2017-12-14 Jonathan Wakely +- +- PR libstdc++/68519 +- * include/std/condition_variable (condition_variable::wait_for): +- Convert duration to native clock's duration before addition. +- * testsuite/30_threads/condition_variable/members/68519.cc: New test. +- +- Backport from mainline +- 2018-06-25 Jonathan Wakely +- +- PR libstdc++/86292 +- * include/bits/stl_vector.h (vector::_M_range_initialize): +- Add try-catch block. +- * testsuite/23_containers/vector/cons/86292.cc: New. +- +- Backport from mainline +- 2018-07-31 Jonathan Wakely +- +- * doc/xml/manual/test.xml: Improve documentation on writing tests for +- newer standards. +- * doc/xml/manual/using.xml: Document all headers for C++11 and later. +- * doc/html/*: Regenerate. +- +- Backport from mainline +- 2018-08-03 Jonathan Wakely +- +- * src/c++11/system_error.cc +- (system_error_category::default_error_condition): Add workaround for +- ENOTEMPTY and EEXIST having the same value on AIX. +- * testsuite/19_diagnostics/error_category/system_category.cc: Add +- extra testcases for EDOM, EILSEQ, ERANGE, EEXIST and ENOTEMPTY. +- +- Backport from mainline +- 2018-08-01 Jonathan Wakely +- +- PR libstdc++/60555 +- * src/c++11/system_error.cc +- (system_error_category::default_error_condition): New override to +- check for POSIX errno values. +- * testsuite/19_diagnostics/error_category/generic_category.cc: New +- * testsuite/19_diagnostics/error_category/system_category.cc: New +- test. +- +- Backport from mainline +- 2018-08-07 Jonathan Wakely +- +- PR libstdc++/86861 +- * libsupc++/new_opa.cc [_GLIBCXX_HAVE_MEMALIGN] (aligned_alloc): +- Replace macro with inline function. +- [__sun]: Increase alignment to meet memalign precondition. +- [!HAVE__ALIGNED_MALLOC && !HAVE_POSIX_MEMALIGN && !HAVE_MEMALIGN] +- (aligned_alloc): Move check for valid alignment to operator new. +- Remove redundant check for non-zero size, it's enforced by the caller. +- (operator new): Move check for valid alignment here. Use +- __builtin_expect on check for zero size. +- +- Backport from mainline +- 2018-07-30 Jonathan Wakely +- +- * libsupc++/new_opa.cc (operator new(size_t, align_val_t)): Add +- workaround for aligned_alloc bug on AIX. +- * testsuite/18_support/new_aligned.cc: New test. +- +- Backport from mainline +- 2018-07-30 Jonathan Wakely +- +- PR libstdc++/86734 +- * include/bits/stl_iterator.h (reverse_iterator::operator->): Use +- addressof (LWG 2188). +- * testsuite/24_iterators/reverse_iterator/dr2188.cc: New test. +- +- Backport from mainline +- 2018-05-19 Jonathan Wakely +- +- * src/c++11/codecvt.cc (__codecvt_utf8_base::do_in) +- [__SIZEOF_WCHAR_T__=3D=3D2 && __BYTE_ORDER__!=3D__ORDER_BIG_ENDIAN__]: S= et +- little_endian element in bitmask. +- * testsuite/22_locale/codecvt/codecvt_utf8/69703.cc: Run all tests. +- * testsuite/22_locale/codecvt/codecvt_utf8/wchar_t/1.cc: New. +- +-2018-07-05 Fran=C3=A7ois Dumont +- +- Backport from mainline +- 2018-07-04 Fran=C3=A7ois Dumont +- +- PR libstdc++/86272 +- * include/debug/string +- (__gnu_debug::basic_string<>::insert<_Ite>(const_iterator, _Ite, _Ite)): +- Use __glibcxx_check_insert_range. +- +-2018-07-04 Jonathan Wakely +- +- Backport from mainline +- 2018-03-09 Jonathan Wakely +- +- src/filesystem/ops.cc (create_dir): Pass error_code to is_directory. +- +- Backport from mainline +- 2018-06-18 Jonathan Wakely +- +- LWG 3050 Fix cv-qualification of convertibility constraints +- * include/std/chrono (duration, operator*, operator/, operator%): Use +- const-qualified type as source type in is_convertible constraints. +- * testsuite/20_util/duration/arithmetic/dr3050.cc: New. +- * testsuite/20_util/duration/cons/dr3050.cc: New. +- * testsuite/20_util/duration/literals/range.cc: Rename to... +- * testsuite/20_util/duration/literals/range_neg.cc: Here. Adjust +- dg-error lineno. +- +- Backport from mainline +- 2018-06-13 Jonathan Wakely +- +- PR libstdc++/86127 +- * include/bits/forward_list.h (_Fwd_list_base::_Tp_alloc_type): Remove +- unused typedef. +- (_Fwd_list_base::_M_create_node, _Fwd_list_base::_M_erase_after): +- Use node allocator to create and destroy elements. +- (forward_list::_Tp_alloc_type): Remove unused typedef. +- (forward_list::_Alloc_traits): Use allocator_traits instead of +- __gnu_cxx::__alloc_traits. +- * include/bits/forward_list.tcc (_Fwd_list_base::_M_erase_after): +- Use node allocator to create and destroy elements. +- +- Backport from mainline +- 2018-05-29 Jonathan Wakely +- +- * include/std/variant (__erased_dtor): Qualify call to __get. +- +- Backport from mainline +- 2018-05-15 Jonathan Wakely +- +- * include/std/variant (__gen_vtable_impl::__visit_invoke): Qualify +- __invoke to prevent ADL. +- +- Backport from mainline +- 2018-04-05 Jonathan Wakely +- +- * include/std/variant (_VARIANT_RELATION_FUNCTION_TEMPLATE): Qualify +- __get calls to avoid ADL and avoid ambiguity due to Clang bug. +- +- Backport from mainline +- 2018-03-26 Jonathan Wakely +- +- * include/std/variant (__get): Qualify calls to avoid ADL. +- (__select_index): Adjust whitespace. +- (variant): Add using-declaration to workaround Clang bug. +- +- Backport from mainline +- 2018-05-24 Maya Rashish +- +- PR target/85904 +- * crossconfig.m4: Test for aligned_alloc on netbsd. +- * configure: Regenerate. +- +- Backport from mainline +- 2018-05-18 Jonathan Wakely +- +- PR libstdc++/85098 +- * include/bits/regex.h [__cplusplus < 201703L] (basic_regex::icase) +- (basic_regex::nosubs, basic_regex::optimize, basic_regex::collate) +- (basic_regex::ECMAScript, basic_regex::basic, basic_regex::extended) +- (basic_regex::awk, basic_regex::grep, basic_regex::egrep): Add +- definitions. +- * include/bits/regex_automaton.h (_NFA::_M_insert_state): Adjust +- whitespace. +- * testsuite/28_regex/basic_regex/85098.cc: New +- +- Backport from mainline +- 2018-05-07 Jonathan Wakely +- +- PR libstdc++/85671 +- * include/experimental/bits/fs_path.h (operator/): Likewise. +- +- Backport from mainline +- 2018-06-14 Daniel Trebbien +- Jonathan Wakely +- +- PR libstdc++/83982 +- * include/bits/vector.tcc (vector::_M_default_append(size_type)): +- Default-construct new elements before moving existing ones. +- * testsuite/23_containers/vector/capacity/resize/strong_guarantee.cc: +- New. +- +- Backport from mainline +- 2018-05-03 Jonathan Wakely +- +- PR libstdc++/84087 LWG DR 2268 basic_string default arguments +- * include/bits/basic_string.h [_GLIBCXX_USE_CXX11_ABI=3D1] +- (append(const basic_string&, size_type, size_type) +- (assign(const basic_string&, size_type, size_type) +- (insert(size_type, const basic_string&, size_type, size_type) +- (replace(size_type,size_type,const basic_string&,size_type,size_type) +- (compare(size_type,size_type,constbasic_string&,size_type,size_type)): +- Add default arguments (LWG 2268). +- [_GLIBCXX_USE_CXX11_ABI=3D0] +- (append(const basic_string&, size_type, size_type) +- (assign(const basic_string&, size_type, size_type) +- (insert(size_type, const basic_string&, size_type, size_type) +- (replace(size_type,size_type,const basic_string&,size_type,size_type) +- (compare(size_type,size_type,constbasic_string&,size_type,size_type)): +- Likewise. +- * testsuite/21_strings/basic_string/dr2268.cc: New test. +- +-2018-06-22 Jakub Jelinek +- +- Backported from mainline +- 2018-04-18 David Malcolm +- +- PR jit/85384 +- * configure: Regenerate. +- +-2018-06-22 Jonathan Wakely +- +- Backport from mainline +- 2018-06-22 Jonathan Wakely +- +- PR libstdc++/86138 +- * include/bits/basic_string.tcc: +- [__cplusplus > 201402 && !_GLIBCXX_USE_CXX11_ABI] +- (basic_string::_Rep::_S_empty_rep_storage) +- (basic_string::_Rep::_S_empty_rep_storage): Add explicit +- instantiation declarations. +- [__cplusplus > 201402] (operator>>, operator<<, getline): Re-enable +- explicit instantiation declarations. +- * testsuite/21_strings/basic_string/cons/char/86138.cc: New. +- * testsuite/21_strings/basic_string/cons/wchar_t/86138.cc: New. +- +-2018-06-21 Jonathan Wakely +- +- * config/abi/post/x86_64-linux-gnu/baseline_symbols.txt: Update. +- +-2018-06-19 Jonathan Wakely +- +- * include/std/utility: Remove unused header. +- +-2018-06-15 Jonathan Wakely +- +- PR libstdc++/86169 +- * include/bits/basic_string.h [!_GLIBCXX_USE_CXX11_ABI] +- (basic_string::data()): Unshare string. +- * testsuite/21_strings/basic_string/operations/data/char/86169.cc: +- New. +- +-2018-06-15 Jonathan Wakely +- +- * include/bits/char_traits.h (__cpp_lib_constexpr_char_traits): Only +- define for C++17 and above. +- +-2018-05-17 Jonathan Wakely +- +- PR libstdc++/85812 +- * libsupc++/cxxabi_init_exception.h (__cxa_free_exception): Declare. +- * libsupc++/exception_ptr.h (make_exception_ptr) [__cpp_exceptions]: +- Refactor to separate non-throwing and throwing implementations. +- [__cpp_rtti && !_GLIBCXX_HAVE_CDTOR_CALLABI]: Deallocate the memory +- if constructing the object throws. +- +-2018-05-14 Jonathan Wakely +- +- PR libstdc++/67554 +- * include/bits/valarray_array.h (_Array_copy_ctor<_Tp, true>) +- (_Array_copier<_Tp, true>): Do not pass null pointers to memcpy. +- +- PR libstdc++/82966 +- * include/bits/node_handle.h (_Node_handle_common::_M_swap): Use value +- instead of type. +- * testsuite/23_containers/set/modifiers/node_swap.cc: New. +- +-2018-05-10 Jonathan Wakely +- +- * doc/xml/faq.xml: Link to C++17 status. Add note to outdated answer. +- * doc/xml/manual/debug_mode.xml: Add array and forward_list to list +- of C++11 containers with Debug Mode support. +- * doc/xml/manual/using.xml: Document Dual ABI for ios_base::failure. +- * doc/html/*: Regenerate. +- +-2018-05-07 Edward Smith-Rowland <3dw4rd@verizon.net> +- Jonathan Wakely +- +- Backport from mainline +- 2018-05-07 Edward Smith-Rowland <3dw4rd@verizon.net> +- +- PR libstdc++/80506 +- * include/bits/random.tcc (gamma_distribution::operator()): Fix magic +- number used in loop condition. +- (gamma_distribution::__generate_impl()): Ditto. +- +-2018-05-03 Jonathan Wakely +- +- PR libstdc++/84769 +- * include/std/variant (visit): Qualify std::get call. +- +- PR libstdc++/85632 use uintmax_t for arithmetic +- * src/filesystem/ops.cc (experimental::filesystem::space): Perform +- arithmetic in result type. +- * testsuite/experimental/filesystem/operations/space.cc: New. +- +-2018-04-30 Edward Smith-Rowland <3dw4rd@verizon.net> +- +- PR libstdc++/pr66689 - comp_ellint_3 and ellint_3 return garbage values +- * include/tr1/ell_integral.tcc: Correct the nu sign convention +- in ellint_3 and comp_ellint_3. +- * testsuite/tr1/5_numerical_facilities/special_functions/ +- 06_comp_ellint_3/check_value.cc: Regen with correct values. +- * testsuite/tr1/5_numerical_facilities/special_functions/ +- 14_ellint_3/check_value.cc: Ditto. +- * testsuite/special_functions/06_comp_ellint_3/check_value.cc: Ditto. +- * testsuite/special_functions/13_ellint_3/check_value.cc: Ditto. +- * testsuite/special_functions/06_comp_ellint_3/pr66689.cc: New. +- * testsuite/special_functions/13_ellint_3/pr66689.cc: New. +- * testsuite/tr1/5_numerical_facilities/special_functions/ +- 06_comp_ellint_3/pr66689.cc: New. +- * testsuite/tr1/5_numerical_facilities/special_functions/ +- 14_ellint_3/pr66689.cc: New. +- +-2018-04-30 Edward Smith-Rowland <3dw4rd@verizon.net> +- +- PR libstdc++/68397 std::tr1::expint fails ... long double arguments. +- * include/tr1/exp_integral.tcc: Increase iteration limits. +- * testsuite/tr1/5_numerical_facilities/special_functions/15_expint/ +- pr68397.cc: New test. +- * testsuite/special_functions/14_expint/pr68397.cc: New test. +- +-2018-04-18 Jonathan Wakely +- Jakub Jelinek +- +- PR libstdc++/85442 +- * src/c++11/Makefile.am: Don't generate debuginfo again for +- cxx11-ios_failure-lt.s and cxx11-ios_failure.s files. +- * src/c++11/Makefile.in: Regenerate. +- +-2018-04-13 Jonathan Wakely +- +- * src/c++11/Makefile.am: Fix sed command. +- * src/c++11/Makefile.in: Regenerate. +- +- * src/c++11/Makefile.am: Rewrite sed rule to be less fragile and to +- handle mangled names starting with double underscores on darwin. +- * src/c++11/Makefile.in: Regenerate. +- +-2018-04-12 Jonathan Wakely +- +- * src/c++11/Makefile.am: Fix comment. +- * src/c++11/Makefile.in: Regenerate. +- * src/c++11/cxx11-ios_failure.cc: Fix comment. +- * src/c++98/ios_failure.cc: Likewise. +- +- Backport from mainline +- 2018-04-10 Jonathan Wakely +- +- PR libstdc++/85222 +- * src/c++11/Makefile.am [ENABLE_DUAL_ABI]: Add special rules for +- cxx11-ios_failure.cc to rewrite type info for __ios_failure. +- * src/c++11/Makefile.in: Regenerate. +- * src/c++11/cxx11-ios_failure.cc (__ios_failure, __iosfail_type_info): +- New types. +- [_GLIBCXX_USE_DUAL_ABI] (__throw_ios_failure): Define here. +- * src/c++11/ios.cc (__throw_ios_failure): Remove definition. +- (_GLIBCXX_USE_CXX11_ABI): Don't define here. +- * src/c++98/ios_failure.cc (__construct_ios_failure) +- (__destroy_ios_failure, is_ios_failure_handler): New functions. +- [!_GLIBCXX_USE_DUAL_ABI] (__throw_ios_failure): Define here. +- * testsuite/27_io/ios_base/failure/dual_abi.cc: New. +- * testsuite/27_io/basic_ios/copyfmt/char/1.cc: Revert changes to +- handler types, to always catch std::ios_base::failure. +- * testsuite/27_io/basic_ios/exceptions/char/1.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_arithmetic/char/ +- exceptions_failbit.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_arithmetic/wchar_t/ +- exceptions_failbit.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_other/char/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_other/wchar_t/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/basic_istream/sentry/char/12297.cc: Likewise. +- * testsuite/27_io/basic_istream/sentry/wchar_t/12297.cc: Likewise. +- * testsuite/27_io/basic_ostream/inserters_other/char/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/basic_ostream/inserters_other/wchar_t/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/ios_base/storage/2.cc: Likewise. +- +-2018-03-22 Rainer Orth +- +- PR libstdc++/77691 +- * testsuite/experimental/memory_resource/resource_adaptor.cc: +- xfail execution on 32-bit Solaris/x86. +- +-2018-03-13 Jonathan Wakely +- +- Backport from mainline +- 2018-03-09 Jonathan Wakely +- +- PR libstdc++/84769 +- * include/std/variant (get<_Tp, _Types...>, get_if<_Tp, _Types...>): +- Qualify calls to get<_Np, Types...> and get_if<_Np, _Types...>. +- +-2018-03-12 Jonathan Wakely +- +- PR libstdc++/84773 +- PR libstdc++/83662 +- * crossconfig.m4: Check for aligned_alloc etc. on freebsd and mingw32. +- * configure: Regenerate. +- * include/c_global/cstdlib [_GLIBCXX_HAVE_ALIGNED_ALLOC] +- (aligned_alloc): Add using-declaration. +- * testsuite/18_support/aligned_alloc/aligned_alloc.cc: New test. +- +-2018-03-02 Jonathan Wakely +- +- Backport from mainline +- 2018-03-02 Jonathan Wakely +- +- PR libstdc++/84671 +- * include/bits/parse_numbers.h (_Number_help): Add partial +- specialization to handle digit separators. Adjust partial +- specialization for recursion temrination to require _Pow =3D=3D 1ULL. +- * testsuite/20_util/duration/literals/84671.cc: New +- +-2018-02-26 Jonathan Wakely +- +- Backport from mainline +- 2018-02-23 Jonathan Wakely +- +- PR libstdc++/84532 +- * include/std/thread (thread::__make_invoker): Construct tuple +- directly instead of using make_tuple. +- * testsuite/30_threads/async/84532.cc: New. +- * testsuite/30_threads/thread/84532.cc: New. +- +-2018-02-19 Jonathan Wakely +- +- Backport from mainline +- 2018-02-15 Jonathan Wakely +- +- PR libstdc++/81797 +- * configure.ac (INCLUDE_DIR_NOTPARALLEL): Define. +- * configure: Regenerate. +- * include/Makefile.am (INCLUDE_DIR_NOTPARALLEL): Add .NOTPARALLEL when +- defined. +- * include/Makefile.in: Regenerate. +- +-2018-01-29 Jonathan Wakely +- +- PR libstdc++/83833 +- * testsuite/26_numerics/random/chi_squared_distribution/83833.cc: +- Add -ffloat-store to options for m68k and ia32. +- +- PR libstdc++/83658 +- * include/std/any (any::__do_emplace): Only set _M_manager after +- constructing the contained object. +- * testsuite/20_util/any/misc/any_cast_neg.cc: Adjust dg-error line. +- * testsuite/20_util/any/modifiers/83658.cc: New test. +- +- Backport from mainline +- 2018-01-15 Jonathan Wakely +- +- PR libstdc++/83833 +- * include/bits/random.h (chi_squared_distribution::param): Update +- gamma distribution parameter. +- * testsuite/26_numerics/random/chi_squared_distribution/83833.cc: New +- test. +- +-2018-01-25 Jonathan Wakely +- +- PR libstdc++/81076 +- * include/c_global/cstddef (__byte_operand): Define primary template. +- * testsuite/18_support/byte/81076.cc: New test. +- +- Backport from mainline +- 2018-01-15 Jonathan Wakely +- +- PR libstdc++/83830 +- * include/std/type_traits (has_unique_object_representations_v): Add +- variable template. +- * testsuite/20_util/has_unique_object_representations/value.cc: Check +- variable template. +- +-2018-01-25 Release Manager +- +- * GCC 7.3.0 released. +- +-2018-01-19 Jonathan Wakely +- +- Backport from mainline +- 2018-01-16 Jonathan Wakely +- +- PR libstdc++/83834 +- * config/abi/pre/gnu.ver (GLIBCXX_3.4): Replace std::c[a-g]* wildcard +- pattern with exact match for std::cerr. +- +-2018-01-18 Jonathan Wakely +- +- Backport from mainline +- 2017-10-23 Jonathan Wakely +- +- * doc/xml/manual/intro.xml: Include new section. +- * doc/xml/manual/status_cxxis29124.xml: New section on IS 29124 +- status. +- * doc/html/*: Regenerate. +- +- Backport from mainline +- 2017-10-19 Jonathan Wakely +- +- * doc/xml/manual/status_cxx2017.xml: Update references to C++17 +- section numbers. +- +-2018-01-16 Eric Botcazou +- +- * testsuite/17_intro/names.cc: Undefine 'y' on SPARC/Linux. +- +-2018-01-13 Jonathan Wakely +- +- * python/libstdcxx/v6/printers.py (register_type_printers): Remove +- printer for experimental::any. Fix printers for experimental::optional +- and experimental::basic_string_view. +- +- Backport from mainline +- 2018-01-05 Jonathan Wakely +- +- PR libstdc++/83626 +- * src/filesystem/ops.cc (remove(const path&, error_code&)): Remove +- unnecessary symlink_status call. +- (remove_all(const path&, error_code&)): Use filesystem::remove. +- +-2018-01-05 Jonathan Wakely +- +- Backport from mainline +- 2017-10-19 Jonathan Wakely +- +- * testsuite/experimental/filesystem/iterators/ +- recursive_directory_iterator.cc: Ensure that error_code arguments are +- cleared when required. +- * testsuite/experimental/filesystem/operations/create_directory.cc: +- Remove redundant check. +- * testsuite/experimental/filesystem/operations/temp_directory_path.cc: +- Ensure that error_code argument is cleared when required. +- +- Backport from mainline +- 2017-12-27 Jonathan Wakely +- +- PR libstdc++/83600 +- * include/bits/regex.h (match_results::end()): Return valid iterator +- when not ready. +- * testsuite/28_regex/match_results/ctors/char/default.cc: Check that +- unready objects are empty and have equal begin and end iterators. +- * testsuite/28_regex/match_results/ctors/wchar_t/default.cc: Likewise. +- +- Backport from mainline +- 2017-12-27 Jonathan Wakely +- +- PR libstdc++/83598 +- * include/bits/regex.h (basic_regex): Don't modify flags passed to +- constructors. +- * testsuite/28_regex/basic_regex/ctors/83598.cc: New test. +- +- Backport from mainline +- 2017-12-14 Jonathan Wakely +- +- PR libstdc++/83279 +- * src/filesystem/std-ops.cc (do_copy_file): Handle sendfile not +- copying entire file. +- +- Backport from mainline +- 2018-01-04 Jonathan Wakely +- +- * include/experimental/fs_ops.h (exists(const path&, error_code&))): +- Only check status_known once. +- +- Backport from mainline +- 2018-01-05 Jonathan Wakely +- +- PR libstdc++/83626 +- * src/filesystem/ops.cc (remove(const path&, error_code&)): Do not +- report an error for ENOENT. +- (remove_all(const path&)): Fix type of result variable. +- (remove_all(const path&, error_code&)): Use non-throwing increment +- for directory iterator. Call POSIX remove directly to avoid redundant +- calls to symlink_status. Do not report errors for ENOENT. +- * testsuite/experimental/filesystem/operations/remove_all.cc: Test +- throwing overload. +- +- Backport from mainline +- 2018-01-04 Jonathan Wakely +- +- PR libstdc++/83626 +- * src/filesystem/ops.cc (remove(const path&, error_code&))): Remove +- redundant call to ec.clear(). +- (remove_all(const path&, error_code&))): Do not return an error for +- non-existent paths. +- * testsuite/experimental/filesystem/operations/remove.cc: New test. +- * testsuite/experimental/filesystem/operations/remove_all.cc: Fix +- expected results for non-existent paths. +- +- Backport from mainline +- 2017-10-25 Jonathan Wakely +- +- PR libstdc++/79283 +- * src/filesystem/ops.cc (read_symlink): Handle st_size being zero. +- +-2018-01-04 Ville Voutilainen +- +- Backport from mainline +- 2018-01-03 Ville Voutilainen +- +- Protect optional's deduction guide with the feature macro +- * include/std/optional: Use the feature macro. +- +-2017-12-28 Fran=C3=A7ois Dumont +- +- Backport from mainline +- 2017-12-20 Fran=C3=A7ois Dumont +- +- PR libstdc++/82522 +- * include/debug/map.h (map::insert(value_type&&)) +- (map::insert(const_iterator, value_type&&)): Add overload for rvalues. +- * include/debug/multimap.h (multimap::insert(value_type&&)) +- (multimap::insert(const_iterator, value_type&&)): Likewise. +- * include/debug/unordered_map (unordered_map::insert(value_type&&)) +- (unordered_map::insert(const_iterator, value_type&&)) +- (unordered_multimap::insert(value_type&&)) +- (unordered_multimap::insert(const_iterator, value_type&&)): Likewise. +- * testsuite/23_containers/map/modifiers/insert/dr2354.cc (test02): New. +- * testsuite/23_containers/multimap/modifiers/insert/dr2354.cc (test02): +- New. +- * testsuite/23_containers/unordered_map/insert/dr2354.cc (test02): New. +- * testsuite/23_containers/unordered_multimap/insert/dr2354.cc (test02): +- New. +- +-2017-12-14 Jonathan Wakely +- +- PR libstdc++/83427 +- * include/bits/refwrap.h (_Weak_result_type_impl) +- (_Reference_wrapper_base): Deduce noexcept for function types. +- * testsuite/20_util/bind/83427.cc: New test. +- * testsuite/20_util/reference_wrapper/83427.cc: New test. +- +- PR libstdc++/59568 +- * include/std/complex (operator>>): Only use putback if a character +- was successfully extracted and only set the value if a number was +- successfully extracted. +- * testsuite/26_numerics/complex/inserters_extractors/char/59568.cc: +- New test. +- +-2017-12-12 Jonathan Wakely +- +- PR libstdc++/83395 +- * include/std/type_traits (__is_invocable_impl): Remove partial +- specialization for INVOKE and restore is_void check in +- primary template. +- (__is_nt_invocable_impl): Likewise. +- * testsuite/20_util/is_invocable/83395.cc: New test. +- * testsuite/20_util/is_nothrow_invocable/83395.cc: New test. +- +-2017-12-01 Jonathan Wakely +- +- Backport from mainline +- 2017-10-13 Jonathan Wakely +- +- PR libstdc++/82522 +- * doc/xml/manual/intro.xml: Document LWG 2354 changes. +- * include/bits/stl_map.h (map::insert(value_type&&)) +- (map::insert(const_iterator, value_type&&)): Add overload for rvalues. +- * include/bits/stl_multimap.h (multimap::insert(value_type&&)) +- (multimap::insert(const_iterator, value_type&&)): Likewise. +- * include/bits/unordered_map.h (unordered_map::insert(value_type&&)) +- (unordered_map::insert(const_iterator, value_type&&)) +- (unordered_multimap::insert(value_type&&)) +- (unordered_multimap::insert(const_iterator, value_type&&)): Likewise. +- * testsuite/23_containers/map/modifiers/insert/dr2354.cc: New test. +- * testsuite/23_containers/multimap/modifiers/insert/dr2354.cc: New +- test. +- * testsuite/23_containers/unordered_map/insert/dr2354.cc: New test. +- * testsuite/23_containers/unordered_multimap/insert/dr2354.cc: New +- test. +- +- Backport from mainline +- 2017-11-23 Jonathan Wakely +- +- PR libstdc++/83134 +- * include/std/type_traits (__not_): Explicitly convert to bool. +- * testsuite/20_util/declval/requirements/1_neg.cc: Adjust dg-error. +- * testsuite/20_util/logical_traits/83134.cc: New test. +- * testsuite/20_util/make_signed/requirements/typedefs_neg.cc: Adjust +- dg-error. +- * testsuite/20_util/make_unsigned/requirements/typedefs_neg.cc: +- Likewise. +- +- Backport from mainline +- 2017-12-01 Jonathan Wakely +- +- * include/std/type_traits (integral_constant): Make member functions +- noexcept (LWG 2346). +- * include/std/utility (integer_sequence): Likewise. +- +- Backport from mainline +- 2017-11-16 Jonathan Wakely +- +- * include/std/future (shared_future): Add noexcept to copy constructor +- and copy-assignment operator (LWG 2799). +- +- Backport from mainline +- 2017-11-15 Jonathan Wakely +- +- * include/bits/range_access.h (size, empty, data): Add conditional +- noexcept to generic overloads. +- +- Backport from mainline +- 2017-10-24 Jonathan Wakely +- +- PR libstdc++/82685 +- * include/experimental/string_view (operator""sv): Add noexcept. +- * include/std/string_view (operator""sv): Likewise. +- +- Backport from mainline +- 2017-11-30 Jonathan Wakely +- +- PR libstdc++/83226 +- * include/bits/node_handle.h (_Node_handle::__pointer): Avoid forming +- pointer-to-reference types. +- * testsuite/23_containers/map/modifiers/insert/83226.cc: New test. +- +- Backport from mainline +- 2017-11-14 Jonathan Wakely +- +- * include/bits/locale_conv.h (wbuffer_convert::_M_conv_get): Fix typo. +- * testsuite/22_locale/conversions/buffer/3.cc: New test. +- +- Backport from mainline +- 2017-11-03 Jonathan Wakely +- +- * include/bits/node_handle.h (_Node_insert_return::get): Remove, as +- per P0508R0. +- +-2017-10-25 Jonathan Wakely +- +- * doc/xml/manual/status_cxx1998.xml: Correct statement about +- what the doc covers. +- * doc/xml/manual/status_cxx2011.xml: Likewise. +- * doc/xml/manual/status_cxx2014.xml: Likewise. +- * doc/xml/manual/status_cxx2017.xml: Update C++17 status, and +- information on feature-test macros. +- * doc/xml/manual/status_cxxtr1.xml: Correct statement about what +- the doc covers. +- * doc/xml/manual/status_cxxtr24733.xml: Likewise. +- * doc/html/*: Regenerate. +- +-2017-10-23 Jonathan Wakely +- +- Backport from mainline +- 2017-07-18 Jonathan Wakely +- +- PR libstdc++/81395 +- * include/bits/fstream.tcc (basic_filebuf::xsgetn): Don't set buffer +- pointers for write mode after reading. +- * testsuite/27_io/basic_filebuf/sgetn/char/81395.cc: New. +- +-2017-10-21 Jonathan Wakely +- +- * testsuite/experimental/filesystem/path/itr/traversal.cc: Do not +- increment past-the-end iterators. +- +-2017-10-20 Jonathan Wakely +- +- * include/std/chrono (__cpp_lib_chrono): Update macro value to +- indicate support for P0505R0. +- * testsuite/20_util/duration/arithmetic/constexpr_c++17.cc: Check +- for updated macro. +- +- * include/c_global/cstddef: Define __cpp_lib_byte feature-test macro. +- * testsuite/18_support/byte/requirements.cc: Check macro. +- +- Backport from mainline +- 2017-10-13 Jonathan Wakely +- +- PR libstdc++/82481 +- * include/std/mutex (call_once): Suppress clang-tidy warnings about +- dangling references. +- +- Backport from mainline +- 2017-09-12 Jonathan Wakely +- +- PR libstdc++/79433 +- * doc/xml/manual/status_cxx2017.xml: Update feature-test macros. +- * doc/html/*: Regenerate. +- * include/Makefile.am: Remove . +- * include/Makefile.in: Regenerate. +- * include/bits/c++17_warning.h: Remove. +- * include/bits/string_view.tcc: Do not include +- for pre-C++17 modes. +- * include/std/any: Likewise. +- (__cpp_lib_any): Define. +- * include/std/mutex (__cpp_lib_scoped_lock): Adjust value as per new +- SD-6 draft. +- * include/std/numeric (__cpp_lib_gcd_lcm): Define as per new SD-6 +- draft. +- * include/std/optional: Do not include . +- (__cpp_lib_optional): Define. +- * include/std/shared_mutex: Do not include . +- * include/std/string_view: Do not include . +- (__cpp_lib_string_view): Define. +- * include/std/variant: Do not include . +- (__cpp_lib_variant): Define. +- * testsuite/20_util/optional/cons/value_neg.cc: Adjust dg-error line +- numbers. +- * testsuite/26_numerics/gcd/1.cc: Test for __cpp_lib_gcd_lcm. +- * testsuite/26_numerics/gcd/gcd_neg.cc: Adjust dg-error line +- numbers. +- * testsuite/26_numerics/lcm/1.cc: Test for __cpp_lib_gcd_lcm. +- * testsuite/26_numerics/lcm/lcm_neg.cc: Adjust dg-error line +- numbers. +- * testsuite/30_threads/scoped_lock/requirements/typedefs.cc: Adjust +- expected value of __cpp_lib_scoped_lock. +- +- Backport from mainline +- 2017-10-19 Jonathan Wakely +- +- * include/experimental/bits/fs_path.h (path::iterator++(int)) +- (path::iterator--(int)): Fix for paths with only one component. +- * testsuite/experimental/filesystem/path/itr/traversal.cc: Test +- post-increment and post-decrement. +- +-2017-09-21 Jonathan Wakely +- +- * testsuite/25_algorithms/clamp/1.cc: Fix order of arguments and +- expected results when using predicate defining reverse order. +- * testsuite/25_algorithms/clamp/constexpr.cc: Likewise. +- +-2017-09-20 Jonathan Wakely +- +- Backport from mainline +- 2017-06-14 Jonathan Wakely +- +- * doc/xml/manual/test.xml: Correct instructions on running tests. +- * testsuite/27_io/basic_ios/copyfmt/char/1.cc: Adjust to pass when +- -D_GLIBCXX_USE_CXX11_ABI=3D0 added to RUNTESTFLAGS. +- * testsuite/27_io/basic_ios/exceptions/char/1.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_arithmetic/char/ +- exceptions_failbit.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_arithmetic/wchar_t/ +- exceptions_failbit.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_other/char/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_other/wchar_t/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/basic_istream/sentry/char/12297.cc: Likewise. +- * testsuite/27_io/basic_istream/sentry/wchar_t/12297.cc: Likewise. +- * testsuite/27_io/basic_ostream/inserters_other/char/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/basic_ostream/inserters_other/wchar_t/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/ios_base/storage/2.cc: Likewise. +- +- PR libstdc++/79162 +- * include/bits/basic_string.h [!_GLIBCXX_USE_CXX11_ABI] +- (basic_string::_If_sv): Remove from the overload set when the +- argument is derived from basic_string. +- +- PR libstdc++/79162 +- * include/bits/basic_string.h (basic_string::_If_sv): Remove from the +- overload set when the argument is derived from basic_string. +- * testsuite/21_strings/basic_string/cons/char/moveable2_c++17.cc: New +- test. +- * testsuite/21_strings/basic_string/cons/wchar_t/moveable2_c++17.cc: +- New test. +- +- * testsuite/24_iterators/range_access_cpp17.cc: Fix order of dg-do +- and dg-options directives. Fix invalid test. +- +- Backport from mainline +- 2017-09-20 Jonathan Wakely +- +- PR libstdc++/82262 +- * include/std/optional (__optional_hash_call_base): Add template +- parameter for remove_const_t<_Tp> and use it consistently. +- * testsuite/20_util/optional/hash.cc: Test optional. +- +- Backport from mainline +- 2017-09-19 Jonathan Wakely +- +- PR libstdc++/82254 +- * include/std/type_traits (__is_invocable): Add partial specialization +- for INVOKE case and remove is_void check from partial +- specialization for INVOKE case. +- (__is_nt_invocable_impl): New helper for is_nothrow_invocable_r. +- (is_nothrow_invocable_r): Use __is_nt_invocable_impl. +- * testsuite/20_util/is_nothrow_invocable/value.cc: Add tests for +- conversions that can throw or fail to convert. Use static assert +- strings to explain negative results. +- * testsuite/20_util/is_nothrow_invocable/value_ext.cc: Use +- is_nothrow_constructible in is_nt_invocable_conv. +- +-2017-09-13 Jonathan Wakely +- +- Backport from mainline +- 2017-09-04 Daniel Kruegler +- +- PR libstdc++/79162 +- Implement LWG 2946, LWG 2758's resolution missed further corrections +- * include/bits/basic_string.h (basic_string::compare): Add missing +- required noexcept specifications. +- (basic_string): Introduce internal _S_to_string_view and __sv_wrapper +- for implicit string_view conversion. +- (basic_string::basic_string): Fix explicit string_view conversion by +- implicit conversion using _S_to_string_view and __sv_wrapper. +- (basic_string): Introduce internal basic_string(__sv_wrapper, Alloc) +- constructor. +- (basic_string): Fix operator=3D(T) template by operator=3D(const T&) +- template for uncopyable types (PR 79162). +- (basic_string::operator+=3D, basic_string::append, basic_string::assign) +- (basic_string::insert, basic_string::replace, basic_string::find) +- (basic_string::rfind, basic_string::find_first_of) +- (basic_string::find_last_of, basic_string::find_first_not_of) +- (basic_string::find_last_not_of, basic_string::compare): Replace +- __sv_type argument by template const T& (LWG 2946) and correct +- documentation describing __sv_type argument. +- (basic_string::find, basic_string::rfind, basic_string::find_first_of) +- (basic_string::find_last_of, basic_string::find_first_not_of) +- (basic_string::find_last_not_of, basic_string::compare): Replace +- unconditional noexcept specification by conditional noexcept +- specification to partially balance the removal of noexcept by LWG 2946. +- * testsuite/21_strings/basic_string/79162.cc: New. +- * testsuite/21_strings/basic_string/lwg2946.cc: New. +- +-2017-09-13 Jonathan Wakely +- +- PR libstdc++/81468 +- * include/std/chrono (time_point(const time_point<_Dur2>&)): Add +- missing constraint from LWG DR 1177. +- * testsuite/20_util/duration/cons/dr1177.cc: New. +- * testsuite/20_util/time_point/cons/81468.cc: New. +- * testsuite/20_util/duration/literals/range.cc: Update dg-error line. +- +- * doc/doxygen/mainpage.html: Fix broken URLs. +- +- PR libstdc++/81835 +- * doc/xml/manual/extensions.xml: Replace unstable URL. +- * doc/html/manual/ext_demangling.html: Regenerate. +- * libsupc++/cxxabi.h (__cxa_demangle): Fix broken URL. +- +-2017-09-12 Jonathan Wakely +- +- Backport from mainline +- 2017-09-12 Jonathan Wakely +- +- PR libstdc++/70483 +- * include/experimental/bits/string_view.tcc (basic_string_view::find) +- (basic_string_view::rfind, basic_string_view::find_first_of) +- (basic_string_view::find_last_of, basic_string_view::find_first_not_of) +- (basic_string_view::find_last_not_of): Add constexpr specifier. +- * include/experimental/string_view (basic_string_view::remove_prefix) +- (basic_string_view::remove_suffix, basic_string_view::swap) +- (basic_string_view::compare, basic_string_view::find) +- (basic_string_view::rfind, basic_string_view::find_first_of) +- (basic_string_view::find_last_of, basic_string_view::find_first_not_of) +- (basic_string_view::find_last_not_of, operator=3D=3D, operator!=3D) +- (operator<, operator>, operator<=3D, operator>=3D): Likewise. +- * testsuite/experimental/string_view/operations/compare/char/70483.cc: +- New. +- +- Backport from mainline +- 2017-09-11 Jonathan Wakely +- +- PR libstdc++/70483 +- * include/bits/string_view.tcc (basic_string_view::find) +- (basic_string_view::rfind, basic_string_view::find_first_of) +- (basic_string_view::find_last_of, basic_string_view::find_first_not_of) +- (basic_string_view::find_last_not_of): Add constexpr specifier. +- * include/std/string_view (basic_string_view::operator=3D) +- (basic_string_view::rbegin, basic_string_view::rend) +- (basic_string_view::crbegin, basic_string_view::crend) +- (basic_string_view::remove_prefix, basic_string_view::remove_suffix) +- (basic_string_view::swap, basic_string_view::compare) +- (basic_string_view::find, basic_string_view::rfind) +- (basic_string_view::find_first_of, basic_string_view::find_last_of) +- (basic_string_view::find_first_not_of) +- (basic_string_view::find_last_not_of, basic_string_view::_M_check) +- (basic_string_view::_M_limit, operator=3D=3D, operator!=3D, operator<) +- (operator>, operator<=3D, operator>=3D): Likewise. +- * testsuite/21_strings/basic_string_view/modifiers/remove_prefix/ +- char/1.cc: Repeat tests in constexpr context. +- * testsuite/21_strings/basic_string_view/modifiers/remove_prefix/ +- wchar_t/1.cc: Likewise. +- * testsuite/21_strings/basic_string_view/modifiers/remove_suffix/ +- char/1.cc: Likewise. +- * testsuite/21_strings/basic_string_view/modifiers/remove_suffix/ +- wchar_t/1.cc: Likewise. +- * testsuite/21_strings/basic_string_view/operations/find/char/1.cc: +- Likewise. +- * testsuite/21_strings/basic_string_view/operations/find/char/2.cc: +- Likewise. +- * testsuite/21_strings/basic_string_view/operations/find/char/3.cc: +- Likewise. +- * testsuite/21_strings/basic_string_view/operations/find/wchar_t/1.cc: +- Likewise. +- * testsuite/21_strings/basic_string_view/operations/find/wchar_t/2.cc: +- Likewise. +- * testsuite/21_strings/basic_string_view/operations/find/wchar_t/3.cc: +- Likewise. +- * testsuite/21_strings/basic_string_view/operators/char/2.cc: +- Likewise. +- * testsuite/21_strings/basic_string_view/operators/wchar_t/2.cc: +- Likewise. +- * testsuite/21_strings/basic_string_view/range_access/char/1.cc: Test +- cbegin, cend, rbegin, rend, crbegin and crend. +- * testsuite/21_strings/basic_string_view/range_access/wchar_t/1.cc: +- Likewise. +- * testsuite/21_strings/basic_string_view/operations/compare/char/1.cc: +- Remove trailing whitespace. +- * testsuite/21_strings/basic_string_view/operations/compare/wchar_t/ +- 1.cc: Likewise. +- * testsuite/21_strings/basic_string_view/modifiers/swap/char/1.cc: +- New. +- * testsuite/21_strings/basic_string_view/modifiers/swap/wchar_t/1.cc: +- New. +- * testsuite/21_strings/basic_string_view/operations/compare/char/2.cc: +- New. +- * testsuite/21_strings/basic_string_view/operations/compare/wchar_t/ +- 2.cc: New. +- +- Backport from mainline +- 2017-06-12 Pedro Alves +- +- * doc/xml/manual/status_cxx2017.xml: Update C++17 constexpr +- char_traits status. +- * doc/html/*: Regenerate. +- +- * include/bits/char_traits.h (_GLIBCXX_ALWAYS_INLINE): Define if +- not already defined. +- (__cpp_lib_constexpr_char_traits): Uncomment. +- (__constant_string_p, __constant_char_array_p): New. +- (std::char_traits, std::char_traits): Add +- _GLIBCXX17_CONSTEXPR on compare, length and find and use +- __constant_string_p, __constant_char_array_p and +- __builtin_constant_p to defer to __gnu_cxx::char_traits at compile +- time. +- +- * testsuite/21_strings/char_traits/requirements/ +- constexpr_functions_c++17.cc: Uncomment +- __cpp_lib_constexpr_char_traits tests. Uncomment +- test_compare, test_length, test_find, +- test_compare, test_length and test_find +- static_assert tests. +- +-2017-09-04 Jonathan Wakely +- +- Backport from mainline +- 2017-08-31 Jonathan Wakely +- +- PR c++/82039 +- * include/ext/new_allocator.h (__gnu_cxx::new_allocator::allocate): +- Adjust null pointer constant to avoid warning. +- +- Backport from mainline +- 2017-08-21 Jonathan Wakely +- +- PR libstdc++/81912 +- * include/bits/stl_iterator_base_types.h (__iterator_category): Add +- constexpr for C++11 and later. +- * testsuite/24_iterators/container_access.cc: Add target selector. +- * testsuite/24_iterators/range_access.cc: Fix clause number in +- comment. +- * testsuite/24_iterators/range_access_cpp14.cc: Likewise. +- * testsuite/24_iterators/range_access_cpp17.cc: New. +- +- Backport from mainline +- 2017-08-09 Jonathan Wakely +- +- * include/std/type_traits (_GLIBCXX_NO_BUILTIN_HAS_UNIQ_OBJ_REP): +- Replace with _GLIBCXX_HAVE_BUILTIN_HAS_UNIQ_OBJ_REP and use +- __is_identifier to set it. +- +- Backport from mainline +- 2017-08-09 Katsuhiko Nishimra +- +- * include/std/type_traits (_GLIBCXX_HAVE_BUILTIN_IS_AGGREGATE): Use +- __is_identifier instead of __has_builtin. +- +- Backport from mainline +- 2017-08-18 Jonathan Wakely +- +- PR libstdc++/81891 +- * include/bits/hashtable.h (_Hashtable(_InputIterator, _InputIterator, +- size_type, const _H1&, const _H2&, const _Hash&, const _Equal&, +- const _ExtractKey&, const allocator_type&)): Let destructor do clean +- up if an exception is thrown. +- * testsuite/23_containers/unordered_map/cons/81891.cc: New. +- +- Backport from mainline +- 2017-07-31 Marek Polacek +- +- PR libstdc++/81599 +- * include/bits/stl_stack.h: Fix typo. +- +- Backport from mainline +- 2017-07-10 Jonathan Wakely +- +- PR libstdc++/81338 +- * include/bits/basic_string.h [_GLIBCXX_USE_CXX11_ABI] (basic_string): +- Declare basic_stringbuf to be a friend. +- * include/bits/sstream.tcc (basic_stringbuf::overflow) +- [_GLIBCXX_USE_CXX11_ABI]: Use unused capacity before reallocating. +- * include/std/sstream (basic_stringbuf::__xfer_bufptrs): Update string +- length to buffer length. +- * testsuite/27_io/basic_stringstream/assign/81338.cc: New. +- +-2017-08-20 John David Anglin +- +- PR testsuite/81056 +- * testsuite/17_intro/names.cc: Undef 'd' and 'r' on __hpux__. +- +-2017-08-14 Jonathan Wakely +- +- Backport from mainline +- 2017-08-09 Jonathan Wakely +- +- PR libstdc++/79820 +- PR libstdc++/81751 +- * config/io/basic_file_stdio.cc (sys_open(FILE*, ios_base::openmode)): +- Call fflush on the stream instead of calling sync() while _M_cfile is +- null. Restore original value of errno. +- * testsuite/ext/stdio_filebuf/char/79820.cc: New. +- * testsuite/ext/stdio_filebuf/char/81751.cc: New. +- +- Backport from mainline +- 2017-07-25 Jonathan Wakely +- +- PR libstdc++/53984 +- * include/bits/basic_ios.h (basic_ios::_M_setstate): Adjust comment. +- * include/bits/istream.tcc (basic_istream::sentry): Handle exceptions +- during construction. +- * include/std/istream: Adjust comments for formatted input functions +- and unformatted input functions. +- * testsuite/27_io/basic_fstream/53984.cc: New. +- * testsuite/27_io/basic_istream/sentry/char/53984.cc: New. +- +-2017-08-14 Release Manager +- +- * GCC 7.2.0 released. +- +-2017-07-26 Richard Biener +- +- Backport from mainline +- 2017-06-02 Richard Biener +- Markus Eisenmann +- +- PR libstdc++/80721 +- * libsupc++/eh_alloc.cc (pool::free): Keep list properly +- sorted and add missing freelist item merging cases. +- +-2017-07-25 Jonathan Wakely +- +- Backport from mainline +- 2017-06-09 Jonathan Wakely +- +- * doc/xml/manual/intro.xml: Document LWG 2802, 2873 and 2942 changes. +- * include/bits/shared_ptr.h (shared_ptr): Use rvalues for deleters +- (LWG 2802). +- * include/bits/shared_ptr_base.h (_Sp_ebo_helper, _Sp_counted_deleter +- (_Sp_counted_deleter::_Impl, __shared_count, __shared_ptr): Likewise. +- * testsuite/20_util/shared_ptr/cons/lwg2802.cc: New. +- +- Backport from mainline +- 2017-06-05 Jonathan Wakely +- +- * include/bits/shared_ptr_base.h (__shared_ptr::owner_before) +- (__weak_ptr::owner_before, _Sp_owner_less::operator()): Add noexcept +- specifiers as per LWG 2873 and LWG 2942. +- * testsuite/20_util/owner_less/noexcept.cc: New. +- * testsuite/20_util/shared_ptr/observers/owner_before.cc: Test +- noexcept guarantees. +- * testsuite/20_util/weak_ptr/observers/owner_before.cc: Likewise. +- +- Backport from mainline +- 2017-04-28 Jonathan Wakely +- +- PR libstdc++/80553 +- * include/bits/stl_construct.h (_Destroy, _Destroy_n): Add static +- assertions to ensure type is destructible. +- (destroy_at, destroy, destroy_n): Move from stl_uninitialized.h. +- * include/bits/stl_uninitialized.h (destroy_at, destroy, destroy_n): +- Move to stl_construct.h. +- * testsuite/20_util/specialized_algorithms/memory_management_tools/ +- destroy_neg.cc: New test. +- * testsuite/23_containers/vector/cons/destructible_neg.cc: New test. +- +- Backport from mainline +- 2017-05-16 Jonathan Wakely +- +- * configure: Regenerate. +- * doc/xml/manual/status_cxx2017.xml: Update status table. +- * doc/html/*: Regenerate. +- * include/Makefile.am: Add new header. +- * include/Makefile.in: Regenerate. +- * include/experimental/source_location: New header implementing N4519. +- * testsuite/experimental/source_location/1.cc: New test. +- +- Backport from mainline +- 2017-07-06 Jonathan Wakely +- +- * include/bits/uses_allocator.h (__use_alloc(const _Alloc&&)): Add +- deleted overload to prevent dangling references to rvalues. +- * include/experimental/memory_resource +- (polymorphic_allocator::construct): Do not call __use_alloc with +- rvalue arguments. +- +- Backport from mainline +- 2017-06-08 Jonathan Wakely +- +- PR libstdc++/81017 +- * include/bits/std_function.h (function::function(function&&)) +- (function::operator=3D(funtion&&)): Add noexcept. +- * testsuite/20_util/function/assign/move.cc: Check for noexcept. +- * testsuite/20_util/function/cons/move.cc: Likewise. +- +- Backport from mainline +- 2017-07-15 Jonathan Wakely +- +- * include/std/mutex (scoped_lock): Reorder std::adopt_lock_t parameter +- as per P0739R0. +- * testsuite/30_threads/scoped_lock/cons/1.cc: Reorder arguments. +- * testsuite/30_threads/scoped_lock/cons/deduction.cc: Test deduction +- with std::adopt_lock_t. +- * testsuite/30_threads/scoped_lock/requirements/typedefs.cc: Check +- feature-test macro. +- +- Backport from mainline +- 2017-07-14 Jason Merrill +- Jonathan Wakely +- +- * include/std/variant (variant::variant(_Tp&&)): Constrain to remove +- the constructor for empty variants from the candidate functions +- during class template argument deduction. +- * testsuite/20_util/variant/deduction.cc: New. +- +- Backport from mainline +- 2017-06-02 Jonathan Wakely +- +- PR libstdc++/80939 +- * include/std/variant (__erased_ctor, __erased_assign, __erased_swap) +- (__erased_hash): Remove constexpr specifier and qualify calls to +- __ref_cast. +- (__erased_dtor): Remove constexpr specifier and use _Destroy. +- +- Backport from mainline +- 2017-05-20 Tim Shen +- +- PR libstdc++/80737 +- * include/std/variant(variant::variant): SFINAE on is_same first. +- * testsuite/20_util/variant/any.cc: test case. +- +-2017-07-11 Jonathan Wakely +- +- Backport from mainline +- 2017-04-21 Jonathan Wakely +- +- PR libstdc++/80316 +- * include/std/future (_State_baseV2::_Setter::operator()): Remove +- _S_check calls that are done after the pointer to the shared state is +- already dereferenced. +- (_State_baseV2::_Setter<_Res, void>): Define specialization for void +- as partial specialization so it can be defined within the definition +- of _State_baseV2. +- (_State_baseV2::__setter): Call _S_check. +- (_State_baseV2::__setter(promise*)): Add overload for use by +- promise::set_value and promise::set_value_at_thread_exit. +- (promise, promise, promise): Make _State a friend. +- (_State_baseV2::_Setter): Remove explicit specialization. +- (promise::set_value, promise::set_value_at_thread_exit): +- Use new __setter overload. +- * testsuite/30_threads/promise/members/at_thread_exit2.cc: New test. +- * testsuite/30_threads/promise/members/set_exception.cc: Test +- promise and promise specializations. +- * testsuite/30_threads/promise/members/set_exception2.cc: Likewise. +- Test for no_state error condition. +- * testsuite/30_threads/promise/members/set_value2.cc: Likewise. +- +-2017-06-27 Jonathan Wakely +- +- PR libstdc++/81221 +- * include/bits/stl_algo.h (sample): Qualify with _GLIBCXX_STD_A not +- std. +- * testsuite/25_algorithms/sample/81221.cc: New. +- +-2017-06-21 Ville Voutilainen +- +- Backport from mainline +- 2017-06-21 Ville Voutilainen +- +- PR libstdc++/80675 +- PR libstdc++/80940 +- * include/std/istream: +- (__is_convertible_to_basic_istream_test(basic_istream<_Ch, _Up>*)): New. +- (__do_is_convertible_to_basic_istream_impl): Likewise. +- (__is_convertible_to_basic_istream_impl): Likewise. +- (__is_convertible_to_basic_istream): Use the new base. +- (__rvalue_istream_type): New. +- (operator>>(_Istream&&, _Tp&&)): Use the new helper alias +- for the SFINAE check, convert to the helper alias type before +- doing the actual extraction. +- * include/std/ostream: +- (__is_convertible_to_basic_ostream_test(basic_ostream<_Ch, _Up>*)): New. +- (__do_is_convertible_to_basic_ostream_impl): Likewise. +- (__is_convertible_to_basic_ostream_impl): Likewise. +- (__is_convertible_to_basic_ostream): Use the new base. +- (__rvalue_ostream_type): New. +- (operator<<(_Ostream&&, const _Tp&)): Use the new helper alias +- for the SFINAE check, convert to the helper alias type before +- doing the actual insertion. +- * testsuite/27_io/rvalue_streams-2.cc: Add new tests. +- +-2017-06-21 Uros Bizjak +- +- * config/abi/post/alpha-linux-gnu/baseline_symbols.txt: Update. +- +-2017-06-21 Jonathan Wakely +- +- PR libstdc++/81092 +- * configure: Regenerate. +- +-2017-06-19 Rainer Orth +- +- * config/abi/post/i386-solaris2.10/baseline_symbols.txt: Regenerate. +- * config/abi/post/i386-solaris2.10/amd64/baseline_symbols.txt: Likewise. +- * config/abi/post/i386-solaris2.11/baseline_symbols.txt: Likewise. +- * config/abi/post/i386-solaris2.11/amd64/baseline_symbols.txt: Likewise. +- * config/abi/post/sparc-solaris2.10/baseline_symbols.txt: Likewise. +- * config/abi/post/sparc-solaris2.10/sparcv9/baseline_symbols.txt: +- Likewise. +- * config/abi/post/sparc-solaris2.11/baseline_symbols.txt: Likewise. +- * config/abi/post/sparc-solaris2.11/sparcv9/baseline_symbols.txt: +- Likewise. +- +-2017-06-18 H.J. Lu +- +- PR libstdc++/81092 +- * config/abi/post/x86_64-linux-gnu/x32/baseline_symbols.txt: Updated. +- +-2017-06-16 Jakub Jelinek +- +- PR libstdc++/81092 +- * config/abi/post/i486-linux-gnu/baseline_symbols.txt: Update. +- +-2017-06-16 Jonathan Wakely +- +- * include/bits/locale_conv.h (wbuffer_convert::sync): Fix condition. +- * testsuite/22_locale/conversions/buffer/2.cc: New. +- +- * doc/xml/manual/appendix_contributing.xml: Link to the list of bad +- names, and link to the test docs and note higher DejaGnu version +- requirement. +- * doc/xml/manual/allocator.xml: Fix ViewCVS URLs. +- * doc/xml/manual/mt_allocator.xml: Likewise. +- * doc/xml/manual/test.xml: Correct instructions on running tests. +- * doc/html/*: Regenerate. +- +- PR libstdc++/81092 +- * acinclude.m4: Bump libtool_VERSION. +- * config/abi/post/i386-linux-gnu/baseline_symbols.txt: Update. +- * config/abi/post/x86_64-linux-gnu/32/baseline_symbols.txt: Update. +- * config/abi/pre/gnu.ver: Add wstring constructor symbols to new +- GLIBCXX_3.4.24 version. +- * doc/xml/manual/abi.xml: Document new versions. +- * doc/html/*: Regenerate. +- * testsuite/21_strings/basic_string/cons/char/8.cc: Use base object +- constructors to ensure required symbols are exported. +- * testsuite/21_strings/basic_string/cons/wchar_t/8.cc: Likewise. +- * testsuite/util/testsuite_abi.cc: Add new version. +- +- * include/bits/locale_conv.h (wbuffer_convert::_M_put): Add missing +- return statement. +- * testsuite/21_strings/basic_string_view/operations/copy/char/1.cc: +- Return void. +- * testsuite/21_strings/basic_string_view/operations/copy/wchar_t/1.cc: +- Likewise. +- * testsuite/23_containers/map/modifiers/insert_or_assign/1.cc: Add +- missing return statements. +- * testsuite/23_containers/unordered_map/modifiers/insert_or_assign.cc: +- Likewise. +- * testsuite/27_io/basic_istream/extractors_arithmetic/char/12.cc: +- Return void. +- * testsuite/special_functions/14_expint/pr68397.cc: Likewise. +- +-2017-06-07 Jonathan Wakely +- +- PR libstdc++/81002 +- * include/bits/regex_compiler.h (__compile_nfa): Add template argument +- list to specify traits type. +- * testsuite/28_regex/basic_regex/ctors/basic/iter.cc: New. +- +-2017-05-19 Jonathan Wakely +- +- PR libstdc++/80796 +- * include/bits/stl_algo.h (search): Add new overload for C++17. +- * testsuite/25_algorithms/search/searcher.cc: New. +- +-2017-05-18 Jonathan Wakely +- +- PR libstdc++/80478 +- * include/std/functional (_Mem_fn_traits_base): Add specializations +- for noexcept member function types. +- * testsuite/20_util/function_objects/mem_fn/80478.cc: New test. +- +-2017-05-18 Jonathan Wakely +- +- * doc/xml/manual/policy_data_structures.xml: Fix typo. +- * doc/xml/manual/test_policy_data_structures.xml: Likewise. +- * doc/html/*: Regenerate. +- +- * doc/xml/manual/abi.xml: Document latest library versions. +- * doc/xml/manual/build_hacking.xml: Document requirement to update +- abi.xml when bumping library versions. +- * doc/html/*: Regenerate. +- +-2017-05-15 Jonathan Wakely +- +- PR libstdc++/80761 +- * include/bits/node_handle.h (_Node_insert_return): Reorder members. +- (tuple_size, tuple_element): Remove partial specializations. +- * include/bits/stl_tree.h (_Rb_tree::insert_return_type): Use +- const_iterator for std::set. +- * testsuite/23_containers/map/modifiers/extract.cc: New. +- * testsuite/23_containers/set/modifiers/extract.cc: New. +- * testsuite/23_containers/unordered_map/modifiers/extract.cc: New. +- * testsuite/23_containers/unordered_set/modifiers/extract.cc: New. +- +-2017-05-12 Jonathan Wakely +- +- PR libstdc++/78939 +- * include/std/utility (tuple_size) [__cplusplus > 201402L]: +- Only define partial specializations when tuple_size::value is +- valid. +- * testsuite/20_util/tuple/78939.cc: New. +- +-2017-05-02 Release Manager +- +- * GCC 7.1.0 released. +- +-2017-04-19 Jonathan Wakely +- +- * doc/xml/manual/abi.xml: Rephrase one of the references to the +- Itanium C++ ABI. +- * doc/xml/manual/test.xml: Document DejaGnu 1.5.3 requirement. +- * doc/html/*: Regenerate. +- +- * libsupc++/new: Update comment on #endif directive. +- +- PR libstdc++/80448 +- * include/experimental/bits/fs_dir.h (directory_iterator) +- (recursive_directory_iterator): Remove noexcept from defaulted +- constructors. +- +- PR libstdc++/80446 +- * include/std/type_traits (is_aggregate): Change __has_builtin checks. +- * libsupc++/new (launder): Likewise. +- +-2017-04-18 Jonathan Wakely +- +- * include/std/functional (default_searcher, __boyer_moore_array_base) +- (__is_std_equal_to, __boyer_moore_base_t, boyer_moore_searcher) +- (boyer_moore_horspool_searcher): Remove redundant namespace +- qualification. +- (default_searcher::operator()): Construct return value early and +- advance second member in-place. +- (boyer_moore_horspool_searcher::operator()): Increment random access +- iterator directly instead of using std::next. +- (boyer_moore_searcher::operator()): Fix return value. +- * testsuite/20_util/function_objects/searchers.cc: Check both parts +- of return values. +- +-2017-04-12 Gerald Pfeifer +- +- * doc/xml/faq.xml: Update reference link to C++ ABI for Itanium. +- * doc/xml/manual/abi.xml. Ditto (thrice). +- +-2017-04-03 Jonathan Wakely +- +- * doc/xml/manual/status_cxx2017.xml: Remove duplicate table entry. +- * doc/html/*: Regenerate. +- +- * testsuite/20_util/reference_wrapper/invoke.cc: Uncomment tests +- that no longer fail. +- +- * include/bits/ios_base.h: Correct comment. +- * testsuite/util/testsuite_hooks.h: Likewise. +- +- * doc/xml/manual/status_cxx2017.xml: Update C++17 status table. +- * doc/xml/manual/appendix_contributing.xml (contrib.organization): Add +- directories for debug, parallel and profile headers. +- * doc/html/*: Regenerate. +- +- * include/bits/char_traits.h (__gnu_cxx::char_traits): Add +- _GLIBCXX14_CONSTEXPR on assign, compare, find, and length. +- (std::char_traits, std::char_traits): Add +- _GLIBCXX17_CONSTEXPR on assign. +- (std::char_traits, std::char_traits): Add +- _GLIBCXX17_CONSTEXPR on assign, compare, find, and length. +- * testsuite/21_strings/char_traits/requirements/ +- constexpr_functions_c++17.cc: New test. +- +-2017-04-03 Ville Voutilainen +- +- PR libstdc++/79141 +- * include/bits/stl_pair.h (__nonesuch_no_braces): New. +- (operator=3D(typename conditional< +- __and_, +- is_copy_assignable<_T2>>::value, +- const pair&, const __nonesuch&>::type)): Change __nonesuch +- to __nonesuch_no_braces. +- (operator=3D(typename conditional< +- __not_<__and_, +- is_copy_assignable<_T2>>>::value, +- const pair&, const __nonesuch&>::type)): Likewise. +- (operator=3D(typename conditional< +- __and_, +- is_move_assignable<_T2>>::value, +- pair&&, __nonesuch&&>::type)): Likewise. +- * testsuite/20_util/pair/79141.cc: New. +- +-2017-04-03 Ville Voutilainen +- +- Implement std::is_aggregate. +- * include/std/type_traits (is_aggregate, is_aggregate_v): New. +- * testsuite/20_util/is_aggregate/requirements/explicit_instantiation.cc: +- New. +- * testsuite/20_util/is_aggregate/requirements/typedefs.cc: Likewise. +- * testsuite/20_util/is_aggregate/value.cc: Likewise. +- +-2017-03-29 Ville Voutilainen +- +- Adjust optional's pretty printer for LWG 2900. +- * python/libstdcxx/v6/printers.py (StdExpOptionalPrinter.__init__): +- Look at the nested payload in case of non-experimental optional. +- +-2017-03-29 Ville Voutilainen +- +- Implement LWG 2900, The copy and move constructors +- of optional are not constexpr. +- * include/std/optional (_Optional_payload): New. +- (_Optional_base): Remove the bool parameter. +- (_Optional_base<_Tp, false>): Remove. +- (_Optional_base()): Adjust. +- (_Optional_base(nullopt_t)): Likewise. +- (_Optional_base(in_place_t, _Args&&...)): Likewise. +- (_Optional_base(in_place_t, initializer_list<_Up>, _Args&&...)): +- Likewise. +- (_Optional_base(const _Optional_base&)): Likewise. +- (_Optional_base(_Optional_base&&)): Likewise. +- (operator=3D(const _Optional_base&)): Likewise. +- (operator=3D(_Optional_base&&)): Likewise. +- (~_Optional_base()): Remove. +- (_M_is_engaged()): Adjust. +- (_M_get()): Likewise. +- (_M_construct(_Args&&...)): Likewise. +- (_M_destruct()): Likewise. +- (_M_reset()): Likewise. +- (_Optional_base::_Empty_byte): Remove. +- (_Optional_base::_M_empty): Remove. +- (_Optional_base::_M_payload): Adjust. +- * testsuite/20_util/optional/cons/value_neg.cc: Adjust. +- * testsuite/20_util/optional/constexpr/cons/value.cc: Add tests. +- +-2017-03-28 Jonathan Wakely +- +- PR libstdc++/80137 +- * include/bits/random.tcc (generate_canonical): Use std::nextafter +- or numeric_limits::epsilon() to reduce out-of-range values. +- * testsuite/26_numerics/random/uniform_real_distribution/operators/ +- 64351.cc: Verify complexity requirement is met. +- +- * doc/xml/manual/abi.xml: Add xml:id anchor. +- * doc/xml/manual/using.xml (manual.intro.using.macros): Document +- _GLIBCXX_RELEASE. Link to new anchor for __GLIBCXX__ notes. +- (concurrency.io.structure): Add markup. +- * doc/html/*: Regenerate. +- +- PR libstdc++/80229 +- * include/bits/shared_ptr_base.h +- (__shared_ptr::_M_enable_shared_from_this_with): Change parameters to +- non-const and then use remove_cv to get unqualified type. +- * testsuite/20_util/enable_shared_from_this/members/const.cc: Don't +- cast away constness on object created const. +- * testsuite/20_util/shared_ptr/cons/80229.cc: New test. +- +-2017-03-26 Markus Trippelsdorf +- +- PR libstdc++/80183 +- * include/bits/stl_tree.h: +- (_Rb_tree_header::_M_move_data(_Rb_tree_header&)): Also save _M_color. +- +-2017-03-23 Jonathan Wakely +- +- * testsuite/23_containers/array/tuple_interface/ +- tuple_element_debug_neg.cc: Adjust dg-error. +- * testsuite/23_containers/list/operations/78389.cc: Fix less-than to +- define a valid strict weak ordering. +- * testsuite/23_containers/priority_queue/67085.cc: Disable test for +- Debug Mode, due to debug checks making extra copies of predicate. +- * testsuite/ext/pb_ds/regression/priority_queue_binary_heap-62045.cc: +- Likewise. +- +- * doc/xml/faq.xml: Add link. +- * doc/xml/manual/backwards_compatibility.xml: Remove outdated +- information on pre-ISO headers. Replace broken link to C++ FAQ Lite. +- * doc/xml/manual/io.xml: Update broken link. +- * doc/html/*: Regenerate. +- +-2017-03-23 Daniel Kruegler +- +- Implement LWG 2686, Why is std::hash specialized for error_code, +- but not error_condition? +- * include/std/system_error (hash): Define for C++17. +- * testsuite/20_util/hash/operators/size_t.cc (hash): +- Instantiate test for error_condition. +- * testsuite/20_util/hash/requirements/explicit_instantiation.cc +- (hash): Instantiate hash. +- +- * include/bits/c++config (_GLIBCXX17_INLINE): Define. +- * include/bits/regex_constants.h (All std::regex_constants constants): +- Add _GLIBCXX17_INLINE as per P0607R0. +- * include/bits/std_mutex.h (defer_lock, try_to_lock, adopt_lock): +- Likewise. +- * include/bits/stl_pair.h (piecewise_construct): Likewise. +- * include/bits/uses_allocator.h (allocator_arg, uses_allocator_v) +- (__is_uses_allocator_constructible_v) +- (__is_nothrow_uses_allocator_constructible_v): Likewise. +- * include/std/chrono (treat_as_floating_point_v): Likewise. +- * include/std/functional (is_bind_expression_v, is_placeholder_v): +- Likewise. +- * include/std/optional (nullopt): Likewise. +- * include/std/ratio (ratio_equal_v, ratio_not_equal_v, ratio_less_v) +- ratio_less_equal_v, ratio_greater_v, ratio_greater_equal_v): Likewise. +- * include/std/system_error (is_error_code_enum_v) +- (is_error_condition_enum_v): Likewise. +- * include/std/tuple (tuple_size_v, ignore): Likewise. +- (ignore): Declare ignore constexpr as per LWG 2773, declare assignment +- constexpr as per LWG 2933. +- * include/std/type_traits (All variable templates): Add +- _GLIBCXX17_INLINE as per P0607R0. +- * include/std/variant (variant_size_v, variant_npos, __index_of_v) +- (__tuple_count_v, __exactly_once): Likewise. +- * testsuite/18_support/headers/new/synopsis.cc +- (hardware_destructive_interference_size) +- (hardware_constructive_interference_size): Likewise for commented-out +- variables. +- * testsuite/20_util/tuple/creation_functions/constexpr.cc: Add new +- test function for constexpr std::ignore (LWG 2773). +- * testsuite/20_util/tuple/creation_functions/constexpr_cpp14.cc: New +- test for LWG 2933. +- +-2017-03-22 Jonathan Wakely +- +- * include/bits/shared_ptr.h (shared_ptr, weak_ptr): Add deduction +- guides for C++17. +- * include/bits/std_function.h (function): Likewise. +- * include/bits/stl_pair.h (pair): Likewise. +- * include/debug/array (__gnu_debug::array): Likewise. +- * include/std/array (array): Likewise. +- * include/std/functional (make_default_searcher) +- (make_boyer_moore_searcher, make_boyer_moore_horspool_searcher): +- Remove generator functions. +- * include/std/tuple (tuple): Add deduction guides. +- * include/std/valarray (valarray): Likewise. +- * testsuite/20_util/function_objects/searchers.cc: Adjust to use +- class template argument deduction instead of generator functions. +- * testsuite/20_util/function/cons/deduction.cc: New test. +- * testsuite/20_util/optional/cons/deduction_guide.cc: Rename to ... +- * testsuite/20_util/optional/cons/deduction.cc: ... here. +- * testsuite/20_util/pair/cons/deduction.cc: New test. +- * testsuite/20_util/shared_ptr/cons/deduction.cc: New test. +- * testsuite/20_util/tuple/cons/deduction.cc: New test. +- * testsuite/20_util/tuple/element_access/get_neg.cc: Adjust dg-error. +- * testsuite/20_util/unique_ptr/cons/deduction_neg.cc: New test. +- * testsuite/20_util/weak_ptr/cons/deduction.cc: New test. +- * testsuite/23_containers/array/cons/deduction.cc: New test. +- * testsuite/23_containers/array/cons/deduction_neg.cc: New test. +- * testsuite/23_containers/array/tuple_interface/get_debug_neg.cc: +- Adjust dg-error. +- * testsuite/23_containers/array/tuple_interface/get_neg.cc: Likewise. +- * testsuite/23_containers/array/tuple_interface/tuple_element_neg.cc: +- Likewise. +- * testsuite/26_numerics/valarray/deduction.cc: New test. +- * testsuite/30_threads/lock_guard/cons/deduction.cc: New test. +- * testsuite/30_threads/scoped_lock/cons/deduction.cc: New test. +- * testsuite/30_threads/unique_lock/cons/deduction.cc: New test. +- +-2017-03-20 Fran=C3=A7ois Dumont +- +- * include/bits/stl_deque.h (deque): Access allocator value_type only if +- concept checks are enabled. +- * include/bits/stl_stack.h (stack): Likewise. +- * include/bits/stl_vector.h (vector): Likewise. +- * include/bits/stl_list.h (list): Likewise and check +- _SGIAssignableConcept only in C++03. +- * include/bits/stl_map.h (map): Likewise. +- * include/bits/stl_set.h (set): Likewise. +- * include/bits/stl_multimap.h (multimap): Likewise. +- * include/bits/stl_multiset.h (multiset): Likewise. +- * include/bits/stl_queue.h (queue, priority_queue): Likewise. +- +-2017-03-18 Gerald Pfeifer +- +- * doc/xml/manual/appendix_contributing.xml: Convert link to +- ansi.org to https. +- Update link to the C++ standard at ansi.org. +- +- * doc/xml/faq.xml: Remove information redundant with the above; +- instead add a reference. +- +-2017-03-17 Jonathan Wakely +- +- * src/c++11/codecvt.cc (range): Add non-type template parameter and +- define oerloaded operators for reading and writing code units. +- (range): Define partial specialization for accessing +- wide characters in potentially unaligned byte ranges. +- (ucs2_span(const char16_t*, const char16_t*, ...)) +- (ucs4_span(const char16_t*, const char16_t*, ...)): Change parameters +- to range in order to avoid unaligned reads. +- (__codecvt_utf16_base::do_out) +- (__codecvt_utf16_base::do_out) +- (__codecvt_utf16_base::do_out): Use range specialization for +- unaligned data to avoid unaligned writes. +- (__codecvt_utf16_base::do_in) +- (__codecvt_utf16_base::do_in) +- (__codecvt_utf16_base::do_in): Likewise for writes. Return +- error if there are unprocessable trailing bytes. +- (__codecvt_utf16_base::do_length) +- (__codecvt_utf16_base::do_length) +- (__codecvt_utf16_base::do_length): Pass arguments of type +- range to span functions. +- * testsuite/22_locale/codecvt/codecvt_utf16/misaligned.cc: New test. +- +-2017-03-16 Jonathan Wakely +- +- PR libstdc++/79980 +- * src/c++11/codecvt.cc (to_integer(codecvt_mode)): Fix target type. +- +- PR libstdc++/80041 +- * src/c++11/codecvt.cc (__codecvt_utf16_base::do_out) +- (__codecvt_utf16_base::do_in): Convert char arguments to +- char16_t to work with UTF-16 instead of UTF-8. +- * testsuite/22_locale/codecvt/codecvt_utf16/80041.cc: New test. +- +- * src/c++11/codecvt.cc (codecvt) +- (codecvt, __codecvt_utf8_base) +- (__codecvt_utf8_base, __codecvt_utf8_base) +- (__codecvt_utf16_base, __codecvt_utf16_base) +- (__codecvt_utf16_base, __codecvt_utf8_utf16_base) +- (__codecvt_utf8_utf16_base) +- (__codecvt_utf8_utf16_base): Fix do_encoding() and +- do_max_length() return values. +- * testsuite/22_locale/codecvt/codecvt_utf16/members.cc: New test. +- * testsuite/22_locale/codecvt/codecvt_utf8/members.cc: New test. +- * testsuite/22_locale/codecvt/codecvt_utf8_utf16/members.cc: New test. +- +- PR libstdc++/79980 +- * include/bits/locale_conv.h (__do_str_codecvt): Set __count on +- error path. +- * src/c++11/codecvt.cc (operator&=3D, operator|=3D, operator~): Overloads +- for manipulating codecvt_mode values. +- (read_utf16_bom): Compare input to BOM constants instead of integral +- constants that depend on endianness. Take mode parameter by +- reference and adjust it, to distinguish between no BOM present and +- UTF-16BE BOM present. +- (ucs4_in, ucs2_span, ucs4_span): Adjust calls to read_utf16_bom. +- (surrogates): New enumeration type. +- (utf16_in, utf16_out): Add surrogates parameter to choose between +- UTF-16 and UCS2 behaviour. +- (utf16_span, ucs2_span): Use std::min not std::max. +- (ucs2_out): Use std::min not std::max. Disallow surrogate pairs. +- (ucs2_in): Likewise. Adjust calls to read_utf16_bom. +- * testsuite/22_locale/codecvt/codecvt_utf16/79980.cc: New test. +- * testsuite/22_locale/codecvt/codecvt_utf8/79980.cc: New test. +- +- PR libstdc++/79511 +- * src/c++11/codecvt.cc (write_utf16_code_point): Don't write 0xffff +- as a surrogate pair. +- (__codecvt_utf8_utf16_base::do_in): Use native endianness +- for internal representation. +- (__codecvt_utf8_utf16_base::do_in): Likewise. +- * testsuite/22_locale/codecvt/codecvt_utf8_utf16/79511.cc: New test. +- +- PR libstdc++/80064 +- * include/bits/stl_heap.h (__is_heap, push_heap, __adjust_heap) +- (pop_heap, make_heap, sort_heap, is_heap_until, is_heap): Cope with +- invalid instantiations using function types for _Compare argument. +- * testsuite/25_algorithms/make_heap/80064.cc: New test. +- +- PR libstdc++/67440 +- * python/libstdcxx/v6/printers.py (find_type): Avoid gdb.Type.name +- for GDB 7.6 compatibility, use gdb.Type.unqualified instead. +- +-2017-03-15 Ville Voutilainen +- +- Implement LWG 2857, {variant,optional,any}::emplace should +- return the constructed value. +- * include/std/any (emplace(_Args&&...)): Change the return type and +- return a reference to the constructed value. +- (emplace(initializer_list<_Up>, _Args&&...)): Likewise. +- * include/std/optional (emplace(_Args&&...)): Likewise. +- (emplace(initializer_list<_Up>, _Args&&...)): Likewise. +- * include/std/variant (emplace<_Tp>(_Args&&...)): Likewise. +- (emplace<_Tp>(initializer_list<_Up>, _Args&&...)): Likewise. +- (emplace<_Np>(_Args&&...)): Likewise. +- (emplace<_Np>(initializer_list<_Up>, _Args&&...)): Likewise. +- * testsuite/20_util/any/assign/emplace.cc: Add tests for +- checking the return value of emplace. +- * testsuite/20_util/any/misc/any_cast_neg.cc: Adjust. +- * testsuite/20_util/optional/assignment/6.cc: Add tests for +- checking the return value of emplace. +- * testsuite/20_util/variant/run.cc: Likewise. +- +-2017-03-15 Xi Ruoyao +- +- PR libstdc++/62045 +- * include/ext/pb_ds/qdetail/binary_heap_/binary_heap_.hpp +- (is_heap): Remove. +- (push_heap): Remove the wrong checking using is_heap. +- (make_heap): Remove the assertion using is_heap. +- * include/ext/pb_ds/detail/binary_heap_/insert_fn_imps.hpp +- (modify): Ditto. +- (resize_for_insert_if_needed): Add PB_DS_ASSERT_VALID after +- calling make_heap. +- +-2017-03-15 Jonathan Wakely +- +- PR libstdc++/62045 +- * testsuite/ext/pb_ds/regression/priority_queue_binary_heap-62045.cc: +- New test. +- * testsuite/ext/pb_ds/regression/priority_queues.cc: Fix copy&paste +- error in comment. +- +-2017-03-15 Jonathan Wakely +- +- * acinclude.m4 (GLIBCXX_CHECK_S_ISREG_OR_S_IFREG): Fix typo in +- comment. +- * config.h.in: Regenerate. +- * configure: Regenerate. +- * doc/Makefile.in: Regenerate. +- +-2017-03-14 Jonathan Wakely +- +- PR libstdc++/79162 +- * include/bits/basic_string.h [_GLIBCXX_USE_CXX11_ABI] +- (basic_string::operator=3D(basic_string_view)): Replace +- with a constrained template. +- [!_GLIBCXX_USE_CXX11_ABI] +- (basic_string::operator=3D(basic_string_view)): Likewise. +- * testsuite/21_strings/basic_string/cons/char/79162.cc: New test. +- * testsuite/21_strings/basic_string/cons/wchar_t/79162.cc: New test. +- +-2017-03-13 Ville Voutilainen +- +- PR libstdc++/80034 +- * include/bits/list.tcc (merge(list&&)): Use const for the size_t +- in the catch-block. +- (merge(list&&, _StrictWeakOrdering)): Likewise. +- * testsuite/23_containers/list/operations/80034.cc: New. +- +-2017-03-13 Ville Voutilainen +- +- Implement LWG 2806, Base class of bad_optional_access. +- * include/std/optional (bad_optional_access): +- Derive from std::exception. +- (bad_optional_access::bad_optional_access): Adjust. +- (bad_optional_access::what): New. +- (__throw_bad_optional_access(const char*)): +- Remove the parameter and adjust calls. +- * testsuite/20_util/optional/cons/value_neg.cc: Adjust. +- * testsuite/20_util/optional/typedefs.cc: Likewise. +- +-2017-03-12 Ville Voutilainen +- +- Implement LWG 2934, optional doesn't compare with T. +- * include/std/optional +- (operator=3D=3D(const optional<_Tp>&, const optional<_Tp>&)): +- Turn into operator=3D=3D(const optional<_Tp>&, const optional<_Up>&). +- (operator!=3D(const optional<_Tp>&, const optional<_Tp>&)): +- Turn into operator!=3D(const optional<_Tp>&, const optional<_Up>&). +- (operator<(const optional<_Tp>&, const optional<_Tp>&)): +- Turn into operator<(const optional<_Tp>&, const optional<_Up>&. +- (operator>(const optional<_Tp>&, const optional<_Tp>&)): +- Turn into operator>(const optional<_Tp>&, const optional<_Up>&. +- (operator<=3D(const optional<_Tp>&, const optional<_Tp>&)): +- Turn into operator<=3D(const optional<_Tp>&, const optional<_Up>&). +- (operator>=3D(const optional<_Tp>&, const optional<_Tp>&)): +- Turn into operator>=3D(const optional<_Tp>&, const optional<_Up>&). +- (operator=3D=3D(const optional<_Tp>&, const _Tp&)): +- Turn into operator=3D=3D(const optional<_Tp>&, const _Up&). +- (operator=3D=3D(const _Tp&, const optional<_Tp>&)): +- Turn into operator=3D=3D(const _Up&, const optional<_Tp>&). +- (operator!=3D(const optional<_Tp>&, const _Tp&)): +- Turn into operator!=3D(const optional<_Tp>&, const _Up&). +- (operator!=3D(const _Tp&, const optional<_Tp>&)): +- Turn into operator!=3D(const _Up&, const optional<_Tp>&). +- (operator<(const optional<_Tp>&, const _Tp&)): +- Turn into operator<(const optional<_Tp>&, const _Up&). +- (operator<(const _Tp&, const optional<_Tp>&)): +- Turn into operator<(const _Up&, const optional<_Tp>&). +- (operator>(const optional<_Tp>&, const _Tp&)): +- Turn into operator>(const optional<_Tp>&, const _Up&). +- (operator>(const _Tp&, const optional<_Tp>&)): +- Turn into operator>(const _Up&, const optional<_Tp>&). +- (operator<=3D(const optional<_Tp>&, const _Tp&)): +- Turn into operator<=3D(const optional<_Tp>&, const _Up&). +- (operator<=3D(const _Tp&, const optional<_Tp>&)): +- Turn into operator<=3D(const _Up&, const optional<_Tp>&). +- (operator>=3D(const optional<_Tp>&, const _Tp&)): +- Turn into operator>=3D(const optional<_Tp>&, const _Up&). +- (operator>=3D(const _Tp&, const optional<_Tp>&)): +- Turn into operator>=3D(const _Up&, const optional<_Tp>&). +- * testsuite/20_util/optional/relops/7.cc: New. +- +-2017-03-10 Jonathan Wakely +- +- * testsuite/17_intro/names.cc: Undefine macros that clash with +- identifiers in AIX system headers. +- +- * include/bits/invoke.h (__invoke): Use __invoke_result instead of +- result_of, and __is_nothrow_invocable instead of +- __is_nothrow_callable. +- * include/bits/shared_ptr_base.h (__shared_ptr): Use __is_invocable +- instead of __is_callable. +- * include/std/functional (invoke): use invoke_result_t instead of +- result_of_t and is_nothrow_invocable instead of is_nothrow_callable. +- (_Not_fn): Use __invoke_result instead of result_of. +- * include/std/type_traits (__result_of_memobj, __result_of_memfun): +- Remove partial specializations for reference_wrapper types. +- (__result_of_impl): Use __inv_unwrap to strip reference_wrapper. +- (__invoke_result): Define replacement for result_of and then use it to +- define result_of. +- (__is_callable_impl, __is_callable, __is_nothrow_callable): Replace +- with __is_invocable_impl, __is_invocable, and __is_nothrow_invocable +- respectively. +- (invoke_result, invoke_result_t): Define for C++17. +- (is_callable, is_nothrow_callable): Replace with is_invocable, +- is_invocable_r, is_nothrow_invocable, and is_nothrow_invocable_r. +- (is_callable_v, is_nothrow_callable_v): Replace with is_invocable_v, +- is_invocable_r_v, is_nothrow_invocable_v, and is_nothrow_invocable_r_v. +- * include/std/variant (hash>): Use is_nothrow_invocable_v +- instead of is_nothrow_callable_v. +- * testsuite/20_util/function_objects/invoke/59768.cc: Remove unused +- main function. +- * testsuite/20_util/function_objects/not_fn/1.cc: Use is_invocable +- instead of is_callable. +- * testsuite/20_util/is_callable/*: Rename directory and adjust tests +- to use new traits. +- * testsuite/20_util/is_nothrow_callable/*: Likewise. +- * testsuite/20_util/optional/hash.cc: Use is_invocable_v instead of +- is_callable. +- * testsuite/20_util/variant/hash.cc: Likewise. +- +-2017-03-10 George Lander +- +- * acinclude.m4 (glibcxx_cv_obsolete_isnan): Define +- _GLIBCXX_INCLUDE_NEXT_C_HEADERS before including math.h. ++ * acinclude.m4: Handle `--with-toolexeclibdir=3D'. ++ * Makefile.in: Regenerate. ++ * aclocal.m4: Regenerate. + * configure: Regenerate. +- +-2017-03-09 Jonathan Wakely +- +- * include/std/functional (_Not_fn): Define macro to simplify +- repetitive function definitions. +- +- * doc/xml/manual/status_cxx2017.xml: Document std::byte support. +- * include/c_global/cstddef (std::byte): Define for C++17. +- * testsuite/18_support/byte/global_neg.cc: New test. +- * testsuite/18_support/byte/ops.cc: New test. +- * testsuite/18_support/byte/requirements.cc: New test. +- +-2017-03-05 Jonathan Wakely +- +- * doc/xml/manual/status_cxx2017.xml: Document P0156R2 status. +- * doc/html/*: Regenerate. +- * include/std/mutex (scoped_lock): Implement new C++17 template. +- * testsuite/30_threads/scoped_lock/cons/1.cc: New test. +- * testsuite/30_threads/scoped_lock/requirements/ +- explicit_instantiation.cc: New test. +- * testsuite/30_threads/scoped_lock/requirements/typedefs.cc: New test. +- +-2017-03-02 Gerald Pfeifer +- Fran=C3=A7ois Dumont +- Jonathan Wakely +- +- * doc/xml/manual/debug_mode.xml: Update and simplify note +- on link- and run-time coexistence. +- +-2017-03-02 Jonathan Wakely +- +- * testsuite/17_intro/headers/names.cc: Rename to ... +- * testsuite/17_intro/names.cc: ... here. +- +- PR libstdc++/79789 +- * include/bits/hashtable_policy.h (__clp2): Use reserved names for +- parameters and local variables. +- * include/bits/ios_base.h (make_error_code, make_error_condition): +- Likewise. +- * include/bits/list.tcc (list::sort): Likewise. +- * include/bits/mask_array.h (mask_array): Likewise. +- * include/bits/regex.h (regex_token_iterator): Likewise. +- * include/bits/slice_array.h (slice_array): Likewise. +- * include/bits/stl_algo.h (__sample): Likewise. +- * include/std/memory (undeclare_no_pointers): Likewise. +- * include/std/type_traits (is_callable_v, is_nothrow_callable_v): +- Likewise. +- * libsupc++/exception_ptr.h (__dest_thunk): Likewise. +- * testsuite/17_intro/headers/names.cc: New test. +- +- PR libstdc++/79798 +- * include/std/functional (bind::_Res_type_impl): Fix incorrect use of +- result_of that loses top-level cv-qualifiers. +- * testsuite/20_util/bind/79798.cc: New test. +- +-2017-03-01 Gerald Pfeifer +- +- * doc/xml/manual/documentation_hacking.xml: Tweak link to +- doxygen.org. +- +-2017-02-23 Jonathan Wakely +- +- * include/experimental/iterator: Include . +- * testsuite/experimental/iterator/requirements.cc: Check for contents +- of . +- +-2017-02-19 Dinka Ranns +- +- C++17 GB50 resolution +- * include/std/chrono (duration::operator++()): Add +- _GLIBCXX17_CONSTEXPR. +- (duration::operator++(int)): Likewise. +- (duration::operator--()): Likewise. +- (duration::operator--(int)): Likewise. +- (duration::operator+=3D(const duration&)): Likewise. +- (duration::operator-=3D(const duration&)): Likewise. +- (duration::operator*=3D(const rep&)): Likewise. +- (duration::operator/=3D(const rep&)): Likewise. +- (duration::operator%=3D(const rep&)): Likewise. +- (duration::operator%=3D(const duration&)): Likewise. +- (time_point::operator+=3D(const duration&)): Likewise. +- (time_point::operator-=3D(const duration&)): Likewise. +- * testsuite/20_util/duration/arithmetic/constexpr_c++17.cc: New test. +- * testsuite/20_util/duration/literals/range.cc: Adjust dg-error. +- * testsuite/20_util/time_point/arithmetic/constexpr.cc: New test. +- +-2017-02-19 Gerald Pfeifer +- +- * doc/xml/manual/debug.xml: Adjust link to ThreadSanitizer. +- +-2017-02-18 Gerald Pfeifer +- +- * doc/xml/manual/io.xml: Update link to groups.google.com. +- Tweak link description. +- +-2017-02-18 Gerald Pfeifer +- +- * doc/xml/manual/profile_mode.xml: Fix link. +- +-2017-02-16 Gerald Pfeifer +- +- * doc/xml/manual/policy_data_structures.xml: Simplify and +- standardize references to boost.org. +- * doc/xml/manual/policy_data_structures_biblio.xml: Ditto. +- * doc/xml/manual/shared_ptr.xml: Ditto. +- +-2017-02-16 Jonathan Wakely +- +- PR libstdc++/60936 +- * src/c++11/snprintf_lite.cc (__concat_size_t): Calculate length +- written to buffer, not length remaining in buffer. +- +-2017-02-15 Tim Shen +- +- PR libstdc++/78723 +- * include/std/variant (operator<(), operator>(), operator<=3D(), +- operator>=3D(), operator=3D=3D(), operator!=3D()): Implement P0393R3. +- * testsuite/20_util/variant/compile.cc: Adjust tests. +- * testsuite/20_util/variant/run.cc: Adjust tests. +- +-2017-02-15 Tim Shen +- +- PR libstdc++/79513 +- * include/std/variant (visit()): Forward variant types to the return +- type detection code. +- * testsuite/20_util/variant/compile.cc: Add test cases. +- +-2017-02-13 H.J. Lu +- +- PR libstdc++/79348 +- * config/abi/post/x86_64-linux-gnu/x32/baseline_symbols.txt: Updated. +- +-2017-02-13 Jakub Jelinek +- +- PR libstdc++/79348 +- * config/abi/post/x86_64-linux-gnu/baseline_symbols.txt: Update. +- * config/abi/post/x86_64-linux-gnu/32/baseline_symbols.txt: Likewise. +- * config/abi/post/i386-linux-gnu/baseline_symbols.txt: Likewise. +- * config/abi/post/i486-linux-gnu/baseline_symbols.txt: Likewise. +- * config/abi/post/aarch64-linux-gnu/baseline_symbols.txt: Likewise. +- * config/abi/post/s390x-linux-gnu/baseline_symbols.txt: Likewise. +- * config/abi/post/s390x-linux-gnu/32/baseline_symbols.txt: Likewise. +- * config/abi/post/s390-linux-gnu/baseline_symbols.txt: Likewise. +- * config/abi/post/powerpc64-linux-gnu/baseline_symbols.txt: Likewise. +- +-2017-02-13 Jonathan Wakely +- +- PR libstdc++/79486 +- * include/std/future (__future_base::_Task_state::_M_run) +- (__future_base::_Task_state::_M_run_delayed): Use lvalue types in +- result_of expressions. +- * testsuite/30_threads/packaged_task/79486.cc: New. +- +-2017-02-11 Jonathan Wakely +- +- PR libstdc++/79467 +- * include/bits/shared_ptr_base.h (__shared_ptr(_Yp*, _Deleter)) +- (__shared_ptr(_Yp*, _Deleter, _Alloc)): Use lvalue types in +- __is_callable check. +- * testsuite/20_util/shared_ptr/cons/79467.cc: New. +- +- * include/bits/atomic_base.h: Re-indent. +- +-2017-02-10 Gerald Pfeifer +- +- * doc/xml/manual/profile_mode.xml: Update a paper reference. +- +-2017-02-08 Gerald Pfeifer +- +- * src/c++11/snprintf_lite.cc (__err): Use https for bug reporting. +- +-2017-02-08 Jonathan Wakely +- +- * doc/xml/manual/policy_data_structures.xml: Fix spelling of author's +- name. +- * doc/xml/manual/policy_data_structures_biblio.xml: Likewise. Remove +- broken links to texts that are no longer online. +- * doc/xml/manual/profile_mode.xml: Update links to CGO 2009 paper and +- LCPC 2006 paper. +- * doc/xml/manual/using.xml: Update links to memory model information. +- * doc/xml/manual/using_exceptions.xml: Update link to "Appendix E: +- Standard-Library Exception Safety". +- * doc/html/*: Regenerate. +- +-2017-02-08 Gerald Pfeifer +- +- * doc/xml/manual/profile_mode.xml: Unbreak link to +- "Optimizing Sorting with Machine Learning Algorithms". +- +-2017-02-08 Gerald Pfeifer +- +- * src/c++11/snprintf_lite.cc (__err): Update bug reporting URL. +- +-2017-02-08 Gerald Pfeifer +- +- * doc/xml/manual/abi.xml: Update link to "Sun Studio 11: C++ +- Migration Guide". +- +-2017-02-07 Gerald Pfeifer +- +- * doc/html/ext/lwg-active.html: Remove. +- * doc/html/ext/lwg-closed.html: Ditto. +- * doc/html/ext/lwg-defects.html: Ditto. +- +- * doc/Makefile.am (xml_extradir): Remove. +- (xml_extra): Ditto. +- (stamp-html-docbook-lwg): Remove recipe... +- (stamp-html-docbook-data): ...and its use here. + * doc/Makefile.in: Regenerate. +- +- * doc/xml/manual/intro.xml: Shorten two paragraphs explaining +- the relationship to the upstream working group. +- Replace a local link to ../ext/lwg-active.html by the upstream one. +- Replace all reference to ../ext/lwg-defects.html by a new entity +- &DR; which refers to the upstream address. +- +-2017-02-07 Gerald Pfeifer +- +- * doc/xml/manual/status_cxx2017.xml: Fix link to N4284. +- +-2017-02-06 Jonathan Wakely +- +- PR libstdc++/79323 +- * testsuite/20_util/duration/literals/range.cc: Prune extra output +- at -O0. +- +-2017-02-06 Gerald Pfeifer +- +- * doc/xml/manual/documentation_hacking.xml: Update URL of the +- DocBook Element Reference. Use that term as link description +- instead of "online". +- epubcheck has moved to GitHub. +- Remove obsolete link to DocBook Publishing Tools. +- +-2017-02-03 Jonathan Wakely +- +- PR libstdc++/66145 +- * testsuite/27_io/basic_ios/copyfmt/char/1.cc: Restore ABI override +- so new ios::failure can be caught even when old ABI is the default. +- * testsuite/27_io/basic_ios/exceptions/char/1.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_arithmetic/char/ +- exceptions_failbit.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_arithmetic/wchar_t/ +- exceptions_failbit.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_other/char/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_other/wchar_t/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/basic_istream/sentry/char/12297.cc: Likewise. +- * testsuite/27_io/basic_istream/sentry/wchar_t/12297.cc: Likewise. +- * testsuite/27_io/basic_ostream/inserters_other/char/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/basic_ostream/inserters_other/wchar_t/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/ios_base/storage/2.cc: Likewise. +- +- PR libstdc++/60936 +- * src/c++11/Makefile.am: Add new files. ++ * include/Makefile.in: Regenerate. ++ * libsupc++/Makefile.in: Regenerate. ++ * po/Makefile.in: Regenerate. ++ * python/Makefile.in: Regenerate. ++ * src/Makefile.in: Regenerate. + * src/c++11/Makefile.in: Regenerate. +- * src/c++11/cow-string-inst.cc [!_GLIBCXX_USE_CXX11_ABI] +- (operator<<, operator>>, getline): Move explicit instantiations to ... +- * src/c++11/cow-string-io-inst.cc: ... new file. +- * src/c++11/cow-wstring-inst.cc [!_GLIBCXX_USE_CXX11_ABI] +- (operator<<, operator>>, getline): Move explicit instantiations to ... +- * src/c++11/cow-wstring-io-inst.cc: ... new file. +- * src/c++11/functexcept.cc (__throw_ios_failure, __throw_system_error) +- (__throw_future_error, __throw_bad_function_call): +- (__throw_regex_error): Move functions for C++11 exceptions to the +- files that define the exception types. +- * src/c++11/functional.cc (__throw_bad_function_call): Move here. +- * src/c++11/future.cc (__throw_future_error): Likewise. +- * src/c++11/ios.cc (__throw_ios_failure): Likewise. +- * src/c++11/regex.cc (__throw_regex_error): Likewise. +- * src/c++11/snprintf_lite.cc (__concat_size_t): Print decimal +- representation directly instead of calling __int_to_char. +- * src/c++11/sso_string.cc (__sso_string): New file for definition +- of __sso_string type. +- * src/c++11/string-io-inst.cc [_GLIBCXX_USE_CXX11_ABI]: New file for +- explicit instantiations of narrow string I/O functions. +- * src/c++11/system_error.cc (__throw_system_error): Move here. +- (__sso_string): Move to new file. +- * src/c++11/wstring-io-inst.cc [_GLIBCXX_USE_CXX11_ABI]: New file for +- explicit instantiations of wide string I/O functions. +- * src/c++98/misc-inst.cc [_GLIBCXX_USE_CXX11_ABI] (operator<<) +- (operator>>, getline): Remove explicit instantiations from here. +- +-2017-02-02 H.J. Lu +- +- * config/abi/post/x86_64-linux-gnu/x32/baseline_symbols.txt: Updated. +- +-2017-02-02 Rainer Orth +- +- * configure.host: Separate Solaris/SPARC and x86 baselines. +- * config/abi/post/solaris2.10/baseline_symbols.txt: Move ... +- * config/abi/post/sparc-solaris2.10/baseline_symbols.txt: ... here. +- * config/abi/post/solaris2.10/sparcv9/baseline_symbols.txt: Move ... +- * config/abi/post/sparc-solaris2.10/sparcv9/baseline_symbols.txt: +- ... here. +- * config/abi/post/solaris2.10/amd64/baseline_symbols.txt: Move ... +- * config/abi/post/i386-solaris2.10/amd64/baseline_symbols.txt: ... here. +- * config/abi/post/i386-solaris2.10/baseline_symbols.txt: New file. +- * config/abi/post/solaris2.11/baseline_symbols.txt: Move ... +- * config/abi/post/sparc-solaris2.11/baseline_symbols.txt: ... here. +- * config/abi/post/solaris2.11/sparcv9/baseline_symbols.txt: Move ... +- * config/abi/post/sparc-solaris2.11/sparcv9/baseline_symbols.txt: +- ... here. +- * config/abi/post/solaris2.11/amd64/baseline_symbols.txt: Move ... +- * config/abi/post/i386-solaris2.11/amd64/baseline_symbols.txt: ... here. +- * config/abi/post/i386-solaris2.11/baseline_symbols.txt: New file. +- +- * config/abi/post/solaris2.10/baseline_symbols.txt: Regenerate. +- * config/abi/post/solaris2.10/amd64/baseline_symbols.txt: Likewise. +- * config/abi/post/solaris2.10/sparcv9/baseline_symbols.txt: Likewise. +- * config/abi/post/solaris2.11/baseline_symbols.txt: Likewise. +- * config/abi/post/solaris2.11/amd64/baseline_symbols.txt: Likewise. +- * config/abi/post/solaris2.11/sparcv9/baseline_symbols.txt: Likewise. +- +-2017-02-01 Jonathan Wakely ++ * src/c++17/Makefile.in: Regenerate. ++ * src/c++98/Makefile.in: Regenerate. ++ * src/filesystem/Makefile.in: Regenerate. ++ * testsuite/Makefile.in: Regenerate. +=20 +- PR libstdc++/78346 +- * include/bits/predefined_ops.h (_Iter_equals_iter): Store iterator +- not its referent. +- (_Iter_comp_to_iter): Likewise. +- * testsuite/25_algorithms/search/78346.cc: New test. ++2020-01-23 Alexandre Oliva +=20 +- PR libstdc++/79254 +- * config/abi/pre/gnu.ver: Remove recently added symbols. +- * include/bits/basic_string.h [_GLIBCXX_USE_CXX11_ABI] +- (basic_string::_M_copy_assign): Remove. +- (basic_string::operator=3D(const basic_string&)): Don't dispatch to +- _M_copy_assign. If source object is small just deallocate, otherwise +- perform new allocation before making any changes. +- * include/bits/basic_string.tcc [_GLIBCXX_USE_CXX11_ABI] +- (basic_string::_M_copy_assign(const basic_string&, true_type)): +- Remove. +- * testsuite/21_strings/basic_string/allocator/char/copy_assign.cc: +- Test cases where the allocators are equal or the string is small. +- * testsuite/21_strings/basic_string/allocator/wchar_t/copy_assign.cc: +- Likewise. ++ * crossconfig.m4 (GLIBCXX_CHECK_MATH_DECL): Reject macros. ++ * configure: Rebuild. +=20 +-2017-01-30 Ville Voutilainen ++ * testsuite/27_io/fpos/mbstate_t/1.cc: Zero-init mbstate_t. +=20 +- Implement LWG 2825, LWG 2756 breaks class template argument +- deduction for optional. +- * include/std/optional: Add a deduction guide. +- * testsuite/20_util/optional/cons/deduction_guide.cc: New. ++2020-01-23 Jonathan Wakely +=20 +-2017-01-27 Jonathan Wakely +- +- PR libstdc++/79254 +- * config/abi/pre/gnu.ver: Add new symbols. +- * include/bits/basic_string.h [_GLIBCXX_USE_CXX11_ABI] +- (basic_string::_M_copy_assign): New overloaded functions to perform +- copy assignment. +- (basic_string::operator=3D(const basic_string&)): Dispatch to +- _M_copy_assign. +- * include/bits/basic_string.tcc [_GLIBCXX_USE_CXX11_ABI] +- (basic_string::_M_copy_assign(const basic_string&, true_type)): +- Define, performing rollback on exception. +- * testsuite/21_strings/basic_string/allocator/char/copy_assign.cc: +- Test exception-safety guarantee. +- * testsuite/21_strings/basic_string/allocator/wchar_t/copy_assign.cc: +- Likewise. +- * testsuite/util/testsuite_allocator.h (uneq_allocator::swap): Make +- std::swap visible. +- +-2017-01-26 Jonathan Wakely +- +- PR libstdc++/70607 +- * include/tr1/complex (conj): Remove using-declaration and restore +- overloads, reverting previous change. +- +- * testsuite/23_containers/list/operations/78389.cc: Fix for C++11 +- mode. +- * testsuite/23_containers/priority_queue/requirements/constructible.cc: +- Mark as unsupported in C++98 mode. +- * testsuite/23_containers/queue/requirements/constructible.cc: +- Likewise. +- * testsuite/23_containers/stack/requirements/constructible.cc: +- Likewise. +- * testsuite/25_algorithms/make_heap/movable.cc: Fix for C++11 mode. +- +- PR libstdc++/79243 +- * include/bits/c++config (literals::string_view_literals::__7): Add. +- Only declare versioned namespaces for the relevant C++ dialects. +- * include/experimental/bits/erase_if.h (fundamentals_v2::__detail): +- Add versioning macros. +- * include/experimental/bits/lfts_config.h: +- (fundamentals_v1::__detail::__7, fundamentals_v2::__detail::__7): Add. +- * include/experimental/string_view (fundamentals_v2::__detail): +- Add versioning macros. +- (fundamentals_v2::__detail::__identity): Remove. +- (fundamentals_v2::__detail::__idt): Use common_type instead of +- __detail::__identity. +- * include/std/string_view (__detail::__identity, __detail::__idt): +- Likewise. +- (literals::string_view_literals): Fix nesting of versioning macros. +- +- PR libstdc++/79190 +- * libsupc++/del_opa.cc (operator delete(void*, std::align_val_t)) +- [!_GLIBCXX_HAVE_ALIGNED_ALLOC && !_GLIBCXX_HAVE_POSIX_MEMALIGN +- && !_GLIBCXX_HAVE_MEMALIGN && !_GLIBCXX_HAVE__ALIGNED_MALLOC]: +- Retrieve original pointer value allocated by malloc. +- * libsupc++/new_opa.cc [!_GLIBCXX_HAVE_ALIGNED_ALLOC +- && !_GLIBCXX_HAVE_POSIX_MEMALIGN && !_GLIBCXX_HAVE_MEMALIGN +- && !_GLIBCXX_HAVE__ALIGNED_MALLOC] (aligned_alloc(size_t, size_t)): +- Define, adjusting pointer value allocated by malloc and storing for +- retrieval by operator delete. +- +-2017-01-26 Jakub Jelinek +- +- * libsupc++/eh_atomics.h: Update copyright years. +- * testsuite/20_util/unique_ptr/cons/default.cc: Update copyright years. +- +-2017-01-25 Jonathan Wakely +- +- PR libstdc++/61791 +- PR libstdc++/70607 +- * include/std/complex (real(T), imag(T)): Add _GLIBCXX_CONSTEXPR. +- (proj(T), conj(T)): Change return types per DR 1522. +- * include/tr1/complex (conj): Remove overloads and use std::conj. +- * testsuite/26_numerics/complex/dr781_dr1137.cc: Rename to... +- * testsuite/26_numerics/complex/dr781.cc: ... this, and update. +- * testsuite/26_numerics/complex/value_operations/constexpr2.cc: Test +- real(T) and imag(T). Allow testing for C++11 too. +- +-2017-01-24 Jonathan Wakely +- +- PR libstdc++/79206 +- * include/experimental/string_view (operator=3D=3D): Check sizes first. +- * include/std/string_view (operator=3D=3D): Likewise. +- +-2017-01-23 Jonathan Wakely +- +- * testsuite/experimental/array/make_array.cc: Restore +- inclusion. +- +-2017-01-23 Thomas Preud'homme +- +- * testsuite/29_atomics/atomic/69301.cc: Require atomic builtins. +- +-2017-01-23 Jonathan Wakely +- +- PR libstdc++/79195 +- * include/experimental/array (__make_array_elem): New class template +- and partial specialization. +- (__is_reference_wrapper): Move into __make_array_elem specialization. +- (make_array): Use __make_array_elem to determine element type and move +- static assertion into specialization. Qualify std::forward call. +- (to_array): Add exception specifiation. +- * testsuite/experimental/array/make_array.cc: Test argument types +- without a common type. +- * testsuite/experimental/array/neg.cc: Adjust expected error message. +- +-2017-01-22 Gerald Pfeifer +- +- * doc/xml/manual/debug.xml: code.google.com uses https now. +- +-2017-01-22 Gerald Pfeifer +- +- * doc/xml/manual/test.xml: Fix link into gccint online manual. +- +-2017-01-21 Ville Voutilainen +- +- Make poisoned hashes SFINAE away the call operator of the hash. +- * include/bits/functional_hash.h +- (__poison_hash::__enable_hash_call): New. +- * include/std/optional (__optional_hash_call_base): New. +- (hash>): Derive from the new base, +- move the hash function into that base. +- * include/std/variant (__variant_hash_call_base_impl): New. +- (__variant_hash_call_base): Likewise. +- (hash>): Derive from the new base, +- move the hash function into that base. +- * testsuite/20_util/optional/hash.cc: Add tests for is_callable. +- * testsuite/20_util/variant/hash.cc: Likewise. +- +-2017-01-20 Joe Seymour +- +- * acinclude.m4 (GLIBCXX_CHECK_SIZE_T_MANGLING): Support uint20_t. +- * configure: Regenerate. +- +-2017-01-20 Jonathan Wakely +- +- PR libstdc++/69240 +- * include/bits/random.h (uniform_real_distribution::param_type) +- (normal_distribution::param_type, lognormal_distribution::param_type) +- (gamma_distribution::param_type, chi_squared_distribution::param_type) +- (cauchy_distribution::param_type, fisher_f_distribution::param_type) +- (student_t_distribution::param_type) +- (bernoulli_distribution::param_type, binomial_distribution::param_type) +- (geometric_distribution::param_type) +- (negative_binomial_distribution::param_type) +- (poisson_distribution::param_type) +- (exponential_distribution::param_type) +- (weibull_distribution::param_type) +- (extreme_value_distribution::param_type) +- (discrete_distribution::param_type) +- (piecewise_constant_distribution::param_type) +- (piecewise_linear_distribution::param_type): Define operator!=3D. +- * include/bits/uniform_int_dist.h +- (uniform_int_distribution::param_type): Likewise. +- * include/ext/random (beta_distribution::param_type) +- (rice_distribution::param_type, nakagami_distribution::param_type) +- (pareto_distribution::param_type, k_distribution::param_type) +- (arcsine_distribution::param_type, hoyt_distribution::param_type) +- (triangular_distribution::param_type) +- (von_mises_distribution::param_type) +- (hypergeometric_distribution::param_type) +- (logistic_distribution::param_type) +- (uniform_on_sphere_distribution::param_type) +- (uniform_inside_sphere_distribution::param_type): Likewise. +- * testsuite/26_numerics/random/bernoulli_distribution/cons/parms.cc: +- Test construction with param_type. +- * testsuite/26_numerics/random/binomial_distribution/cons/parms.cc: +- Likewise. +- * testsuite/26_numerics/random/cauchy_distribution/cons/parms.cc: +- Likewise. +- * testsuite/26_numerics/random/chi_squared_distribution/cons/parms.cc: +- Likewise. +- * testsuite/26_numerics/random/exponential_distribution/cons/parms.cc: +- Likewise. +- * testsuite/26_numerics/random/extreme_value_distribution/cons/ +- parms.cc: Likewise. +- * testsuite/26_numerics/random/fisher_f_distribution/cons/parms.cc: +- Likewise. +- * testsuite/26_numerics/random/gamma_distribution/cons/parms.cc: +- Likewise. +- * testsuite/26_numerics/random/geometric_distribution/cons/parms.cc: +- Likewise. +- * testsuite/26_numerics/random/lognormal_distribution/cons/parms.cc: +- Likewise. +- * testsuite/26_numerics/random/negative_binomial_distribution/cons/ +- parms.cc: Likewise. +- * testsuite/26_numerics/random/normal_distribution/cons/parms.cc: +- Likewise. +- * testsuite/26_numerics/random/poisson_distribution/cons/parms.cc: +- Likewise. +- * testsuite/26_numerics/random/student_t_distribution/cons/parms.cc: +- Likewise. +- * testsuite/26_numerics/random/uniform_int_distribution/cons/parms.cc: +- Likewise. +- * testsuite/26_numerics/random/uniform_real_distribution/cons/parms.cc: +- Likewise. +- * testsuite/26_numerics/random/weibull_distribution/cons/parms.cc: +- Likewise. +- * testsuite/ext/random/arcsine_distribution/cons/parms.cc: Likewise. +- * testsuite/ext/random/beta_distribution/cons/parms.cc: Likewise. +- * testsuite/ext/random/hoyt_distribution/cons/parms.cc: Likewise. +- * testsuite/ext/random/hypergeometric_distribution/cons/parms.cc: +- Likewise. +- * testsuite/ext/random/k_distribution/cons/parms.cc: Likewise. +- * testsuite/ext/random/logistic_distribution/cons/parms.cc: Likewise. +- * testsuite/ext/random/nakagami_distribution/cons/parms.cc: Likewise. +- * testsuite/ext/random/normal_mv_distribution/cons/parms.cc: Likewise. +- * testsuite/ext/random/pareto_distribution/cons/parms.cc: Likewise. +- * testsuite/ext/random/rice_distribution/cons/parms.cc: Likewise. +- * testsuite/ext/random/triangular_distribution/cons/parms.cc: +- Likewise. +- * testsuite/ext/random/uniform_inside_sphere_distribution/cons/ +- parms.cc: Likewise. +- * testsuite/ext/random/von_mises_distribution/cons/parms.cc: Likewise. +- +- PR libstdc++/72792 +- * include/bits/alloc_traits.h (__allocator_traits_base::__diff_type) +- (__allocator_traits_base::__size_type): Remove. +- (allocator_traits::_Ptr): New class template to detect const and void +- pointer types without instantiating pointer_traits::rebind +- unnecessarily. +- (allocator_traits::_Diff): Likewise for detecting difference_type. +- (allocator_traits::_Size): New class template to detect size_type +- without instantiating make_unsigned unnecessarily. +- * include/bits/ptr_traits.h (pointer_traits::element_type): Use +- __detected_or_t instead of __detected_or_t_. +- * include/std/type_traits (__detected_or_t_): Remove. +- * testsuite/20_util/allocator_traits/members/pointers.cc: New test. +- +- PR libstdc++/72792 +- PR libstdc++/72793 +- * include/bits/alloc_traits.h (__allocator_traits_base::__rebind): +- Replace with class template using void_t. +- (__alloc_rebind): Define in terms of +- __allocator_traits_base::__rebind. +- (allocator_traits): Remove unconditional static_assert for +- rebind_alloc. +- * include/bits/ptr_traits.h (__replace_first_arg): Remove type member. +- (pointer_traits::__rebind): Replace with class template using void_t. +- (pointer_traits::rebind): Define in terms of __rebind. +- (pointer_traits): Remove unconditional static_assert for rebind. +- * testsuite/20_util/allocator_traits/members/rebind_alloc.cc: New test. +- * testsuite/20_util/pointer_traits/rebind.cc: New test. +- +- PR libstdc++/69321 +- * include/experimental/any (__any_caster): Avoid instantiating +- manager function for types that can't be stored in any. +- * include/std/any (__any_caster): Likewise. +- * testsuite/20_util/any/misc/any_cast.cc: Test non-copyable type. +- * testsuite/experimental/any/misc/any_cast.cc: Likewise. +- +- PR libstdc++/64903 +- * include/bits/stl_algo.h (is_partitioned): Use increment instead of +- std::advance. +- +-2017-01-19 Jonathan Wakely +- +- PR libstdc++/79156 +- * include/bits/shared_ptr_base.h (__enable_shared_from_this_base): +- Fix return type. +- (__enable_shared_from_this): Declare __shared_ptr as a friend. +- * testsuite/ext/shared_ptr/1.cc: New test. +- +- PR libstdc++/64903 +- * include/bits/stl_algo.h (is_partitioned): Don't retest the partition +- point. +- * testsuite/25_algorithms/is_partitioned/2.cc: New test. +- +- * doc/xml/manual/abi.xml: Fix typo. +- * doc/html/manual/abi.html: Likewise. +- +- PR libstdc++/67085 +- * include/bits/predefined_ops.h (_Iter_less_val, _Val_less_iter): Add +- converting constructors from _Iter_less_iter. +- (_Iter_comp_val, _Val_comp_iter): Add converting constructors from +- _Iter_comp_iter. +- (__iter_comp_val(_Iter_comp_iter): Use converting constructor. +- (__val_comp_iter(_Iter_comp_iter): Likewise. +- * include/bits/stl_heap.h (__is_heap_until, __push_heap, __pop_heap) +- (__make_heap, __sort_heap): Change _Compare parameters to references. +- (__is_heap, push_heap, __adjust_heap, __pop_heap, pop_heap) +- (__make_heap, make_heap, sort_heap, is_heap_until): Pass comparison +- functions as lvalues. +- (is_heap): Call __is_heap_until directly to avoid copying __comp. +- * testsuite/23_containers/priority_queue/67085.cc: Adjust test to +- count copies during construction with empty sequence. +- +- PR libstdc++/67085 +- * include/bits/stl_heap.h (__is_heap): Use _GLIBCXX_MOVE. +- (__make_heap, __sort_heap): Don't use _GLIBCXX_MOVE inside loops. +- * testsuite/23_containers/priority_queue/67085.cc: Adjust expected +- number of copies. +- * testsuite/25_algorithms/make_heap/movable.cc: New test. +- +- PR libstdc++/67085 +- * include/bits/stl_heap.h (push_heap, __adjust_heap, __pop_heap) +- (pop_heap, __make_heap, make_heap, __sort_heap, sort_heap): Use +- _GLIBCXX_MOVE when passing comparison function to other functions. +- (is_heap_until, is_heap): Use std::move when passing comparison +- function. +- * testsuite/23_containers/priority_queue/67085.cc: New test. +- +- PR libstdc++/78905 +- * doc/xml/manual/abi.xml (abi.versioning.history): Add markup to +- macro names, filenames, and literal values. Document _GLIBCXX_RELEASE. +- Document that the deprecated _GLIBCXX_VERSION macro was removed for +- the 4.0.0 release. +- * doc/html/*: Regenerate. +- * include/Makefile.am (_GLIBCXX_RELEASE): Set value. ++ PR libstdc++/91947 ++ * include/Makefile.am (${host_builddir}/largefile-config.h): Simplify ++ rule. + * include/Makefile.in: Regenerate. +- * include/bits/c++config (_GLIBCXX_RELEASE): Add #define. +- * testsuite/ext/profile/mutex_extensions_neg.cc: Use lineno of 0 in +- dg-error. +- +-2017-01-18 Jonathan Wakely +- +- PR libstdc++/69301 +- * include/std/atomic (atomic::load, atomic::exchange): Use +- aligned buffer instead of default-initialized variable. +- * testsuite/29_atomics/atomic/69301.cc: New test. +- * include/experimental/memory (observer_ptr::release): Use reserved +- name. +- * include/ext/pointer.h (_Pointer_adapter::operator++(int)) +- (_Pointer_adapter::operator--(int)): Likewise. +- +- PR libstdc++/68925 +- * include/experimental/random (randint): Use temporary instead of +- thread_local static. +- +-2017-01-17 Joshua Conner +- +- * crossconfig.m4: Add fuchsia OS. +- * configure: Regenerate. +- +-2017-01-17 Jonathan Wakely +- +- PR libstdc++/69699 +- * doc/xml/manual/abi.xml (abi.versioning.history): Explain why the +- __GLIBCXX__ macro is not useful. Remove redundant date information +- and link to the GCC release timeline. +- (abi.versioning.active): Move partial sentence into the previous +- paragraph. +- * doc/html/*: Regenerate. +- +- PR libstdc++/79114 +- * libsupc++/nested_exception.h (throw_with_nested): Use decay instead +- of remove_reference. +- * testsuite/18_support/nested_exception/79114.cc: New test. +- +-2017-01-17 Jakub Jelinek +- +- PR other/79046 +- * configure.ac: Add GCC_BASE_VER. +- * fragment.am (gcc_version): Use @get_gcc_base_ver@ instead of cat to +- get version from BASE-VER file. +- * po/Makefile.in: Regenerated. +- * libsupc++/Makefile.in: Regenerated. +- * testsuite/Makefile.in: Regenerated. +- * src/Makefile.in: Regenerated. +- * configure: Regenerated. +- * Makefile.in: Regenerated. +- * include/Makefile.in: Regenerated. +- * doc/Makefile.in: Regenerated. +- * python/Makefile.in: Regenerated. +- * src/c++11/Makefile.in: Regenerated. +- * src/c++98/Makefile.in: Regenerated. +- * src/filesystem/Makefile.in: Regenerated. +- +-2017-01-16 Jonathan Wakely +- +- PR libstdc++/66145 +- * src/c++11/functexcept.cc: Use new ABI for std::ios_base::failure +- exceptions. +- * testsuite/27_io/basic_ios/copyfmt/char/1.cc: Don't override ABI +- for test, so new ios::failure can be caught. +- * testsuite/27_io/basic_ios/exceptions/char/1.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_arithmetic/char/ +- exceptions_failbit.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_arithmetic/wchar_t/ +- exceptions_failbit.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_other/char/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/basic_istream/extractors_other/wchar_t/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/basic_istream/sentry/char/12297.cc: Likewise. +- * testsuite/27_io/basic_istream/sentry/wchar_t/12297.cc: Likewise. +- * testsuite/27_io/basic_ostream/inserters_other/char/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/basic_ostream/inserters_other/wchar_t/ +- exceptions_null.cc: Likewise. +- * testsuite/27_io/ios_base/storage/2.cc: Likewise. +- +- PR libstdc++/78702 +- * include/bits/locale_classes.h (locale::facet::__shim): Change from +- private to protected. +- * src/c++11/cxx11-shim_facets.cc (__shim_accessor): Define helper to +- make locale::facet::__shim accessible. +- +-2017-01-16 Ville Voutilainen +- +- PR libstdc++/78389 +- * include/bits/list.tcc (merge(list&&)): Fix backwards size adjustments. +- (merge(list&&, _StrictWeakOrdering)): Likewise. +- * testsuite/23_containers/list/operations/78389.cc: Add +- better test for the sizes. +- +-2017-01-14 Jonathan Wakely +- +- * testsuite/23_containers/array/specialized_algorithms/swap_cxx17.cc: +- Skip test when -D_GLIBCXX_PROFILE mode is included in options. +- * testsuite/23_containers/map/modifiers/extract.cc: Likewise. +- * testsuite/23_containers/map/modifiers/insert_or_assign/1.cc: +- Likewise. +- * testsuite/23_containers/map/modifiers/try_emplace/1.cc: Likewise. +- * testsuite/23_containers/multimap/modifiers/extract.cc: Likewise. +- * testsuite/23_containers/multiset/modifiers/extract.cc: Likewise. +- * testsuite/23_containers/set/modifiers/extract.cc: Likewise. +- * testsuite/23_containers/unordered_map/modifiers/extract.cc: +- Likewise. +- * testsuite/23_containers/unordered_multimap/modifiers/extract.cc:: +- Likewise. +- * testsuite/23_containers/unordered_multiset/modifiers/extract.cc:: +- Likewise. +- * testsuite/23_containers/unordered_set/modifiers/extract.cc: +- Likewise. +- * testsuite/23_containers/vector/modifiers/insert_vs_emplace.cc: +- Likewise. +- * testsuite/25_algorithms/binary_search/partitioned.cc: Likewise. +- * testsuite/25_algorithms/equal_range/partitioned.cc: Likewise. +- * testsuite/25_algorithms/lexicographical_compare/71545.cc: Likewise. +- * testsuite/25_algorithms/lower_bound/partitioned.cc: Likewise. +- * testsuite/25_algorithms/upper_bound/partitioned.cc: Likewise. +- * testsuite/libstdc++-prettyprinters/cxx11.cc: Likewise. +- * testsuite/libstdc++-prettyprinters/cxx17.cc: Likewise. +- * testsuite/libstdc++-prettyprinters/debug.cc: Likewise. +- * testsuite/libstdc++-prettyprinters/debug_cxx11.cc: Likewise. +- * testsuite/libstdc++-prettyprinters/libfundts.cc: Likewise. +- * testsuite/libstdc++-prettyprinters/simple.cc: Likewise. +- * testsuite/libstdc++-prettyprinters/simple11.cc: Likewise. +- * testsuite/libstdc++-prettyprinters/whatis.cc: Likewise. +- +-2017-01-13 Jonathan Wakely +- +- PR libstdc++/65411 +- * config/io/basic_file_stdio.cc (__basic_file::close()): Don't +- retry fclose on EINTR. +=20 +- * include/profile/base.h: Remove unused header that leads to header +- cycle in C++17 mode. ++2020-01-20 Jonathan Wakely +=20 +- PR libstdc++/79075 +- * include/bits/basic_string.h [_GLIBCXX_USE_CXX11_ABI] (basic_string): +- Make _If_sv private. +- [!_GLIBCXX_USE_CXX11_ABI] (basic_string): Add member functions taking +- basic_string_view arguments. +- +- PR libstdc++/79075 +- * testsuite/lib/libstdc++.exp (check_v3_target_filesystem_ts): Remove +- redundant option from cxxflags. +- (check_effective_target_cxx11-abi): Define. +- * testsuite/21_strings/basic_string/allocator/71964.cc: Use cxx11-abi +- effective target. +- * testsuite/21_strings/basic_string/allocator/char/copy.cc: Likewise. +- * testsuite/21_strings/basic_string/allocator/char/copy_assign.cc: +- Likewise. +- * testsuite/21_strings/basic_string/allocator/char/minimal.cc: +- Likewise. +- * testsuite/21_strings/basic_string/allocator/char/move.cc: Likewise. +- * testsuite/21_strings/basic_string/allocator/char/move_assign.cc: +- Likewise. +- * testsuite/21_strings/basic_string/allocator/char/noexcept.cc: +- Likewise. +- * testsuite/21_strings/basic_string/allocator/char/swap.cc: Likewise. +- * testsuite/21_strings/basic_string/allocator/wchar_t/copy.cc: +- Likewise. +- * testsuite/21_strings/basic_string/allocator/wchar_t/copy_assign.cc: +- Likewise. +- * testsuite/21_strings/basic_string/allocator/wchar_t/minimal.cc: +- Likewise. +- * testsuite/21_strings/basic_string/allocator/wchar_t/move.cc: +- Likewise. +- * testsuite/21_strings/basic_string/allocator/wchar_t/move_assign.cc: +- Likewise. +- * testsuite/21_strings/basic_string/allocator/wchar_t/noexcept.cc: +- Likewise. +- * testsuite/21_strings/basic_string/allocator/wchar_t/swap.cc: +- Likewise. +- * testsuite/23_containers/list/61347.cc: Likewise. +- * testsuite/27_io/basic_fstream/cons/base.cc: Likewise. +- * testsuite/27_io/ios_base/failure/cxx11.cc: Likewise. +- +-2017-01-13 Ville Voutilainen +- +- PR libstdc++/78389 +- * include/bits/list.tcc (merge(list&&)): +- Adjust list sizes if the comparator throws. +- (merge(list&&, _StrictWeakOrdering)): Likewise. +- (sort()): Splice elements back from the scratch buffers +- if the comparator throws. +- (sort(_StrictWeakOrdering)): Likewise. +- * testsuite/23_containers/list/operations/78389.cc: New. +- +-2017-01-13 Jonathan Wakely +- +- * testsuite/23_containers/unordered_set/allocator/ext_ptr.cc: Mark +- XFAIL for C++17 until node reinsertion supports fancy pointers. +- +- PR libstdc++/78361 +- * testsuite/20_util/add_pointer/value.cc: Test forming function +- pointers. +- +-2017-01-13 Michael Brune +- +- PR libstdc++/78361 +- * include/std/type_traits (__is_referenceable): Handle noexcept +- function types. +- +-2017-01-12 Jonathan Wakely +- +- PR libstdc++/77528 +- * include/bits/stl_queue.h (queue, priority_queue): Remove default +- member-initializers and define default constructors as templates with +- constraints. +- * include/bits/stl_stack.h (stack): Likewise. +- * testsuite/23_containers/priority_queue/requirements/constructible.cc: +- New. +- * testsuite/23_containers/priority_queue/requirements/ +- explicit_instantiation/1.cc: Test more instantiations. +- * testsuite/23_containers/priority_queue/requirements/ +- explicit_instantiation/1_c++98.cc: Likewise. +- * testsuite/23_containers/queue/requirements/constructible.cc: New. +- * testsuite/23_containers/stack/requirements/constructible.cc: New. +- +- PR libstdc++/66284 +- * doc/xml/manual/intro.xml: Document LWG 2781 change. ++ * doc/xml/faq.xml: Fix grammar. ++ * doc/xml/manual/appendix_contributing.xml: Improve instructions. ++ * doc/xml/manual/spine.xml: Update copyright years. + * doc/html/*: Regenerate. +- * include/std/functional (_Function_base::_Ref_manager): Remove. +- (_Function_handler): Remove partial specializations for +- reference_wrapper. +- (function::target): Remove special case for const qualification. +- * testsuite/20_util/function/6.cc: Adjust tests for target type. +- * testsuite/20_util/function/7.cc: Likewise. +- * testsuite/20_util/function/8.cc: Likewise. +- +-2017-01-11 Jonathan Wakely +- +- PR libstdc++/78134 +- * include/bits/stl_map.h (map::lower_bound, map::upper_bound) +- (map::equal_range): Fix return type of heterogeneous overloads. +- * include/bits/stl_multimap.h (multimap::lower_bound) +- (multimap::upper_bound, multimap::equal_range): Likewise. +- * include/bits/stl_multiset.h (multiset::lower_bound) +- (multiset::upper_bound, multiset::equal_range): Likewise. +- * include/bits/stl_set.h (set::lower_bound, set::upper_bound) +- (set::equal_range): Likewise. +- * testsuite/23_containers/map/operations/2.cc +- * testsuite/23_containers/multimap/operations/2.cc +- * testsuite/23_containers/multiset/operations/2.cc +- * testsuite/23_containers/set/operations/2.cc +- +- PR libstdc++/78273 +- * include/bits/stl_map.h (map::count<_Kt>(const _Kt&)): Don't assume +- the heterogeneous comparison can only find one match. +- * include/bits/stl_set.h (set::count<_Kt>(const _Kt&)): Likewise. +- * testsuite/23_containers/map/operations/2.cc: Test count works with +- comparison function that just partitions rather than sorting. +- * testsuite/23_containers/set/operations/2.cc: Likewise. +- +-2017-01-11 Ville Voutilainen +=20 +- Reduce the size of variant, it doesn't need an index of +- type size_t internally. +- * include/std/variant (parse_numbers.h): New include. +- (__select_index): New. +- (_Variant_storage::_M_reset_impl): Use +- _index_type for comparison with variant_npos. +- (_Variant_storage::__index_type): New. +- (_Variant_storage::_M_index): Change the +- type from size_t to __index_type. +- (_Variant_storage::__index_type): New. +- (_Variant_storage::_M_index): Change the +- type from size_t to __index_type. +- (_Variant_base::_M_valid): Use _Storage::__index_type +- for comparison with variant_npos. +- (variant::index): Use _Base::_Storage::__index_type +- for comparison with variant_npos. +- * testsuite/20_util/variant/index_type.cc: New. ++2020-01-19 Eric S. Raymond +=20 +-2017-01-10 Jonathan Wakely ++ * doc/xml/faq.xml: Update for SVN -> Git transition. ++ * doc/xml/manual/appendix_contributing.xml: Likewise. ++ * doc/xml/manual/status_cxx1998.xml: Likewise. ++ * doc/xml/manual/status_cxx2011.xml: Likewise. ++ * doc/xml/manual/status_cxx2014.xml: Likewise. ++ * doc/xml/manual/status_cxx2017.xml: Likewise. ++ * doc/xml/manual/status_cxx2020.xml: Likewise. ++ * doc/xml/manual/status_cxxtr1.xml: Likewise. ++ * doc/xml/manual/status_cxxtr24733.xml: Likewise. +=20 +- * testsuite/18_support/exception_ptr/60612-unexpected.cc: Adjust +- effective target selector to prevent running in C++17 mode. ++2020-01-18 Iain Sandoe +=20 +- PR libstdc++/77528 +- * include/bits/stl_queue.h (queue::c): Add default member initializer. +- (queue::queue()): Add constructor and define as defaulted. +- (queue::queue(_Sequence&&)): Remove default argument. +- (priority_queue::c, priority_queue::comp): Add default member +- initializers. +- (priority_queue::priority_queue()): Add constructor and define as +- defaulted. +- (priority_queue::priority_queue(const _Compare&, _Sequence&&)): +- Remove default argument for first parameter. +- * include/bits/stl_stack.h (stack::c): Add default member initializer. +- (stack::stack()): Add constructor and define as defaulted. +- (stack::stack(const _Sequence&)): Remove default argument. +- * testsuite/23_containers/priority_queue/requirements/ +- explicit_instantiation/1.cc: Test explicit instantiation with +- non-DefaultConstructible sequence. +- * testsuite/23_containers/priority_queue/77528.cc: New test. +- * testsuite/23_containers/priority_queue/requirements/ +- explicit_instantiation/1_c++0x.cc: Replace with 1_c++98.cc. +- * testsuite/23_containers/queue/77528.cc: New test. +- * testsuite/23_containers/queue/requirements/explicit_instantiation/ +- 1.cc: Test explicit instantiation with non-DefaultConstructible +- sequence. +- * testsuite/23_containers/queue/requirements/explicit_instantiation/ +- 1_c++0x.cc: Replace with 1_c++98.cc. +- * testsuite/23_containers/stack/77528.cc: New test. +- * testsuite/23_containers/stack/requirements/explicit_instantiation/ +- 1.cc: Test explicit instantiation with non-DefaultConstructible +- sequence. +- * testsuite/23_containers/stack/requirements/explicit_instantiation/ +- 1_c++0x.cc: Replace with 1_c++98.cc. ++ * include/Makefile.am: Add coroutine to the std set. ++ * include/Makefile.in: Regenerated. ++ * include/std/coroutine: New file. +=20 +-2017-01-10 Felipe Magno de Almeida ++2020-01-17 Jonathan Wakely +=20 +- * include/bits/locale_facets_nonio.tcc +- (time_get::_M_extract_via_format): Avoid compilation errors with +- non-standard struct tm. ++ PR libstdc++/92376 ++ * include/bits/c++config: Only do PSTL config when the header is ++ present, to fix freestanding. ++ * libsupc++/new_opa.cc [!_GLIBCXX_HOSTED]: Declare allocation ++ functions if they were detected by configure. +=20 +-2017-01-10 Fran=C3=A7ois Dumont ++2020-01-16 Kai-Uwe Eckhardt ++ Matthew Bauer + Jonathan Wakely +=20 +- * python/libstdcxx/v6/printers.py (_versioned_namespace): Define. +- (is_specialization, strip_versioned_namespace): New helpers functions +- to work with symbols in the versioned namespace. +- (Printer.add_version): Add second name using versioned namespace. +- (add_one_template_type_printer, add_one_type_printer): Add second +- type printers using versioned namespace. +- (register_type_printers): Add template type printer for basic_string. +- (build_libstdcxx_dictionary): Remove dead code. +- * python/libstdcxx/v6/xmethods.py: Make all matchers look for +- versioned namespace. +- * testsuite/libstdc++-prettyprinters/48362.cc: Adjust expected +- results. +- * testsuite/libstdc++-prettyprinters/whatis.cc: Likewise. +- +-2017-01-09 Jonathan Wakely +- +- PR libstdc++/79017 +- * acinclude.m4 (GLIBCXX_CHECK_C99_TR1): Check for llrint and llround +- functions separately on darwin and if they're missing define +- _GLIBCXX_NO_C99_ROUNDING_FUNCS. +- * config.h.in: Regenerate. +- * configure: Regenerate. +- * include/c_global/cmath [_GLIBCXX_NO_C99_ROUNDING_FUNCS] (llrint) +- (llrintf, llrintl, llround, llroundf, llroundl): Do not define. +- +- * testsuite/30_threads/condition_variable/members/3.cc: Use new macro +- to detect correct thread_local destructors. +- * testsuite/util/testsuite_hooks.h (CORRECT_THREAD_LOCAL_DTORS): ++ PR bootstrap/64271 (partial) ++ * config/os/bsd/netbsd/ctype_base.h (ctype_base::mask): Change type ++ to unsigned short. ++ (ctype_base::alpha, ctype_base::digit, ctype_base::xdigit) ++ (ctype_base::print, ctype_base::graph, ctype_base::alnum): Sync ++ definitions with NetBSD upstream. ++ (ctype_base::blank): Use _CTYPE_BL. ++ * config/os/bsd/netbsd/ctype_configure_char.cc (_C_ctype_): Remove ++ Declaration. ++ (ctype::classic_table): Use _C_ctype_tab_ instead of _C_ctype_. ++ (ctype::do_toupper, ctype::do_tolower): Cast char ++ parameters to unsigned char. ++ * config/os/bsd/netbsd/ctype_inline.h (ctype::is): Likewise. ++ ++2020-01-16 Fran=C3=A7ois Dumont ++ ++ PR libstdc++/91263 ++ * include/bits/hashtable.h (_Hashtable<>): Make _Equality<> friend. ++ * include/bits/hashtable_policy.h: Include . ++ (_Equality_base): Remove. ++ (_Equality<>::_M_equal): Review implementation. Use ++ std::is_permutation. ++ * testsuite/23_containers/unordered_multiset/operators/1.cc ++ (Hash, Equal, test02, test03): New. ++ * testsuite/23_containers/unordered_set/operators/1.cc ++ (Hash, Equal, test02, test03): New. ++ ++2020-01-15 Jonathan Wakely ++ ++ PR libstdc++/93267 ++ * include/bits/iterator_concepts.h (__max_diff_type, __max_size_type): ++ Move here from and define using __int128 when ++ available. ++ (__is_integer_like, __is_signed_integer_like): Move here from ++ . ++ (weakly_incrementable): Use __is_signed_integer_like. ++ * include/bits/range_access.h (__max_diff_type, __max_size_type) ++ (__is_integer_like, __is_signed_integer_like): Move to ++ . ++ (__make_unsigned_like_t): Move here from . ++ * include/std/ranges (__make_unsigned_like_t): Move to ++ . ++ (iota_view): Replace using-directive with using-declarations. ++ * testsuite/std/ranges/iota/93267.cc: New test. ++ * testsuite/std/ranges/iota_view.cc: Move to new 'iota' sub-directory. ++ ++2020-01-13 Jonathan Wakely ++ ++ PR libstdc++/93244 ++ * include/bits/fs_path.h (path::generic_string) ++ [_GLIBCXX_FILESYSTEM_IS_WINDOWS]: Convert root-dir to forward-slash. ++ * testsuite/27_io/filesystem/path/generic/generic_string.cc: Check ++ root-dir is converted to forward slash in generic pathname. ++ * testsuite/27_io/filesystem/path/generic/utf.cc: New test. ++ * testsuite/27_io/filesystem/path/generic/wchar_t.cc: New test. ++ ++ PR libstdc++/58605 ++ * include/bits/atomic_base.h (__cpp_lib_atomic_value_initialization): + Define. +- +-2017-01-09 Jonathan Wakely +- Aditya Kumar +- +- PR libstdc++/66414 +- * include/bits/basic_string.tcc +- (basic_string::find(const CharT*, size_type, size_type)): Optimize. +- +-2017-01-06 Jonathan Wakely +- +- * testsuite/21_strings/basic_string/operations/find/char/6.cc: New. +- * testsuite/21_strings/basic_string/operations/find/wchar_t/6.cc: New. +- +- * testsuite/util/performance/priority_queue/mem_usage/pop_test.hpp: +- Include header. +- +- PR libstdc++/78968 +- * crossconfig.m4: Check for __cxa_thread_atexit on *-*-freebsd*. +- * configure: Regenerate. +- +-2017-01-06 Barrett Adair +- Jonathan Wakely +- +- * include/std/variant (variant, swap): Replace __and_ usage with fold +- expressions. +- +-2017-01-06 Rainer Orth +- +- PR go/78978 +- * acinclude.m4 (GLIBCXX_CHECK_ASSEMBLER_HWCAP): Remove. +- * configure.ac: Call GCC_CHECK_ASSEMBLER_HWCAP instead of +- GLIBCXX_CHECK_ASSEMBLER_HWCAP. +- * fragment.am (CONFIG_CXXFLAGS): Use HWCAP_CFLAGS instead of +- HWCAP_FLAGS. +- * aclocal.m4: Regenerate. +- * configure: Regenerate. +- * Makefile.in, doc/Makefile.in, include/Makefile.in, +- libsupc++/Makefile.in, po/Makefile.in, python/Makefile.in, +- src/Makefile.in, src/c++11/Makefile.in, src/c++98/Makefile.in, +- src/filesystem/Makefile.in, testsuite/Makefile.in: Regenerate. +- +-2017-01-06 Jonathan Wakely +- +- * include/bits/c++config (_GLIBCXX_ASSERTIONS): Avoid redefinition. +- +- PR libstdc++/78991 +- * include/bits/predefined_ops.h (_Iter_comp_iter, _Iter_comp_val) +- (_Val_comp_iter, _Iter_equals_val, _Iter_pred, _Iter_comp_to_val) +- (_Iter_comp_to_iter, _Iter_negate): Make constructors explicit and +- move function objects. +- (__iter_comp_iter, __iter_comp_val, __val_comp_iter, __pred_iter) +- (__iter_comp_val, __iter_comp_iter, __negate): Move function objects. +- * testsuite/25_algorithms/sort/78991.cc: New test. +- +-2017-01-05 Jonathan Wakely +- +- * include/bits/std_function.h (function::_Signature_type): Remove. +- (function::function(_Functor)): Adjust. +- +-2017-01-05 Tim Shen +- +- PR libstdc++/78996 +- * include/std/variant (__gen_vtable_impl): rename __unused to +- __dimensions to avoid naming conflict. +- +-2017-01-04 Jonathan Wakely +- +- PR libstdc++/78968 +- * config.h.in: Regenerate. +- * configure: Likewise. +- * configure.ac: Check for __cxa_thread_atexit. +- * libsupc++/atexit_thread.cc [_GLIBCXX_HAVE___CXA_THREAD_ATEXIT]: +- Don't define __cxa_thread_atexit if libc provides it. +- +-2017-01-04 Ville Voutilainen +- +- Implement 2801, Default-constructibility of unique_ptr. +- * include/bits/unique_ptr.h (__uniq_ptr_impl::_DeleterConstraint): New. +- (unique_ptr::_DeleterConstraint): Likewise. +- (unique_ptr()): Constrain. +- (unique_ptr(pointer)): Likewise. +- (unique_ptr(nullptr_t)): Likewise. +- (unique_ptr<_Tp[], _Dp>::_DeleterConstraint): New. +- (unique_ptr<_Tp[], _Dp>::unique_ptr()): Constrain. +- (unique_ptr<_Tp[], _Dp>::unique_ptr(_Up)): Likewise. +- (unique_ptr<_Tp[], _Dp>::unique_ptr(nullptr_t)): Likewise. +- * testsuite/20_util/unique_ptr/assign/48635_neg.cc: Adjust. +- * testsuite/20_util/unique_ptr/cons/cv_qual_neg.cc: Likewise. +- * testsuite/20_util/unique_ptr/cons/default.cc: New. +- * testsuite/20_util/unique_ptr/cons/ptr_deleter_neg.cc: Adjust. +- +-2017-01-04 Pauli Nieminen +- Jonathan Wakely +- +- PR libstdc++/64735 +- * acinclude.m4 (GLIBCXX_CHECK_EXCEPTION_PTR_SYMVER): Define. +- * config.h.in: Regenerate. +- * config/abi/pre/gnu.ver [HAVE_EXCEPTION_PTR_SINCE_GCC46] +- (GLIBCXX_3.4.15, GLIBCXX_3.4.21, CXXABI_1.3.3, CXXABI_1.3.5): Make +- exports for exception_ptr, nested_exception, and future conditional. +- [HAVE_EXCEPTION_PTR_SINCE_GCC46] (GLIBCXX_3.4.23, CXXABI_1.3.11): Add +- exports for exception_ptr, nested_exception, and future conditional. +- * configure: Regenerate. +- * configure.ac: Use GLIBCXX_CHECK_EXCEPTION_PTR_SYMVER. +- * include/std/future: Remove check for ATOMIC_INT_LOCK_FREE +- * libsupc++/eh_atomics.h: New file for internal use only. +- (__eh_atomic_inc, __eh_atomic_dec): New. +- * libsupc++/eh_ptr.cc (exception_ptr::_M_addref) +- (exception_ptr::_M_release) (__gxx_dependent_exception_cleanup) +- (rethrow_exception): Use eh_atomics.h reference counting helpers. +- * libsupc++/eh_throw.cc (__gxx_exception_cleanup): Likewise. +- * libsupc++/eh_tm.cc (free_any_cxa_exception): Likewise. +- * libsupc++/exception: Remove check for ATOMIC_INT_LOCK_FREE. +- * libsupc++/exception_ptr.h: Likewise. +- * libsupc++/guard.cc: Include header for ATOMIC_INT_LOCK_FREE macro. +- * libsupc++/nested_exception.cc: Remove check for +- ATOMIC_INT_LOCK_FREE. +- * libsupc++/nested_exception.h: Likewise. +- * src/c++11/future.cc: Likewise. +- * testsuite/18_support/exception_ptr/*: Remove atomic builtins checks. +- * testsuite/18_support/nested_exception/*: Likewise. +- * testsuite/30_threads/async/*: Likewise. +- * testsuite/30_threads/future/*: Likewise. +- * testsuite/30_threads/headers/future/types_std_c++0x.cc: Likewise. +- * testsuite/30_threads/packaged_task/*: Likewise. +- * testsuite/30_threads/promise/*: Likewise. +- * testsuite/30_threads/shared_future/*: Likewise. +- +-2017-01-03 Gerald Pfeifer +- +- * doc/xml/manual/documentation_hacking.xml: sourceforge.net now +- defaults to https; adjust reference. +- +-2017-01-03 Jonathan Wakely +- +- PR libstdc++/78956 +- * include/std/thread (thread(const thread&&)): Add deleted +- constructor. +- * testsuite/30_threads/thread/cons/lwg2097.cc: New test. +- +- * doc/xml/manual/spine.xml: Update copyright years. +- * doc/xml/manual/build_hacking.xml: Fix spelling of libbuilddir. +- * doc/xml/manual/test.xml: Likewise. +- * doc/html/*: Regenerate. +- +-2017-01-01 Gerald Pfeifer +- +- * doc/xml/faq.xml: Update address of C++ ABI link. +- * doc/xml/manual/abi.xml: Ditto. +- +-2017-01-01 Jakub Jelinek ++ (__atomic_flag_base, __atomic_base, __atomic_base<_PTp*>) ++ (__atomic_float): Add default member initializer for C++20. ++ * include/std/atomic (atomic): Likewise. ++ (atomic::atomic()): Remove noexcept-specifier on default constructor. ++ * include/std/version (__cpp_lib_atomic_value_initialization): Define. ++ * testsuite/29_atomics/atomic/cons/assign_neg.cc: Adjust dg-error line ++ number. ++ * testsuite/29_atomics/atomic/cons/copy_neg.cc: Likewise. ++ * testsuite/29_atomics/atomic/cons/value_init.cc: New test. ++ * testsuite/29_atomics/atomic_flag/cons/value_init.cc: New test. ++ * testsuite/29_atomics/atomic_flag/requirements/trivial.cc: Adjust ++ expected result for is_trivially_default_constructible. ++ * testsuite/29_atomics/atomic_float/requirements.cc: Likewise. ++ * testsuite/29_atomics/atomic_float/value_init.cc: New test. ++ * testsuite/29_atomics/atomic_integral/cons/assign_neg.cc: Likewise. ++ * testsuite/29_atomics/atomic_integral/cons/copy_neg.cc: Likewise. ++ * testsuite/29_atomics/atomic_integral/cons/value_init.cc ++ * testsuite/29_atomics/atomic_integral/requirements/trivial.cc: Adjust ++ expected results for is_trivially_default_constructible. ++ * testsuite/util/testsuite_common_types.h (has_trivial_dtor): Add ++ new test generator. ++ ++2020-01-10 Jonathan Wakely ++ ++ * testsuite/util/testsuite_iterators.h: Improve comment. ++ ++ * testsuite/25_algorithms/equal/deque_iterators/1.cc: Don't use C++11 ++ initialization syntax. ++ ++ PR libstdc++/92285 ++ * include/bits/streambuf_iterator.h (istreambuf_iterator): Make type ++ of base class independent of __cplusplus value. ++ [__cplusplus < 201103L] (istreambuf_iterator::reference): Override the ++ type defined in the base class ++ * testsuite/24_iterators/istreambuf_iterator/92285.cc: New test. ++ * testsuite/24_iterators/istreambuf_iterator/requirements/ ++ base_classes.cc: Adjust expected base class for C++98. ++ ++2020-01-09 Olivier Hainque ++ ++ * doc/xml/manual/appendix_contributing.xml: Document _C2 ++ as a reserved identifier, by VxWorks. ++ * include/bits/stl_map.h: Rename _C2 template typenames as _Cmp2. ++ * include/bits/stl_multimap.h: Likewise. ++ ++2020-01-09 Jonathan Wakely ++ ++ * include/ext/extptr_allocator.h (_ExtPtr_allocator::operator=3D=3D) ++ (_ExtPtr_allocator::operator!=3D): Add missing const qualifiers. ++ * include/ext/pointer.h (readable_traits<_Pointer_adapter>): Add ++ partial specialization to disambiguate the two constrained ++ specializations. ++ ++ * include/experimental/type_traits (experimental::is_pod_v): Disable ++ -Wdeprecated-declarations warnings around reference to std::is_pod. ++ * include/std/type_traits (is_pod_v): Likewise. ++ * testsuite/18_support/max_align_t/requirements/2.cc: Also check ++ is_standard_layout and is_trivial. Do not check is_pod for C++20. ++ * testsuite/20_util/is_pod/requirements/explicit_instantiation.cc: ++ Add -Wno-deprecated for C++20. ++ * testsuite/20_util/is_pod/requirements/typedefs.cc: Likewise. ++ * testsuite/20_util/is_pod/value.cc: Likewise. ++ * testsuite/experimental/type_traits/value.cc: Likewise. ++ ++2020-01-09 JeanHeyd "ThePhD" Meneide ++ ++ * include/bits/c++config (_GLIBCXX20_DEPRECATED): Add new macro. ++ * include/std/type_traits (is_pod, is_pod_v): Deprecate for C++20. ++ * testuite/20_util/is_pod/deprecated-2a.cc: New test. ++ ++2020-01-09 Jonathan Wakely ++ ++ PR libstdc++/93205 ++ * include/bits/random.h (operator>>): Check stream operation succeeds. ++ * include/bits/random.tcc (operator<<): Remove redundant __ostream_type ++ typedefs. ++ (operator>>): Remove redundant __istream_type typedefs. Check stream ++ operations succeed. ++ (__extract_params): New function to fill a vector from a stream. ++ * testsuite/26_numerics/random/pr60037-neg.cc: Adjust dg-error line. ++ ++ PR libstdc++/93208 ++ * config/abi/pre/gnu.ver: Add new exports. ++ * include/std/memory_resource (memory_resource::~memory_resource()): ++ Do not define inline. ++ (monotonic_buffer_resource::~monotonic_buffer_resource()): Likewise. ++ * src/c++17/memory_resource.cc (memory_resource::~memory_resource()): ++ Define. ++ (monotonic_buffer_resource::~monotonic_buffer_resource()): Define. ++ * testsuite/20_util/monotonic_buffer_resource/93208.cc: New test. ++ ++2020-01-09 Fran=C3=A7ois Dumont ++ ++ PR libstdc++/92124 ++ * include/bits/hashtable.h (_Hashtable<>::__alloc_node_gen_t): New ++ template alias. ++ (_Hashtable<>::__fwd_value_for): New. ++ (_Hashtable<>::_M_assign_elements<>): Remove _NodeGenerator template ++ parameter. ++ (_Hashtable<>::_M_assign<>): Add _Ht template parameter. ++ (_Hashtable<>::operator=3D(const _Hashtable<>&)): Adapt. ++ (_Hashtable<>::_M_move_assign): Adapt. Replace std::move_if_noexcept ++ with std::move. ++ (_Hashtable<>::_Hashtable(const _Hashtable&)): Adapt. ++ (_Hashtable<>::_Hashtable(const _Hashtable&, const allocator_type&)): ++ Adapt. ++ (_Hashtable<>::_Hashtable(_Hashtable&&, const allocator_type&)): ++ Adapt. ++ * testsuite/23_containers/unordered_set/92124.cc: New. ++ ++2020-01-08 Jonathan Wakely ++ ++ PR libstdc++/93201 ++ * src/c++17/fs_ops.cc (do_remove_all): New function implementing more ++ detailed error reporting for remove_all. Check result of recursive ++ call before incrementing iterator. ++ (remove_all(const path&), remove_all(const path&, error_code&)): Use ++ do_remove_all. ++ * src/filesystem/ops.cc (remove_all(const path&, error_code&)): Check ++ result of recursive call before incrementing iterator. ++ * testsuite/27_io/filesystem/operations/remove_all.cc: Check errors ++ are reported correctly. ++ * testsuite/experimental/filesystem/operations/remove_all.cc: Likewise. ++ ++2020-01-07 Thomas Rodgers ++ ++ * include/std/condition_variable ++ (condition_variable_any::wait_on): Rename to match current draft ++ standard. ++ (condition_variable_any::wait_on_until): Likewise. ++ (condition_variable_any::wait_on_for): Likewise. ++ * testsuite/30_threads/condition_variable_any/stop_token/wait_on.cc: ++ Adjust tests to account for renamed methods. ++ ++2020-01-07 Fran=C3=A7ois Dumont ++ ++ PR libstdc++/92124 ++ * include/bits/stl_tree.h ++ (_Rb_tree<>::_M_move_assign(_Rb_tree&, false_type)): Replace ++ std::move_if_noexcept by std::move. ++ * testsuite/23_containers/map/92124.cc: New. ++ * testsuite/23_containers/set/92124.cc: New. ++ ++2020-01-06 Jonathan Wakely ++ ++ * include/std/stop_token (stop_token): Remove operator!=3D (LWG 3254). ++ (stop_source): Likewise (LWG 3362). ++ * testsuite/30_threads/stop_token/stop_source.cc: Test equality ++ comparisons. ++ ++ * include/bits/stl_algobase.h (__is_byte_iter, __min_cmp) ++ (lexicographical_compare_three_way): Do not depend on ++ __cpp_lib_concepts. ++ * include/std/version (__cpp_lib_three_way_comparison): Only define ++ when __cpp_lib_concepts is defined. ++ * libsupc++/compare (__cpp_lib_three_way_comparison): Likewise. ++ ++2020-01-03 Jonathan Wakely ++ ++ * include/bits/stl_algobase.h (lexicographical_compare_three_way): ++ Only define four-argument overload when __cpp_lib_concepts is defined. ++ ++2020-01-01 John David Anglin ++ ++ * config/abi/post/hppa-linux-gnu/baseline_symbols.txt: Update. ++ ++2020-01-01 Jakub Jelinek +=20 + Update copyright years. + +-Copyright (C) 2017 Free Software Foundation, Inc. ++Copyright (C) 2020 Free Software Foundation, Inc. +=20 + Copying and distribution of this file, with or without modification, + are permitted in any medium without royalty provided the copyright +diff --git a/libstdc++-v3/Makefile.in b/libstdc++-v3/Makefile.in +index 85d56fb6a04..a4242569962 100644 +--- a/libstdc++-v3/Makefile.in ++++ b/libstdc++-v3/Makefile.in +@@ -74,6 +74,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/acinclude.m4 b/libstdc++-v3/acinclude.m4 +index 08319dc5549..b97ff8db335 100644 +--- a/libstdc++-v3/acinclude.m4 ++++ b/libstdc++-v3/acinclude.m4 +@@ -790,6 +790,8 @@ AC_DEFUN([GLIBCXX_EXPORT_INSTALL_INFO], [ + [version_specific_libs=3Dno]) + AC_MSG_RESULT($version_specific_libs) +=20 ++ GCC_WITH_TOOLEXECLIBDIR ++ + # Default case for install directory for include files. + if test $version_specific_libs =3D no && test $gxx_include_dir =3D no; = then + gxx_include_dir=3D'include/c++/${gcc_version}' +@@ -820,7 +822,14 @@ AC_DEFUN([GLIBCXX_EXPORT_INSTALL_INFO], [ + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + glibcxx_toolexecdir=3D'${exec_prefix}/${host_alias}' +- glibcxx_toolexeclibdir=3D'${toolexecdir}/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ glibcxx_toolexeclibdir=3D'${toolexecdir}/lib' ++ ;; ++ *) ++ glibcxx_toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + glibcxx_toolexecdir=3D'${libdir}/gcc/${host_alias}' + glibcxx_toolexeclibdir=3D'${libdir}' +diff --git a/libstdc++-v3/aclocal.m4 b/libstdc++-v3/aclocal.m4 +index 229d0354116..16c6e61cf7e 100644 +--- a/libstdc++-v3/aclocal.m4 ++++ b/libstdc++-v3/aclocal.m4 +@@ -684,6 +684,7 @@ m4_include([../config/multi.m4]) + m4_include([../config/no-executables.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../config/unwind_ipinfo.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) +diff --git a/libstdc++-v3/configure b/libstdc++-v3/configure +index de8390703e2..88de3f728d4 100755 +--- a/libstdc++-v3/configure ++++ b/libstdc++-v3/configure +@@ -903,6 +903,7 @@ enable_libstdcxx_threads + enable_libstdcxx_filesystem_ts + with_gxx_include_dir + enable_version_specific_runtime_libs ++with_toolexeclibdir + with_gcc_major_version_only + ' + ac_precious_vars=3D'build_alias +@@ -1623,6 +1624,9 @@ Optional Packages: + set the std::string ABI to use by default + --with-gxx-include-dir=3DDIR + installation directory for include files ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-gcc-major-version-only + use only GCC major number in filesystem paths +=20 +@@ -11606,7 +11610,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11609 "configure" ++#line 11613 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11712,7 +11716,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11715 "configure" ++#line 11723 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -15398,7 +15402,7 @@ $as_echo "$glibcxx_cv_atomic_long_long" >&6; } + # Fake what AC_TRY_COMPILE does. +=20 + cat > conftest.$ac_ext << EOF +-#line 15401 "configure" ++#line 15409 "configure" + int main() + { + typedef bool atomic_type; +@@ -15433,7 +15437,7 @@ $as_echo "$glibcxx_cv_atomic_bool" >&6; } + rm -f conftest* +=20 + cat > conftest.$ac_ext << EOF +-#line 15436 "configure" ++#line 15440 "configure" + int main() + { + typedef short atomic_type; +@@ -15468,7 +15472,7 @@ $as_echo "$glibcxx_cv_atomic_short" >&6; } + rm -f conftest* +=20 + cat > conftest.$ac_ext << EOF +-#line 15471 "configure" ++#line 15475 "configure" + int main() + { + // NB: _Atomic_word not necessarily int. +@@ -15504,7 +15508,7 @@ $as_echo "$glibcxx_cv_atomic_int" >&6; } + rm -f conftest* +=20 + cat > conftest.$ac_ext << EOF +-#line 15507 "configure" ++#line 15511 "configure" + int main() + { + typedef long long atomic_type; +@@ -15585,7 +15589,7 @@ $as_echo "$as_me: WARNING: Performance of certain = classes will degrade as a resu + # unnecessary for this test. +=20 + cat > conftest.$ac_ext << EOF +-#line 15588 "configure" ++#line 15592 "configure" + int main() + { + _Decimal32 d1; +@@ -15627,7 +15631,7 @@ ac_compiler_gnu=3D$ac_cv_cxx_compiler_gnu + # unnecessary for this test. +=20 + cat > conftest.$ac_ext << EOF +-#line 15630 "configure" ++#line 15634 "configure" + template + struct same + { typedef T2 type; }; +@@ -15661,7 +15665,7 @@ $as_echo "$enable_int128" >&6; } + rm -f conftest* +=20 + cat > conftest.$ac_ext << EOF +-#line 15664 "configure" ++#line 15668 "configure" + template + struct same + { typedef T2 type; }; +@@ -81674,6 +81678,19 @@ fi + { $as_echo "$as_me:${as_lineno-$LINENO}: result: $version_specific_libs= " >&5 + $as_echo "$version_specific_libs" >&6; } +=20 ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ + # Default case for install directory for include files. + if test $version_specific_libs =3D no && test $gxx_include_dir =3D no; = then + gxx_include_dir=3D'include/c++/${gcc_version}' +@@ -81704,7 +81721,14 @@ $as_echo "$version_specific_libs" >&6; } + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + glibcxx_toolexecdir=3D'${exec_prefix}/${host_alias}' +- glibcxx_toolexeclibdir=3D'${toolexecdir}/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ glibcxx_toolexeclibdir=3D'${toolexecdir}/lib' ++ ;; ++ *) ++ glibcxx_toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + glibcxx_toolexecdir=3D'${libdir}/gcc/${host_alias}' + glibcxx_toolexeclibdir=3D'${libdir}' +diff --git a/libstdc++-v3/doc/Makefile.in b/libstdc++-v3/doc/Makefile.in +index c98c42fce98..c61f0dc1aa0 100644 +--- a/libstdc++-v3/doc/Makefile.in ++++ b/libstdc++-v3/doc/Makefile.in +@@ -69,6 +69,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/include/Makefile.in b/libstdc++-v3/include/Makef= ile.in +index 980cabb80e2..e57652bbda0 100644 +--- a/libstdc++-v3/include/Makefile.in ++++ b/libstdc++-v3/include/Makefile.in +@@ -69,6 +69,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/libsupc++/Makefile.in b/libstdc++-v3/libsupc++/M= akefile.in +index 7386771d475..c0296d0a342 100644 +--- a/libstdc++-v3/libsupc++/Makefile.in ++++ b/libstdc++-v3/libsupc++/Makefile.in +@@ -71,6 +71,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/po/Makefile.in b/libstdc++-v3/po/Makefile.in +index d92d8b8ac6a..1166a4f55d1 100644 +--- a/libstdc++-v3/po/Makefile.in ++++ b/libstdc++-v3/po/Makefile.in +@@ -69,6 +69,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/python/Makefile.in b/libstdc++-v3/python/Makefil= e.in +index df8285226fa..188a3ab1a5d 100644 +--- a/libstdc++-v3/python/Makefile.in ++++ b/libstdc++-v3/python/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/Makefile.in b/libstdc++-v3/src/Makefile.in +index f0755f015a1..b168f992be8 100644 +--- a/libstdc++-v3/src/Makefile.in ++++ b/libstdc++-v3/src/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/c++11/Makefile.in b/libstdc++-v3/src/c++11/M= akefile.in +index 73852e75c25..8dff9e75ab6 100644 +--- a/libstdc++-v3/src/c++11/Makefile.in ++++ b/libstdc++-v3/src/c++11/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/c++17/Makefile.in b/libstdc++-v3/src/c++17/M= akefile.in +index 26a4713831d..07a88759fb2 100644 +--- a/libstdc++-v3/src/c++17/Makefile.in ++++ b/libstdc++-v3/src/c++17/Makefile.in +@@ -105,6 +105,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4= \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/c++98/Makefile.in b/libstdc++-v3/src/c++98/M= akefile.in +index c0a55171935..1e168815777 100644 +--- a/libstdc++-v3/src/c++98/Makefile.in ++++ b/libstdc++-v3/src/c++98/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/filesystem/Makefile.in b/libstdc++-v3/src/fi= lesystem/Makefile.in +index 3312d0306ca..bf32707c781 100644 +--- a/libstdc++-v3/src/filesystem/Makefile.in ++++ b/libstdc++-v3/src/filesystem/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/testsuite/Makefile.in b/libstdc++-v3/testsuite/M= akefile.in +index 5797a55b728..61cd1317a16 100644 +--- a/libstdc++-v3/testsuite/Makefile.in ++++ b/libstdc++-v3/testsuite/Makefile.in +@@ -69,6 +69,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libvtv/ChangeLog b/libvtv/ChangeLog +index c21a70fea54..c0b68784f30 100644 +--- a/libvtv/ChangeLog ++++ b/libvtv/ChangeLog +@@ -1,30 +1,77 @@ +-2019-11-14 Release Manager ++2020-01-24 Maciej W. Rozycki +=20 +- * GCC 7.5.0 released. ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * Makefile.in: Regenerate. ++ * aclocal.m4: Regenerate. ++ * configure: Regenerate. ++ * testsuite/Makefile.in: Regenerate. ++ ++2020-01-01 Jakub Jelinek ++ ++ Update copyright years. ++ ++2019-09-27 Maciej W. Rozycki ++ ++ * configure: Regenerate. ++ ++2019-02-19 Caroline Tice ++ ++ Fix testsuite ++ * testsuite/libvtv.cc/const_vtable.cc (main): Fix function signature. ++ ++2019-01-01 Jakub Jelinek ++ ++ Update copyright years. +=20 +-2018-12-06 Release Manager ++2018-10-31 Joseph Myers +=20 +- * GCC 7.4.0 released. ++ PR bootstrap/82856 ++ * Makefile.am: Include multilib.am. ++ * configure.ac: Remove AC_PREREQ. ++ * testsuite/Makefile.am (RUNTEST): Remove quotes. ++ * Makefile.in, aclocal.m4, configure, testsuite/Makefile.in: ++ Regenerate. +=20 +-2018-06-22 Jakub Jelinek ++2018-05-02 Tom de Vries +=20 +- Backported from mainline +- 2018-04-18 David Malcolm ++ PR testsuite/85106 ++ * testsuite/lib/libvtv.exp: Include scanltranstree.exp. ++ ++2018-05-02 Tom de Vries ++ ++ PR testsuite/85106 ++ * testsuite/lib/libvtv.exp: Include scanwpaipa.exp. ++ ++2018-04-24 H.J. Lu ++ ++ * configure: Regenerated. ++ ++2018-04-19 Jakub Jelinek ++ ++ * configure: Regenerated. ++ ++2018-04-18 David Malcolm +=20 + PR jit/85384 + * configure: Regenerate. +=20 +-2018-01-25 Release Manager ++2018-02-14 Igor Tsimbalist +=20 +- * GCC 7.3.0 released. ++ PR target/84148 ++ * configure: Regenerate. +=20 +-2017-08-14 Release Manager ++2018-01-03 Jakub Jelinek +=20 +- * GCC 7.2.0 released. ++ Update copyright years. +=20 +-2017-05-02 Release Manager ++2017-11-17 Igor Tsimbalist +=20 +- * GCC 7.1.0 released. ++ * acinclude.m4: Add enable.m4 and cet.m4. ++ * Makefile.in: Regenerate. ++ * testsuite/Makefile.in: Likewise. ++ * configure: Likewise. ++ * configure.ac: Set CET_FLAGS. Update XCFLAGS. ++ * testsuite/libvtv.cc/vtv.exp: Add scanlang.exp. +=20 + 2017-01-21 Jakub Jelinek +=20 +@@ -153,7 +200,7 @@ + * libvtv/configure.ac : Add ACX_LT_HOST_FLAGS. Define VTV_CYGMIN. + * libvtv/configure.tgt : (x86_64-*-cygwin*, i?86-*-cygwin*, + x86_64-*-mingw*) +- (i?86-*-mingw*): Add to supported targets. ++ (i?86-*-mingw*): Add to supported targets. + * libvtv/vtv_fail.cc : Skip inclusion of execinfo.h on Cygwin and MinGW. + (log_error_message): Skip calls to backtrace and backtrace_symbols_fd + on Cygwin and MinGW. +diff --git a/libvtv/Makefile.in b/libvtv/Makefile.in +index 59d0b11bdd0..3a529115879 100644 +--- a/libvtv/Makefile.in ++++ b/libvtv/Makefile.in +@@ -68,6 +68,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lthostflags.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libvtv/aclocal.m4 b/libvtv/aclocal.m4 +index 1e73dcc4a24..b0a3872166f 100644 +--- a/libvtv/aclocal.m4 ++++ b/libvtv/aclocal.m4 +@@ -1030,6 +1030,7 @@ m4_include([../config/libstdc++-raw-cxx.m4]) + m4_include([../config/lthostflags.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libvtv/configure b/libvtv/configure +index dfb9162c79f..74a728e7aba 100755 +--- a/libvtv/configure ++++ b/libvtv/configure +@@ -754,6 +754,7 @@ enable_version_specific_runtime_libs + enable_vtable_verify + enable_dependency_tracking + enable_maintainer_mode ++with_toolexeclibdir + enable_shared + enable_static + with_pic +@@ -1408,6 +1409,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -4575,6 +4579,22 @@ fi +=20 +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -4590,7 +4610,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -12066,7 +12093,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 12069 "configure" ++#line 12096 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -12172,7 +12199,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 12175 "configure" ++#line 12202 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libvtv/configure.ac b/libvtv/configure.ac +index 33b1e7913c6..005e46e2386 100644 +--- a/libvtv/configure.ac ++++ b/libvtv/configure.ac +@@ -79,6 +79,8 @@ AM_MAINTAINER_MODE +=20 + LIBVTV_CONFIGURE +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -94,7 +96,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libvtv/testsuite/Makefile.in b/libvtv/testsuite/Makefile.in +index b5dfd29973c..c296f38f6cb 100644 +--- a/libvtv/testsuite/Makefile.in ++++ b/libvtv/testsuite/Makefile.in +@@ -61,6 +61,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lthostflags.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/zlib/ChangeLog.gcj b/zlib/ChangeLog.gcj +index 09bc9c26104..60f0a1d4c10 100644 +--- a/zlib/ChangeLog.gcj ++++ b/zlib/ChangeLog.gcj +@@ -1,3 +1,36 @@ ++2020-01-24 Maciej W. Rozycki ++ ++ * configure.ac: Handle `--with-toolexeclibdir=3D'. ++ * Makefile.in: Regenerate. ++ * aclocal.m4: Regenerate. ++ * configure: Regenerate. ++ ++2019-09-27 Maciej W. Rozycki ++ ++ * configure: Regenerate. ++ ++2019-01-21 Iain Buclaw ++ ++ * Makefile.am (noinst_LTLIBRARIES): Rename libzgcj_convience.la to ++ libz_convenience.la. ++ * Makefile.in: Regenerate. ++ * configure.ac: Remove target_all. ++ * configure: Regenerate. ++ ++2018-10-31 Joseph Myers ++ ++ PR bootstrap/82856 ++ * Makefile.am: Include multilib.am. ++ ++ Merge from binutils-gdb: ++ 2018-06-19 Simon Marchi ++ ++ * configure.ac: Modernize AC_INIT call, remove AC_PREREQ. ++ * Makefile.am (AUTOMAKE_OPTIONS): Remove 1.8, cygnus, add foreign. ++ * Makefile.in: Re-generate. ++ * aclocal.m4: Re-generate. ++ * configure: Re-generate. ++ + 2017-03-15 Yaakov Selkowitz +=20 + PR bootstrap/79771 +diff --git a/zlib/Makefile.in b/zlib/Makefile.in +index 82b72a16367..5ccc47b1173 100644 +--- a/zlib/Makefile.in ++++ b/zlib/Makefile.in +@@ -62,6 +62,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/depstand= .m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 \ +diff --git a/zlib/aclocal.m4 b/zlib/aclocal.m4 +index fab04ed5c47..8ce1dc9d31d 100644 +--- a/zlib/aclocal.m4 ++++ b/zlib/aclocal.m4 +@@ -992,6 +992,7 @@ m4_include([../config/depstand.m4]) + m4_include([../config/lead-dot.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/zlib/configure b/zlib/configure +index ee5527c4a40..e8d7c00dbcf 100755 +--- a/zlib/configure ++++ b/zlib/configure +@@ -738,6 +738,7 @@ with_pic + enable_fast_install + with_gnu_ld + enable_libtool_lock ++with_toolexeclibdir + enable_host_shared + ' + ac_precious_vars=3D'build_alias +@@ -1385,6 +1386,9 @@ Optional Packages: + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR +=20 + Some influential environment variables: + CC C compiler command +@@ -10406,7 +10410,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10409 "configure" ++#line 10413 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -10512,7 +10516,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10515 "configure" ++#line 10519 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11173,10 +11177,33 @@ fi + done +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/zlib/configure.ac b/zlib/configure.ac +index fb8d943905e..c679b37e2a5 100644 +--- a/zlib/configure.ac ++++ b/zlib/configure.ac +@@ -91,10 +91,19 @@ AC_SUBST(target_all) +=20 + AC_CHECK_HEADERS(unistd.h) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +--=20 +2.24.0 + --=20 2.24.0 --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sat Mar 14 08:30:14 2020 Received: (at 39941) by debbugs.gnu.org; 14 Mar 2020 12:30:14 +0000 Received: from localhost ([127.0.0.1]:60710 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jD5vh-0005B3-RZ for submit@debbugs.gnu.org; Sat, 14 Mar 2020 08:30:14 -0400 Received: from wout1-smtp.messagingengine.com ([64.147.123.24]:44259) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jD5vf-000531-PD for 39941@debbugs.gnu.org; Sat, 14 Mar 2020 08:30:12 -0400 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.west.internal (Postfix) with ESMTP id F2489699; Sat, 14 Mar 2020 08:30:05 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute4.internal (MEProxy); Sat, 14 Mar 2020 08:30:06 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=ing46ck4aWiMl/4ewqdfhV2Q1g X9azNSzq9zSJkBROA=; b=YMn41T94+TdHHid1TTxog1CDLnXqGJUrZjma74je/d GLzRaCXIVMmb8vBBZVJLeuokTqFBthbay3I+bFPiDCG5MJUlrQgAHguLC9HBv/8M rdJNi1ul5Wy/HPes0qmAfIx9z8Uvk1rpHiH5IAe3xaiB7BVy+v0HC038IxLrrjSZ HivSoeNUlTfyfxK/WYWufND4qxWn6sgAtmtM3hXUhqx9qqbvVAFKKADbW9rC/9ps rOKR468U/0MWrdZJpl4VSfPrvW5WaUzZT7L8zI3ZG4haUzNoDJDpC1CqMB/EHMV7 fT8+sCYcuwKa+0sqGBkz0IiQGUmbJJ3g4kd1Q1/p/FMw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=ing46c k4aWiMl/4ewqdfhV2Q1gX9azNSzq9zSJkBROA=; b=XRe7vNrb2GYvpEWpK1GFn2 k9YuVc5stACBuKnVKfjrJjGjzVvwQ/xofvXRpUgKUDVivgJIHl6i5oqSwE8a4uza neB0tMzzrRERD0K3gVDzyFYW/PuCBNv+HCww3SfaKlcEr8C5Cu3tArszWsXLeS99 Bbv9mlANbpfGTi9Kh2B2mXPB+jfCzCBe0Q08+pGEEip9CS7JeKGrTIsEpNpmjCND T8emKgPhc+v/ifDmrdPccVOJlSJVTbwkn3dYPa2NvYxf1IfotIWjZU5/h8bwtuOp 2bPQgTgl2KCmq0dEXqtHmM9jmuQWcqtF5cUGhjUQnJrGO7IDB614cFH76X2rLqoQ == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedugedruddvledggedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmne cujfgurhephffvufgjfhgffffkgggtsehgtderredtredtnecuhfhrohhmpeforghrihhu shcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeenucfkphepke egrddvtddvrdeikedrjeehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehm rghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrghilhdrtghomh X-ME-Proxy: Received: from localhost (ti0006q161-2604.bb.online.no [84.202.68.75]) by mail.messagingengine.com (Postfix) with ESMTPA id EBF6230615B2; Sat, 14 Mar 2020 08:30:04 -0400 (EDT) From: Marius Bakke To: Mathieu Othacehe , Ludovic =?utf-8?Q?Court=C3=A8?= =?utf-8?Q?s?= Subject: Re: bug#39941: Disk-image size increase on core-updates. In-Reply-To: <87a74jnr4f.fsf@gmail.com> References: <87sgimdjcj.fsf@gmail.com> <87eeu0h8d6.fsf@gmail.com> <87a74nhstf.fsf@gnu.org> <87zhcnympn.fsf@gmail.com> <87r1xyfx7o.fsf@gnu.org> <87a74jnr4f.fsf@gmail.com> User-Agent: Notmuch/0.29.3 (https://notmuchmail.org) Emacs/26.3 (x86_64-pc-linux-gnu) Date: Sat, 14 Mar 2020 13:30:00 +0100 Message-ID: <87y2s3ktkn.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 39941 Cc: 39941@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain Mathieu Othacehe writes: > Hello, > > Here's a patch that adds a "lib" output to cross-gcc. This was indeed > quite tricky! > > Anyway, with this patch the closure of "hello" for aarch64-linux-gnu is > reduced from 469 MiB to 187 MiB. Woohoo :-) > I think we can go further. > > --8<---------------cut here---------------start------------->8--- > mathieu@elbruz ~/guix [env]$ guix size /gnu/store/14ygibryjr7mcly0q9mb8306hlg16nhq-hello-2.10 > store item total self > /gnu/store/vm2gaw5jk1zr1x9qzj4z52qjxvrh0nk9-glibc-cross-aarch64-linux-gnu-2.31 158.9 71.4 38.2% > /gnu/store/w00jb174abikqpznadwzvvgwl3r7qfzd-glibc-2.31 38.4 36.7 19.6% > /gnu/store/08vqg0s77dnff7rz90b0h87n2rfyaszg-gcc-7.5.0-lib 71.0 32.6 17.5% > /gnu/store/vqsixs9ks4chpjynhizkpdd1gdshv87h-gcc-cross-aarch64-linux-gnu-7.5.0-lib 186.8 27.9 14.9% > /gnu/store/fgrpk8r46k34pyqv6xkbi8gbv997dbpx-gcc-cross-sans-libc-aarch64-linux-gnu-7.5.0-lib 80.8 9.8 5.2% > /gnu/store/zf5603c5l6ilgyg35gqfkn82v3k9hbri-linux-libre-headers-cross-aarch64-linux-gnu-5.4.20 5.1 5.1 2.7% > /gnu/store/6hhsxa3vvbh8gvcfjw4k5sfk1qrhkcrf-bash-static-5.0.16 1.6 1.6 0.9% > /gnu/store/nvc3r588745kkj159lm1pa4xz5g99rqd-bash-static-5.0.16 1.6 1.6 0.9% > /gnu/store/14ygibryjr7mcly0q9mb8306hlg16nhq-hello-2.10 187.0 0.2 0.1% > total: 187.0 MiB > --8<---------------cut here---------------end--------------->8--- > > There are still references to native glibc/gcc and two different bash, > that may be removed? Maybe file a different bug report for those so it does not get forgotten? One thing at the time... FWIW I think the original problem with huge closure increase has been fixed with 8e98f750e63e8723db0361f4e3e960193278fa47 and 7688dbbdd7a7a091c9a0fc4850e70725e3ff64e3. I'm getting 1372 MiB for the cross-mini example at approximately commit d594963856690f1aacf228c8a83e406d33bc44ce (cross-built for arm-linux-gnueabihf). > WDYT? The patch is almost 40k lines! Most of the changes are whitespace changes in the ChangeLog files, could you remove the commit log and ChangeLog entries altogether to make the patch easier to parse? Where did you find this patch? --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl5szkgACgkQoqBt8qM6 VPokxgf/UBtj3uCcSBcLXLOYvrmGliixEi6Pn7FpATAhrLd7BZqOE03ax2v+VSbu 8FP3jtDZH0ssdKrIDqfyKS8F0xeodde+weKjMl7ufobn4rE40WGMqPfWjI7Zp1DN 6nm6d89zqU2nGfht81fFlFfhrKewWGbfw1SB1xeOABJ4H23QvW1z3ScO5KEEKSNR Y5c8648rTrbv8FMU5q8r/DO/E5nc2fpJKTz9/sATsoDoxiixM41/6+bt5EFDN3Og 6a7lW+sp4RPjQSYgaMLTBVSfTbFx6aFq53OuNyMl9VtbT04UPyGyOZGCkGhXgngv OZ0kwdDNqU9Qc+wPocXEwBaLg8ToSA== =3mtd -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 15 07:21:56 2020 Received: (at 39941) by debbugs.gnu.org; 15 Mar 2020 11:21:56 +0000 Received: from localhost ([127.0.0.1]:34277 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jDRLA-0007S0-N1 for submit@debbugs.gnu.org; Sun, 15 Mar 2020 07:21:56 -0400 Received: from mail-wr1-f47.google.com ([209.85.221.47]:44219) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jDRL9-0007Ro-4d for 39941@debbugs.gnu.org; Sun, 15 Mar 2020 07:21:55 -0400 Received: by mail-wr1-f47.google.com with SMTP id y2so2157280wrn.11 for <39941@debbugs.gnu.org>; Sun, 15 Mar 2020 04:21:55 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=references:user-agent:from:to:cc:subject:in-reply-to:date :message-id:mime-version; bh=j40l+KXl6RwnX9zEQO5fBJt9DZ9Cfu9fX+Qvya8yC2c=; b=D8FE883fiTFiU+B6tu6Ym1lJ/DTQYnzjl/x2ULUo71yBiNY1+ZlmVVcuRdpI1hNXhH n5Td1BAFKuZfDHB/OUf+8UFeyyRAt22LGBABV6zs1Be0c0gplNCm8hdXt6ySfoiqdJJP 9eJw+wTpoQEnChxqe7Xl2NWF4DOq1f3ji0YTXK22TuWF71ZTrD4diQwKZClAU9fWEzli yfULUHDkipiYwUkvH/3jtXoZv2xNzde3U/j+jONPkMg2iJw1MOvuJRTzm+sGalTNi8xh 9ddwPM3oLxxX+Tw8cEEva9ReVvK4llcIrWR5CtLSjh/4DrX8x4t8HiYZFaTDJNE9bmq3 aBtA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:references:user-agent:from:to:cc:subject :in-reply-to:date:message-id:mime-version; bh=j40l+KXl6RwnX9zEQO5fBJt9DZ9Cfu9fX+Qvya8yC2c=; b=H6LFjh6/Lj9sYPS/xjxzq4V+rwVtDDTDZCx8VGJRrrgP+nGsLU8NGR2DN4XPGyoRzj k1C8BQWIfIjwmJWZlPzaSW+zh4wIsDFyDAKgvPsz3jyZY2QbHBxUA1sPgswkmSBGRJ2B Vvf/1A83GqCsXFCCQsOzG58liZSOuQ/4KvURCcBeGgVw2u0DVPvrhQI2MfH7rfCZ5kta h/qNf0PAKRd/TeBIig96bFnCJk5ZATs/4wHZ1E6HPj8jPdD+1RPntmVlkGl5GXu5oWhh 8apoz0lVClG8puan/KTv36yp5zQZKp4+VSrTylfXy3UVSuusBLyiwa8rzyYJZlFq9gaV /tBQ== X-Gm-Message-State: ANhLgQ10DBpSAnzM+E4/+aJlONZC1edi8xuOUoMALr/30GpYAd8zlDjE H3pcsW2LRGU9QYsOlikDXwSW/TNF X-Google-Smtp-Source: ADFU+vu76vzmHmO7p2AMiJ4ylRrrKhgnYksJ7VYez0ZOUdn5Deq5hMgeqbcUJuAmLzHRCNzLA/BSrQ== X-Received: by 2002:a5d:69c1:: with SMTP id s1mr19248996wrw.351.1584271309053; Sun, 15 Mar 2020 04:21:49 -0700 (PDT) Received: from cervin ([2a01:e0a:fa:a50:709f:c263:3a05:fdf9]) by smtp.gmail.com with ESMTPSA id 2sm55117225wrf.79.2020.03.15.04.21.46 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sun, 15 Mar 2020 04:21:47 -0700 (PDT) References: <87sgimdjcj.fsf@gmail.com> <87eeu0h8d6.fsf@gmail.com> <87a74nhstf.fsf@gnu.org> <87zhcnympn.fsf@gmail.com> <87r1xyfx7o.fsf@gnu.org> <87a74jnr4f.fsf@gmail.com> <87y2s3ktkn.fsf@devup.no> User-agent: mu4e 1.2.0; emacs 26.3 From: Mathieu Othacehe To: Marius Bakke Subject: Re: bug#39941: Disk-image size increase on core-updates. In-reply-to: <87y2s3ktkn.fsf@devup.no> Date: Sun, 15 Mar 2020 12:21:46 +0100 Message-ID: <875zf5lv79.fsf@gmail.com> MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="=-=-=" X-Debbugs-Envelope-To: 39941 Cc: Ludovic =?utf-8?Q?Court=C3=A8s?= , 39941@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" --=-=-= Content-Type: text/plain Hey Marius, > Maybe file a different bug report for those so it does not get > forgotten? One thing at the time... Ok! > FWIW I think the original problem with huge closure increase has been > fixed with 8e98f750e63e8723db0361f4e3e960193278fa47 and > 7688dbbdd7a7a091c9a0fc4850e70725e3ff64e3. > > I'm getting 1372 MiB for the cross-mini example at approximately commit > d594963856690f1aacf228c8a83e406d33bc44ce (cross-built for > arm-linux-gnueabihf). What's cross-mini? On commit d594963856690f1aacf228c8a83e406d33bc44ce of core-updates (both patches you mentionned included), I still have a 1.9GiB closure. Note, that applying the "lib" output patch, it drops down to 1.6GiB, which is good news :). > The patch is almost 40k lines! Most of the changes are whitespace > changes in the ChangeLog files, could you remove the commit log and > ChangeLog entries altogether to make the patch easier to parse? > > Where did you find this patch? You'll find a trimmed patch attached. I found the GCC patch upstream (pushed in January), after finding the option in the online manual. Thanks, Mathieu --=-=-= Content-Type: text/x-diff; charset=utf-8 Content-Disposition: inline; filename=0001-gnu-cross-gcc-Add-a-lib-output.patch Content-Transfer-Encoding: quoted-printable >From d8c45710847b504912670ebccf319354746f06f9 Mon Sep 17 00:00:00 2001 From: Mathieu Othacehe Date: Sat, 14 Mar 2020 11:39:52 +0100 Subject: [PATCH] gnu: cross-gcc: Add a "lib" output. Add a "lib" output to cross-gcc. This requires an upstream GCC patch adding support for --with-toolexeclibdir configure option. This option allows to install cross-built GCC libraries in a specific location. This also fixes the computation of TOOLDIR_BASE_PREFIX, that fails when /gnu/store/... directories are involved. * gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch: New file. * gnu/local.mk (dist_patch_DATA): Add it. * gnu/packages/cross-base.scm (cross-gcc)[source]: Apply it, [outputs]: add a "lib" output, (cross-gcc-snippet): fix TOOLDIR_BASE_PREFIX. --- gnu/local.mk | 3 +- gnu/packages/cross-base.scm | 41 +- .../patches/gcc-7-cross-toolexeclibdir.patch | 2654 +++++++++++++++++ 3 files changed, 2684 insertions(+), 14 deletions(-) create mode 100644 gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch diff --git a/gnu/local.mk b/gnu/local.mk index 21a149c469..3af841efea 100644 --- a/gnu/local.mk +++ b/gnu/local.mk @@ -14,7 +14,7 @@ # Copyright =C2=A9 2016, 2017, 2018, 2019 Jan (janneke) Nieuwenhuizen # Copyright =C2=A9 2017, 2018, 2019, 2020 Tobias Geerinckx-Rice # Copyright =C2=A9 2017, 2018 Cl=C3=A9ment Lassieur -# Copyright =C2=A9 2017 Mathieu Othacehe +# Copyright =C2=A9 2017, 2020 Mathieu Othacehe # Copyright =C2=A9 2017, 2018, 2019 G=C3=A1bor Boskovits # Copyright =C2=A9 2018 Amirouche Boubekki # Copyright =C2=A9 2018, 2019, 2020 Oleg Pykhalov @@ -911,6 +911,7 @@ dist_patch_DATA =3D \ %D%/packages/patches/gcc-6-source-date-epoch-2.patch \ %D%/packages/patches/gcc-7-cross-mingw.patch \ %D%/packages/patches/gcc-7-cross-environment-variables.patch \ + %D%/packages/patches/gcc-7-cross-toolexeclibdir.patch \ %D%/packages/patches/gcc-8-cross-environment-variables.patch \ %D%/packages/patches/gcc-8-strmov-store-file-names.patch \ %D%/packages/patches/gcc-9-asan-fix-limits-include.patch \ diff --git a/gnu/packages/cross-base.scm b/gnu/packages/cross-base.scm index 667d1f786a..d373e522d5 100644 --- a/gnu/packages/cross-base.scm +++ b/gnu/packages/cross-base.scm @@ -6,6 +6,7 @@ ;;; Copyright =C2=A9 2018 Tobias Geerinckx-Rice ;;; Copyright =C2=A9 2019, 2020 Marius Bakke ;;; Copyright =C2=A9 2019 Carl Dong +;;; Copyright =C2=A9 2020 Mathieu Othacehe ;;; ;;; This file is part of GNU Guix. ;;; @@ -162,6 +163,13 @@ base compiler and using LIBC (which may be either a li= bc package or #f.)" "--disable-libsanitizer" )) =20 + ;; Install cross-built libraries such as libgcc_s.s= o in + ;; the "lib" output. + ,@(if libc + `((string-append "--with-toolexeclibdir=3D" + (assoc-ref %outputs "lib") + "/" ,target "/lib")) + '()) ;; For a newlib (non-glibc) target ,@(if (cross-newlib? target) '("--with-newlib") @@ -196,12 +204,18 @@ base compiler and using LIBC (which may be either a l= ibc package or #f.)" =20 (define (cross-gcc-snippet target) "Return GCC snippet needed for TARGET." - (cond ((target-mingw? target) - '(begin - (copy-recursively "libstdc++-v3/config/os/mingw32-w64" - "libstdc++-v3/config/os/newlib") - #t)) - (else #f))) + `(begin + ,@(if (target-mingw? target) + '((copy-recursively "libstdc++-v3/config/os/mingw32-w64" + "libstdc++-v3/config/os/newlib")) + '()) + ;; TOOLDIR_BASE_PREFIX is erroneous when using a separate "lib" + ;; output. Specify it correctly, otherwise GCC won't find its shared + ;; libraries installed in the "lib" output. + (substitute* "gcc/Makefile.in" + (("-DTOOLDIR_BASE_PREFIX=3D[^ ]*") + "-DTOOLDIR_BASE_PREFIX=3D\\\"../../../../\\\"")) + #t)) =20 (define* (cross-gcc target #:key @@ -220,18 +234,19 @@ target that libc." (patches (append (origin-patches (package-source xgcc)) - (cons (cond - ((version>=3D? (package-version xgcc) "8.0") (searc= h-patch "gcc-8-cross-environment-variables.patch")) - ((version>=3D? (package-version xgcc) "6.0") (searc= h-patch "gcc-6-cross-environment-variables.patch")) - (else (search-patch "gcc-cross-environment-variabl= es.patch"))) + (append (cond + ((version>=3D? (package-version xgcc) "8.0") + (search-patches "gcc-8-cross-environment-variables= .patch")) + ((version>=3D? (package-version xgcc) "6.0") + (search-patches "gcc-7-cross-toolexeclibdir.patch" + "gcc-6-cross-environment-variables= .patch")) + (else (search-patches "gcc-cross-environment-varia= bles.patch"))) (cross-gcc-patches xgcc target)))) (modules '((guix build utils))) (snippet (cross-gcc-snippet target)))) =20 - ;; For simplicity, use a single output. Otherwise libgcc_s & co. are = not - ;; found by default, etc. - (outputs '("out")) + (outputs '("out" "lib")) =20 (arguments `(#:implicit-inputs? #f diff --git a/gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch b/gnu/pa= ckages/patches/gcc-7-cross-toolexeclibdir.patch new file mode 100644 index 0000000000..3b90caba22 --- /dev/null +++ b/gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch @@ -0,0 +1,2654 @@ +This patch taken from GCC upstream adds support for overriding cross-compi= led +shared libraries installation path. This is needed to have a separate "li= b" +output containing those shared libraries. + +From fe6b5640a52a6e75dddea834e357974c205c737c Mon Sep 17 00:00:00 2001 +From: "Maciej W. Rozycki" +Date: Fri, 24 Jan 2020 11:24:25 +0000 +Subject: [PATCH] Add `--with-toolexeclibdir=3D' configuration option + +Provide means, in the form of a `--with-toolexeclibdir=3D' configuration +option, to override the default installation directory for target +libraries, otherwise known as $toolexeclibdir. This is so that it is +possible to get newly-built libraries, particularly the shared ones, +installed in a common place, so that they can be readily used by the +target system as their host libraries, possibly over NFS, without a need +to manually copy them over from the currently hardcoded location they +would otherwise be installed in. + +In the presence of the `--enable-version-specific-runtime-libs' option +and for configurations building native GCC the option is ignored. + +diff --git a/config/toolexeclibdir.m4 b/config/toolexeclibdir.m4 +new file mode 100644 +index 00000000000..5dd89786219 +--- /dev/null ++++ b/config/toolexeclibdir.m4 +@@ -0,0 +1,31 @@ ++dnl toolexeclibdir override support. ++dnl Copyright (C) 2020 Free Software Foundation, Inc. ++dnl ++dnl This program is free software; you can redistribute it and/or modify ++dnl it under the terms of the GNU General Public License as published by ++dnl the Free Software Foundation; either version 3, or (at your option) ++dnl any later version. ++dnl ++dnl This program is distributed in the hope that it will be useful, ++dnl but WITHOUT ANY WARRANTY; without even the implied warranty of ++dnl MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ++dnl GNU General Public License for more details. ++dnl ++dnl You should have received a copy of the GNU General Public License ++dnl along with this program; see the file COPYING3. If not see ++dnl . ++ ++AC_DEFUN([GCC_WITH_TOOLEXECLIBDIR], ++[AC_ARG_WITH(toolexeclibdir, ++ [AS_HELP_STRING([--with-toolexeclibdir=3DDIR], ++ [install libraries built with a cross compiler within DIR])], ++ [dnl ++case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac], ++ [with_toolexeclibdir=3Dno]) ++]) +diff --git a/gcc/doc/install.texi b/gcc/doc/install.texi +index 77ba08d3f21..28cb6d88da8 100644 +--- a/gcc/doc/install.texi ++++ b/gcc/doc/install.texi +@@ -2083,6 +2083,10 @@ shorthand for + The following options only apply to building cross compilers. +=20 + @table @code ++@item --with-toolexeclibdir=3D@var{dir} ++Specify the installation directory for libraries built with a cross compi= ler. ++The default is @option{$@{gcc_tooldir@}/lib}. ++ + @item --with-sysroot + @itemx --with-sysroot=3D@var{dir} + Tells GCC to consider @var{dir} as the root of a tree that contains +diff --git a/libada/Makefile.in b/libada/Makefile.in +index 328c067c4cd..004aaf8f993 100644 +--- a/libada/Makefile.in ++++ b/libada/Makefile.in +@@ -192,6 +192,7 @@ configure_deps =3D \ + $(srcdir)/../config/multi.m4 \ + $(srcdir)/../config/override.m4 \ + $(srcdir)/../config/picflag.m4 \ ++ $(srcdir)/../config/toolexeclibdir.m4 \ + $(srcdir)/../config/unwind_ipinfo.m4 +=20 + $(srcdir)/configure: @MAINT@ $(configure_deps) +diff --git a/libada/configure b/libada/configure +index 13e267a7f4e..3135092a73b 100755 +--- a/libada/configure ++++ b/libada/configure +@@ -631,6 +631,7 @@ ac_user_opts=3D' + enable_option_checking + with_build_libsubdir + enable_maintainer_mode ++with_toolexeclibdir + enable_multilib + enable_shared + with_system_libunwind +@@ -1262,6 +1263,9 @@ Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) + --with-build-libsubdir=3DDIR Directory where to find libraries for bui= ld system ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-system-libunwind use installed libunwind + --with-gcc-major-version-only + use only GCC major number in filesystem paths +@@ -1952,6 +1956,22 @@ else + fi +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Default to --enable-multilib + # Check whether --enable-multilib was given. + if test "${enable_multilib+set}" =3D set; then : +@@ -2004,7 +2024,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libada/configure.ac b/libada/configure.ac +index 0020df9d463..a2a4a1f5049 100644 +--- a/libada/configure.ac ++++ b/libada/configure.ac +@@ -19,6 +19,7 @@ sinclude(../config/acx.m4) + sinclude(../config/multi.m4) + sinclude(../config/override.m4) + sinclude(../config/picflag.m4) ++sinclude(../config/toolexeclibdir.m4) + sinclude(../config/unwind_ipinfo.m4) +=20 + AC_INIT +@@ -53,6 +54,8 @@ AC_ARG_ENABLE([maintainer-mode], + [MAINT=3D'#']) + AC_SUBST([MAINT])dnl +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + AM_ENABLE_MULTILIB(, ..) + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir +@@ -69,7 +72,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libatomic/Makefile.in b/libatomic/Makefile.in +index f6eeab312ea..86d7ba20c19 100644 +--- a/libatomic/Makefile.in ++++ b/libatomic/Makefile.in +@@ -72,6 +72,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libatomic/aclocal.m4 b/libatomic/aclocal.m4 +index 1363e7b9cbc..f1a3f1dda26 100644 +--- a/libatomic/aclocal.m4 ++++ b/libatomic/aclocal.m4 +@@ -1017,6 +1017,7 @@ m4_include([../config/lthostflags.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libatomic/configure b/libatomic/configure +index 2ae9b8d40f3..0fa531ec4a3 100755 +--- a/libatomic/configure ++++ b/libatomic/configure +@@ -755,6 +755,7 @@ enable_option_checking + enable_version_specific_runtime_libs + enable_generated_files_in_srcdir + enable_multilib ++with_toolexeclibdir + enable_dependency_tracking + enable_shared + enable_static +@@ -1414,6 +1415,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -3185,6 +3189,22 @@ fi + ac_config_commands=3D"$ac_config_commands default-1" +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -3200,7 +3220,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -11115,7 +11142,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11118 "configure" ++#line 11145 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11221,7 +11248,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11224 "configure" ++#line 11251 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libatomic/configure.ac b/libatomic/configure.ac +index 023f1727b1e..3c58801ae98 100644 +--- a/libatomic/configure.ac ++++ b/libatomic/configure.ac +@@ -85,6 +85,8 @@ target_alias=3D${target_alias-$host_alias} + AM_INIT_AUTOMAKE([1.9.0 foreign no-dist -Wall -Wno-portability -Wno-overr= ide]) + AM_ENABLE_MULTILIB(, ..) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -100,7 +102,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libatomic/testsuite/Makefile.in b/libatomic/testsuite/Makefil= e.in +index adfc231484a..a2a76e07502 100644 +--- a/libatomic/testsuite/Makefile.in ++++ b/libatomic/testsuite/Makefile.in +@@ -61,6 +61,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libffi/Makefile.in b/libffi/Makefile.in +index 8a99ee58b68..032dadf4c4a 100644 +--- a/libffi/Makefile.in ++++ b/libffi/Makefile.in +@@ -72,6 +72,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/acinclude.m4 \ +diff --git a/libffi/aclocal.m4 b/libffi/aclocal.m4 +index 6d6207eb897..9cd050aaaf5 100644 +--- a/libffi/aclocal.m4 ++++ b/libffi/aclocal.m4 +@@ -1051,6 +1051,7 @@ m4_include([../config/depstand.m4]) + m4_include([../config/lead-dot.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/libffi/configure b/libffi/configure +index 790a291011f..6e37039e84c 100755 +--- a/libffi/configure ++++ b/libffi/configure +@@ -777,6 +777,7 @@ enable_debug + enable_structs + enable_raw_api + enable_purify_safety ++with_toolexeclibdir + enable_symvers + with_gcc_major_version_only + ' +@@ -1436,6 +1437,9 @@ Optional Packages: + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-gcc-major-version-only + use only GCC major number in filesystem paths +=20 +@@ -11390,7 +11394,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11393 "configure" ++#line 11397 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11496,7 +11500,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11499 "configure" ++#line 11507 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -16002,10 +16006,33 @@ $as_echo "#define USING_PURIFY 1" >>confdefs.h + fi +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libffi/configure.ac b/libffi/configure.ac +index a01d8ac16b0..f295d06ab58 100644 +--- a/libffi/configure.ac ++++ b/libffi/configure.ac +@@ -333,10 +333,19 @@ AC_ARG_ENABLE(purify-safety, + AC_DEFINE(USING_PURIFY, 1, [Define this if you are using Purify and w= ant to suppress spurious messages.]) + fi) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libffi/include/Makefile.in b/libffi/include/Makefile.in +index e0c75992327..3762e6c9b68 100644 +--- a/libffi/include/Makefile.in ++++ b/libffi/include/Makefile.in +@@ -62,6 +62,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/acinclude.m4 \ +diff --git a/libffi/man/Makefile.in b/libffi/man/Makefile.in +index 0243bdbedfa..12e61e485eb 100644 +--- a/libffi/man/Makefile.in ++++ b/libffi/man/Makefile.in +@@ -60,6 +60,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/acinclude.m4 \ +diff --git a/libffi/testsuite/Makefile.in b/libffi/testsuite/Makefile.in +index b7da4b0b3e7..469b251b17f 100644 +--- a/libffi/testsuite/Makefile.in ++++ b/libffi/testsuite/Makefile.in +@@ -60,6 +60,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/acinclude.m4 \ +diff --git a/libgcc/Makefile.in b/libgcc/Makefile.in +index a1a392de88d..3a94dab2fdd 100644 +--- a/libgcc/Makefile.in ++++ b/libgcc/Makefile.in +@@ -163,6 +163,7 @@ AUTOCONF =3D autoconf + configure_deps =3D \ + $(srcdir)/../config/enable.m4 \ + $(srcdir)/../config/tls.m4 \ ++ $(srcdir)/../config/toolexeclibdir.m4 \ + $(srcdir)/../config/acx.m4 \ + $(srcdir)/../config/no-executables.m4 \ + $(srcdir)/../config/lib-ld.m4 \ +diff --git a/libgcc/configure b/libgcc/configure +index 441601a1f76..976827dc57e 100644 +--- a/libgcc/configure ++++ b/libgcc/configure +@@ -669,6 +669,7 @@ enable_shared + enable_vtable_verify + with_aix_soname + enable_version_specific_runtime_libs ++with_toolexeclibdir + with_slibdir + enable_maintainer_mode + with_build_libsubdir +@@ -1329,6 +1330,9 @@ Optional Packages: + --with-aix-soname=3Daix|svr4|both + shared library versioning (aka "SONAME") varian= t to + provide on AIX ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-slibdir=3DDIR shared libraries in DIR LIBDIR + --with-build-libsubdir=3DDIR Directory where to find libraries for bui= ld system + --with-system-libunwind use installed libunwind +@@ -2403,6 +2407,22 @@ fi + $as_echo "$version_specific_libs" >&6; } +=20 +=20 ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ ++ + # Check whether --with-slibdir was given. + if test "${with_slibdir+set}" =3D set; then : + withval=3D$with_slibdir; slibdir=3D"$with_slibdir" +@@ -2410,7 +2430,14 @@ else + if test "${version_specific_libs}" =3D yes; then + slibdir=3D'$(libsubdir)' + elif test -n "$with_cross_host" && test x"$with_cross_host" !=3D x"no"; t= hen +- slibdir=3D'$(exec_prefix)/$(host_noncanonical)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ slibdir=3D'$(exec_prefix)/$(host_noncanonical)/lib' ++ ;; ++ *) ++ slibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + slibdir=3D'$(libdir)' + fi +@@ -2640,7 +2667,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_noncanonical)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_noncanonical)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libgcc/configure.ac b/libgcc/configure.ac +index 99b8e15562f..ca833fdc5c1 100644 +--- a/libgcc/configure.ac ++++ b/libgcc/configure.ac +@@ -2,6 +2,7 @@ dnl Process this file with autoconf to produce a configure= script. +=20 + sinclude(../config/enable.m4) + sinclude(../config/tls.m4) ++sinclude(../config/toolexeclibdir.m4) + sinclude(../config/acx.m4) + sinclude(../config/no-executables.m4) + sinclude(../config/lib-ld.m4) +@@ -108,16 +109,25 @@ AC_ARG_ENABLE(version-specific-runtime-libs, + [version_specific_libs=3Dno]) + AC_MSG_RESULT($version_specific_libs) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + AC_ARG_WITH(slibdir, + [ --with-slibdir=3DDIR shared libraries in DIR [LIBDIR]], + slibdir=3D"$with_slibdir", +-if test "${version_specific_libs}" =3D yes; then ++[if test "${version_specific_libs}" =3D yes; then + slibdir=3D'$(libsubdir)' + elif test -n "$with_cross_host" && test x"$with_cross_host" !=3D x"no"; t= hen +- slibdir=3D'$(exec_prefix)/$(host_noncanonical)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ slibdir=3D'$(exec_prefix)/$(host_noncanonical)/lib' ++ ;; ++ *) ++ slibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + slibdir=3D'$(libdir)' +-fi) ++fi]) + AC_SUBST(slibdir) +=20 + # Command-line options. +@@ -163,7 +173,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_noncanonical)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_noncanonical)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libgfortran/Makefile.in b/libgfortran/Makefile.in +index 4914a6f323f..ba700a8002c 100644 +--- a/libgfortran/Makefile.in ++++ b/libgfortran/Makefile.in +@@ -133,6 +133,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/depsta= nd.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../config/acx.m4 \ +diff --git a/libgfortran/aclocal.m4 b/libgfortran/aclocal.m4 +index 015537ef197..58f0687d7a5 100644 +--- a/libgfortran/aclocal.m4 ++++ b/libgfortran/aclocal.m4 +@@ -1030,6 +1030,7 @@ m4_include([../config/lthostflags.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libgfortran/configure b/libgfortran/configure +index 1db8f5f5224..e28fa82d8d5 100755 +--- a/libgfortran/configure ++++ b/libgfortran/configure +@@ -771,6 +771,7 @@ enable_intermodule + enable_maintainer_mode + enable_multilib + enable_dependency_tracking ++with_toolexeclibdir + enable_symvers + with_gnu_ld + enable_shared +@@ -1436,6 +1437,9 @@ Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) + --with-build-libsubdir=3DDIR Directory where to find libraries for bui= ld system ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] +@@ -4927,6 +4931,22 @@ $as_echo "$ac_cv_safe_to_define___extensions__" >&6= ; } +=20 +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -4942,7 +4962,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -12421,7 +12448,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 12424 "configure" ++#line 12451 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -12527,7 +12554,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 12530 "configure" ++#line 12557 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libgfortran/configure.ac b/libgfortran/configure.ac +index 37b12d2998f..6dee8ef15b0 100644 +--- a/libgfortran/configure.ac ++++ b/libgfortran/configure.ac +@@ -87,6 +87,8 @@ fi +=20 + AC_USE_SYSTEM_EXTENSIONS +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -102,7 +104,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libgomp/Makefile.in b/libgomp/Makefile.in +index 920d29d1c4c..9deafc4e0ce 100644 +--- a/libgomp/Makefile.in ++++ b/libgomp/Makefile.in +@@ -101,6 +101,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4= \ + $(top_srcdir)/../config/lthostflags.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/stdint.m4 \ + $(top_srcdir)/../config/tls.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libgomp/aclocal.m4 b/libgomp/aclocal.m4 +index a1f51f27651..c244c2549e5 100644 +--- a/libgomp/aclocal.m4 ++++ b/libgomp/aclocal.m4 +@@ -998,6 +998,7 @@ m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) + m4_include([../config/tls.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libgomp/configure b/libgomp/configure +index 06166c66120..6b3beae0f63 100755 +--- a/libgomp/configure ++++ b/libgomp/configure +@@ -782,6 +782,7 @@ enable_option_checking + enable_version_specific_runtime_libs + enable_generated_files_in_srcdir + enable_multilib ++with_toolexeclibdir + enable_dependency_tracking + enable_shared + enable_static +@@ -1455,6 +1456,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -3338,6 +3342,22 @@ fi + ac_config_commands=3D"$ac_config_commands default-1" +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -3353,7 +3373,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -11155,7 +11182,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11158 "configure" ++#line 11185 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11261,7 +11288,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11264 "configure" ++#line 11295 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libgomp/configure.ac b/libgomp/configure.ac +index a42d4f08b4b..a3500d71480 100644 +--- a/libgomp/configure.ac ++++ b/libgomp/configure.ac +@@ -65,6 +65,8 @@ target_alias=3D${target_alias-$host_alias} + AM_INIT_AUTOMAKE([1.9.0 foreign no-dist -Wall -Wno-portability -Wno-overr= ide]) + AM_ENABLE_MULTILIB(, ..) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -80,7 +82,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libgomp/testsuite/Makefile.in b/libgomp/testsuite/Makefile.in +index 6edb7ae7ade..0492e7788ab 100644 +--- a/libgomp/testsuite/Makefile.in ++++ b/libgomp/testsuite/Makefile.in +@@ -63,6 +63,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lthostflags.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/stdint.m4 \ + $(top_srcdir)/../config/tls.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libhsail-rt/Makefile.in b/libhsail-rt/Makefile.in +index 528cdb0b423..0b6596b79bc 100644 +--- a/libhsail-rt/Makefile.in ++++ b/libhsail-rt/Makefile.in +@@ -106,6 +106,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4= \ + $(top_srcdir)/../config/depstand.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/configure.ac +diff --git a/libhsail-rt/aclocal.m4 b/libhsail-rt/aclocal.m4 +index 505744c695a..05de587bda2 100644 +--- a/libhsail-rt/aclocal.m4 ++++ b/libhsail-rt/aclocal.m4 +@@ -992,6 +992,7 @@ m4_include([../config/acx.m4]) + m4_include([../config/depstand.m4]) + m4_include([../config/lead-dot.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/libhsail-rt/configure b/libhsail-rt/configure +index a4fcc10c1f9..1b4f2a953d0 100755 +--- a/libhsail-rt/configure ++++ b/libhsail-rt/configure +@@ -737,6 +737,7 @@ enable_option_checking + enable_maintainer_mode + enable_dependency_tracking + enable_version_specific_runtime_libs ++with_toolexeclibdir + enable_shared + enable_static + with_pic +@@ -1395,6 +1396,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -4418,6 +4422,22 @@ fi + { $as_echo "$as_me:${as_lineno-$LINENO}: result: $enable_version_specific= _runtime_libs" >&5 + $as_echo "$enable_version_specific_runtime_libs" >&6; } +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -4433,7 +4453,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -10973,7 +11000,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10976 "configure" ++#line 11003 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11079,7 +11106,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11082 "configure" ++#line 11113 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libhsail-rt/configure.ac b/libhsail-rt/configure.ac +index ed7e3041994..88afd5b56d6 100644 +--- a/libhsail-rt/configure.ac ++++ b/libhsail-rt/configure.ac +@@ -70,6 +70,8 @@ ler-specific directory]), + [enable_version_specific_runtime_libs=3Dno]) + AC_MSG_RESULT($enable_version_specific_runtime_libs) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -85,7 +87,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libitm/Makefile.in b/libitm/Makefile.in +index bd16ce0cfb8..851c6b37f0b 100644 +--- a/libitm/Makefile.in ++++ b/libitm/Makefile.in +@@ -74,6 +74,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ + $(top_srcdir)/../config/tls.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/weakref.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ +diff --git a/libitm/aclocal.m4 b/libitm/aclocal.m4 +index 26de26b7808..3b67780342a 100644 +--- a/libitm/aclocal.m4 ++++ b/libitm/aclocal.m4 +@@ -1022,6 +1022,7 @@ m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) + m4_include([../config/tls.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../config/weakref.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/libitm/configure b/libitm/configure +index 96c494d4a3f..ed47fab3c83 100644 +--- a/libitm/configure ++++ b/libitm/configure +@@ -766,6 +766,7 @@ enable_option_checking + enable_version_specific_runtime_libs + enable_generated_files_in_srcdir + enable_multilib ++with_toolexeclibdir + enable_dependency_tracking + enable_shared + enable_static +@@ -1430,6 +1431,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -3371,6 +3375,22 @@ fi + ac_config_commands=3D"$ac_config_commands default-1" +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -3386,7 +3406,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -11794,7 +11821,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11797 "configure" ++#line 11824 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11900,7 +11927,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11903 "configure" ++#line 11934 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libitm/configure.ac b/libitm/configure.ac +index c5ecd394a43..ebd888fbd42 100644 +--- a/libitm/configure.ac ++++ b/libitm/configure.ac +@@ -79,6 +79,8 @@ target_alias=3D${target_alias-$host_alias} + AM_INIT_AUTOMAKE([1.9.0 foreign no-dist -Wall -Wno-portability -Wno-overr= ide]) + AM_ENABLE_MULTILIB(, ..) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -94,7 +96,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libitm/testsuite/Makefile.in b/libitm/testsuite/Makefile.in +index eb9e992279d..88d2120c156 100644 +--- a/libitm/testsuite/Makefile.in ++++ b/libitm/testsuite/Makefile.in +@@ -66,6 +66,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ + $(top_srcdir)/../config/tls.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/weakref.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ +diff --git a/libobjc/Makefile.in b/libobjc/Makefile.in +index febc92d4b3c..1a12ebec592 100644 +--- a/libobjc/Makefile.in ++++ b/libobjc/Makefile.in +@@ -291,6 +291,7 @@ aclocal_deps =3D \ + $(srcdir)/../config/multi.m4 \ + $(srcdir)/../config/override.m4 \ + $(srcdir)/../config/proginstall.m4 \ ++ $(srcdir)/../config/toolexeclibdir.m4 \ + $(srcdir)/../ltoptions.m4 \ + $(srcdir)/../ltsugar.m4 \ + $(srcdir)/../ltversion.m4 \ +diff --git a/libobjc/aclocal.m4 b/libobjc/aclocal.m4 +index 174f9b7d0d8..58e4dfce6b6 100644 +--- a/libobjc/aclocal.m4 ++++ b/libobjc/aclocal.m4 +@@ -204,4 +204,5 @@ m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) + m4_include([../lt~obsolete.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([acinclude.m4]) +diff --git a/libobjc/configure b/libobjc/configure +index 84862a82864..b766980e0a5 100755 +--- a/libobjc/configure ++++ b/libobjc/configure +@@ -714,6 +714,7 @@ with_target_subdir + with_cross_host + enable_version_specific_runtime_libs + enable_multilib ++with_toolexeclibdir + enable_maintainer_mode + enable_shared + enable_static +@@ -1368,6 +1369,9 @@ Optional Packages: + --with-target-subdir=3DSUBDIR + configuring in a subdirectory + --with-cross-host=3DHOST configuring with a cross compiler ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -2461,6 +2465,22 @@ case $srcdir in + esac +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -2476,7 +2496,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_noncanonical)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_noncanonical)' + toolexeclibdir=3D'$(libdir)' +@@ -10594,7 +10621,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10597 "configure" ++#line 10628 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -10700,7 +10727,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10703 "configure" ++#line 10738 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libobjc/configure.ac b/libobjc/configure.ac +index c6d48f787ae..79c31562e97 100644 +--- a/libobjc/configure.ac ++++ b/libobjc/configure.ac +@@ -77,6 +77,8 @@ case $srcdir in + esac + AC_SUBST(glibcpp_srcdir) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -92,7 +94,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_noncanonical)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_noncanonical)' + toolexeclibdir=3D'$(libdir)' +diff --git a/liboffloadmic/Makefile.in b/liboffloadmic/Makefile.in +index f4470c6e4d4..d42745a49e0 100644 +--- a/liboffloadmic/Makefile.in ++++ b/liboffloadmic/Makefile.in +@@ -94,6 +94,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/configure.ac +diff --git a/liboffloadmic/aclocal.m4 b/liboffloadmic/aclocal.m4 +index 4bb1d43a5e5..c62ed26f6b1 100644 +--- a/liboffloadmic/aclocal.m4 ++++ b/liboffloadmic/aclocal.m4 +@@ -993,6 +993,7 @@ m4_include([../config/depstand.m4]) + m4_include([../config/lead-dot.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/liboffloadmic/configure b/liboffloadmic/configure +index f873716991b..6dfe9e37642 100644 +--- a/liboffloadmic/configure ++++ b/liboffloadmic/configure +@@ -739,6 +739,7 @@ enable_maintainer_mode + enable_dependency_tracking + enable_multilib + enable_version_specific_runtime_libs ++with_toolexeclibdir + enable_shared + enable_static + with_pic +@@ -1397,6 +1398,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -5003,6 +5007,22 @@ else + fi +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir. + # Also toolexecdir, though it's only used in toolexeclibdir. + case ${enable_version_specific_runtime_libs} in +@@ -5018,7 +5038,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -11108,7 +11135,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11111 "configure" ++#line 11138 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11214,7 +11241,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11217 "configure" ++#line 11248 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/liboffloadmic/configure.ac b/liboffloadmic/configure.ac +index 64728f1a1a7..14efcdd3290 100644 +--- a/liboffloadmic/configure.ac ++++ b/liboffloadmic/configure.ac +@@ -80,6 +80,8 @@ case "$enable_liboffloadmic" in + esac + AM_CONDITIONAL(LIBOFFLOADMIC_HOST, [test x"$enable_liboffloadmic" =3D xho= st]) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir. + # Also toolexecdir, though it's only used in toolexeclibdir. + case ${enable_version_specific_runtime_libs} in +@@ -95,7 +97,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/liboffloadmic/plugin/Makefile.in b/liboffloadmic/plugin/Makef= ile.in +index 2a7c8d2ec6c..6e180f6a23c 100644 +--- a/liboffloadmic/plugin/Makefile.in ++++ b/liboffloadmic/plugin/Makefile.in +@@ -90,6 +90,7 @@ DIST_COMMON =3D $(srcdir)/Makefile.in $(srcdir)/Makefile= .am \ + ACLOCAL_M4 =3D $(top_srcdir)/aclocal.m4 + am__aclocal_m4_deps =3D $(top_srcdir)/../../config/acx.m4 \ + $(top_srcdir)/../../config/depstand.m4 \ ++ $(top_srcdir)/../../config/toolexeclibdir.m4 \ + $(top_srcdir)/../../config/lead-dot.m4 \ + $(top_srcdir)/../../config/multi.m4 \ + $(top_srcdir)/../../config/override.m4 \ +diff --git a/liboffloadmic/plugin/aclocal.m4 b/liboffloadmic/plugin/acloca= l.m4 +index a4179ef40ac..6d90e5d6e16 100644 +--- a/liboffloadmic/plugin/aclocal.m4 ++++ b/liboffloadmic/plugin/aclocal.m4 +@@ -990,6 +990,7 @@ AC_SUBST([am__untar]) +=20 + m4_include([../../config/acx.m4]) + m4_include([../../config/depstand.m4]) ++m4_include([../../config/toolexeclibdir.m4]) + m4_include([../../config/lead-dot.m4]) + m4_include([../../config/multi.m4]) + m4_include([../../config/override.m4]) +diff --git a/liboffloadmic/plugin/configure b/liboffloadmic/plugin/configu= re +index c031eb3e7fa..570758344b4 100644 +--- a/liboffloadmic/plugin/configure ++++ b/liboffloadmic/plugin/configure +@@ -735,6 +735,7 @@ enable_maintainer_mode + enable_dependency_tracking + enable_multilib + enable_version_specific_runtime_libs ++with_toolexeclibdir + enable_shared + enable_static + with_pic +@@ -1394,6 +1395,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -4311,6 +4315,22 @@ fi + $as_echo "$enable_version_specific_runtime_libs" >&6; } +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir. + # Also toolexecdir, though it's only used in toolexeclibdir. + case ${enable_version_specific_runtime_libs} in +@@ -4326,7 +4346,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -10815,7 +10842,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10818 "configure" ++#line 10845 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -10921,7 +10948,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10924 "configure" ++#line 10955 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/liboffloadmic/plugin/configure.ac b/liboffloadmic/plugin/conf= igure.ac +index 9c48cafd38b..fdac290c5f1 100644 +--- a/liboffloadmic/plugin/configure.ac ++++ b/liboffloadmic/plugin/configure.ac +@@ -96,6 +96,8 @@ AC_ARG_ENABLE([version-specific-runtime-libs], + AC_MSG_RESULT($enable_version_specific_runtime_libs) +=20 +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir. + # Also toolexecdir, though it's only used in toolexeclibdir. + case ${enable_version_specific_runtime_libs} in +@@ -111,7 +113,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libquadmath/Makefile.in b/libquadmath/Makefile.in +index 428e0158aca..e5c7aba84b7 100644 +--- a/libquadmath/Makefile.in ++++ b/libquadmath/Makefile.in +@@ -67,6 +67,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libquadmath/aclocal.m4 b/libquadmath/aclocal.m4 +index b9ebb8a9ed4..59009468a47 100644 +--- a/libquadmath/aclocal.m4 ++++ b/libquadmath/aclocal.m4 +@@ -1030,6 +1030,7 @@ m4_include([../config/lthostflags.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/no-executables.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libquadmath/configure b/libquadmath/configure +index 76a2c20b7e1..e887071aeb2 100755 +--- a/libquadmath/configure ++++ b/libquadmath/configure +@@ -749,6 +749,7 @@ enable_fast_install + with_gnu_ld + enable_libtool_lock + enable_maintainer_mode ++with_toolexeclibdir + enable_symvers + enable_generated_files_in_srcdir + with_gcc_major_version_only +@@ -1408,6 +1409,9 @@ Optional Packages: + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-gcc-major-version-only + use only GCC major number in filesystem paths +=20 +@@ -10572,7 +10576,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10575 "configure" ++#line 10579 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -10678,7 +10682,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10681 "configure" ++#line 10689 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11917,6 +11921,22 @@ ac_link=3D'$CC -o conftest$ac_exeext $CFLAGS $CPP= FLAGS $LDFLAGS conftest.$ac_ext $ + ac_compiler_gnu=3D$ac_cv_c_compiler_gnu +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -11932,7 +11952,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libquadmath/configure.ac b/libquadmath/configure.ac +index 41fbe1259ee..e27aa8d0389 100644 +--- a/libquadmath/configure.ac ++++ b/libquadmath/configure.ac +@@ -83,6 +83,8 @@ if test "x$GCC" !=3D "xyes"; then + fi + AC_PROG_CPP +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -98,7 +100,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libsanitizer/Makefile.in b/libsanitizer/Makefile.in +index 1f4bb8cd6bb..fb533c253ea 100644 +--- a/libsanitizer/Makefile.in ++++ b/libsanitizer/Makefile.in +@@ -71,6 +71,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/aclocal.m4 b/libsanitizer/aclocal.m4 +index 55e063530f6..f51347671e3 100644 +--- a/libsanitizer/aclocal.m4 ++++ b/libsanitizer/aclocal.m4 +@@ -1017,6 +1017,7 @@ m4_include([../config/libstdc++-raw-cxx.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libsanitizer/asan/Makefile.in b/libsanitizer/asan/Makefile.in +index 4dad60ba1ae..f079e07f0da 100644 +--- a/libsanitizer/asan/Makefile.in ++++ b/libsanitizer/asan/Makefile.in +@@ -66,6 +66,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/configure b/libsanitizer/configure +index a3a08d635f4..5f4cdcad38d 100755 +--- a/libsanitizer/configure ++++ b/libsanitizer/configure +@@ -767,6 +767,7 @@ enable_multilib + enable_version_specific_runtime_libs + enable_dependency_tracking + enable_maintainer_mode ++with_toolexeclibdir + enable_shared + enable_static + with_pic +@@ -1425,6 +1426,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -4773,6 +4777,22 @@ fi +=20 +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -4788,7 +4808,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -12032,7 +12059,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 12035 "configure" ++#line 12062 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -12138,7 +12165,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 12141 "configure" ++#line 12168 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libsanitizer/configure.ac b/libsanitizer/configure.ac +index b0c485b0f7b..d69d5aa1c9a 100644 +--- a/libsanitizer/configure.ac ++++ b/libsanitizer/configure.ac +@@ -30,6 +30,8 @@ GCC_LIBSTDCXX_RAW_CXX_FLAGS + AM_INIT_AUTOMAKE(foreign no-dist) + AM_MAINTAINER_MODE +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -45,7 +47,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libsanitizer/interception/Makefile.in b/libsanitizer/intercep= tion/Makefile.in +index c71fb57b8b8..ed9c996b5eb 100644 +--- a/libsanitizer/interception/Makefile.in ++++ b/libsanitizer/interception/Makefile.in +@@ -62,6 +62,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/libbacktrace/Makefile.in b/libsanitizer/libbackt= race/Makefile.in +index dff04cfa3ea..22655306594 100644 +--- a/libsanitizer/libbacktrace/Makefile.in ++++ b/libsanitizer/libbacktrace/Makefile.in +@@ -94,6 +94,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/lsan/Makefile.in b/libsanitizer/lsan/Makefile.in +index baa8367cd40..efae691d3ef 100644 +--- a/libsanitizer/lsan/Makefile.in ++++ b/libsanitizer/lsan/Makefile.in +@@ -63,6 +63,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/sanitizer_common/Makefile.in b/libsanitizer/sani= tizer_common/Makefile.in +index c375f63a380..27c8b410ef7 100644 +--- a/libsanitizer/sanitizer_common/Makefile.in ++++ b/libsanitizer/sanitizer_common/Makefile.in +@@ -68,6 +68,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/tsan/Makefile.in b/libsanitizer/tsan/Makefile.in +index 770c053e64f..a77cda3d0f3 100644 +--- a/libsanitizer/tsan/Makefile.in ++++ b/libsanitizer/tsan/Makefile.in +@@ -65,6 +65,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/ubsan/Makefile.in b/libsanitizer/ubsan/Makefile.= in +index 1664ce9497e..108505c3c67 100644 +--- a/libsanitizer/ubsan/Makefile.in ++++ b/libsanitizer/ubsan/Makefile.in +@@ -64,6 +64,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libssp/Makefile.in b/libssp/Makefile.in +index 96b03ae1248..c119ef3e8a2 100644 +--- a/libssp/Makefile.in ++++ b/libssp/Makefile.in +@@ -67,6 +67,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/configure.ac +diff --git a/libssp/aclocal.m4 b/libssp/aclocal.m4 +index 927988e5814..46585360592 100644 +--- a/libssp/aclocal.m4 ++++ b/libssp/aclocal.m4 +@@ -995,6 +995,7 @@ m4_include([../config/lthostflags.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/no-executables.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/libssp/configure b/libssp/configure +index ee1751d20db..3273cd40ab1 100755 +--- a/libssp/configure ++++ b/libssp/configure +@@ -743,6 +743,7 @@ with_pic + enable_fast_install + with_gnu_ld + enable_libtool_lock ++with_toolexeclibdir + with_gcc_major_version_only + ' + ac_precious_vars=3D'build_alias +@@ -1389,6 +1390,9 @@ Optional Packages: + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-gcc-major-version-only + use only GCC major number in filesystem paths +=20 +@@ -10671,7 +10675,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10674 "configure" ++#line 10678 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -10777,7 +10781,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10780 "configure" ++#line 10784 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11039,6 +11043,22 @@ esac +=20 +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -11054,7 +11074,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libssp/configure.ac b/libssp/configure.ac +index 9e4a22a24d4..63538cb8f4e 100644 +--- a/libssp/configure.ac ++++ b/libssp/configure.ac +@@ -159,6 +159,8 @@ ACX_LT_HOST_FLAGS + AC_SUBST(enable_shared) + AC_SUBST(enable_static) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -174,7 +176,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libstdc++-v3/Makefile.in b/libstdc++-v3/Makefile.in +index 85d56fb6a04..a4242569962 100644 +--- a/libstdc++-v3/Makefile.in ++++ b/libstdc++-v3/Makefile.in +@@ -74,6 +74,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/acinclude.m4 b/libstdc++-v3/acinclude.m4 +index 08319dc5549..b97ff8db335 100644 +--- a/libstdc++-v3/acinclude.m4 ++++ b/libstdc++-v3/acinclude.m4 +@@ -790,6 +790,8 @@ AC_DEFUN([GLIBCXX_EXPORT_INSTALL_INFO], [ + [version_specific_libs=3Dno]) + AC_MSG_RESULT($version_specific_libs) +=20 ++ GCC_WITH_TOOLEXECLIBDIR ++ + # Default case for install directory for include files. + if test $version_specific_libs =3D no && test $gxx_include_dir =3D no; = then + gxx_include_dir=3D'include/c++/${gcc_version}' +@@ -820,7 +822,14 @@ AC_DEFUN([GLIBCXX_EXPORT_INSTALL_INFO], [ + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + glibcxx_toolexecdir=3D'${exec_prefix}/${host_alias}' +- glibcxx_toolexeclibdir=3D'${toolexecdir}/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ glibcxx_toolexeclibdir=3D'${toolexecdir}/lib' ++ ;; ++ *) ++ glibcxx_toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + glibcxx_toolexecdir=3D'${libdir}/gcc/${host_alias}' + glibcxx_toolexeclibdir=3D'${libdir}' +diff --git a/libstdc++-v3/aclocal.m4 b/libstdc++-v3/aclocal.m4 +index 229d0354116..16c6e61cf7e 100644 +--- a/libstdc++-v3/aclocal.m4 ++++ b/libstdc++-v3/aclocal.m4 +@@ -684,6 +684,7 @@ m4_include([../config/multi.m4]) + m4_include([../config/no-executables.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../config/unwind_ipinfo.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) +diff --git a/libstdc++-v3/configure b/libstdc++-v3/configure +index de8390703e2..88de3f728d4 100755 +--- a/libstdc++-v3/configure ++++ b/libstdc++-v3/configure +@@ -903,6 +903,7 @@ enable_libstdcxx_threads + enable_libstdcxx_filesystem_ts + with_gxx_include_dir + enable_version_specific_runtime_libs ++with_toolexeclibdir + with_gcc_major_version_only + ' + ac_precious_vars=3D'build_alias +@@ -1623,6 +1624,9 @@ Optional Packages: + set the std::string ABI to use by default + --with-gxx-include-dir=3DDIR + installation directory for include files ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-gcc-major-version-only + use only GCC major number in filesystem paths +=20 +@@ -11606,7 +11610,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11609 "configure" ++#line 11613 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11712,7 +11716,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11715 "configure" ++#line 11723 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -15398,7 +15402,7 @@ $as_echo "$glibcxx_cv_atomic_long_long" >&6; } + # Fake what AC_TRY_COMPILE does. +=20 + cat > conftest.$ac_ext << EOF +-#line 15401 "configure" ++#line 15409 "configure" + int main() + { + typedef bool atomic_type; +@@ -15433,7 +15437,7 @@ $as_echo "$glibcxx_cv_atomic_bool" >&6; } + rm -f conftest* +=20 + cat > conftest.$ac_ext << EOF +-#line 15436 "configure" ++#line 15440 "configure" + int main() + { + typedef short atomic_type; +@@ -15468,7 +15472,7 @@ $as_echo "$glibcxx_cv_atomic_short" >&6; } + rm -f conftest* +=20 + cat > conftest.$ac_ext << EOF +-#line 15471 "configure" ++#line 15475 "configure" + int main() + { + // NB: _Atomic_word not necessarily int. +@@ -15504,7 +15508,7 @@ $as_echo "$glibcxx_cv_atomic_int" >&6; } + rm -f conftest* +=20 + cat > conftest.$ac_ext << EOF +-#line 15507 "configure" ++#line 15511 "configure" + int main() + { + typedef long long atomic_type; +@@ -15585,7 +15589,7 @@ $as_echo "$as_me: WARNING: Performance of certain = classes will degrade as a resu + # unnecessary for this test. +=20 + cat > conftest.$ac_ext << EOF +-#line 15588 "configure" ++#line 15592 "configure" + int main() + { + _Decimal32 d1; +@@ -15627,7 +15631,7 @@ ac_compiler_gnu=3D$ac_cv_cxx_compiler_gnu + # unnecessary for this test. +=20 + cat > conftest.$ac_ext << EOF +-#line 15630 "configure" ++#line 15634 "configure" + template + struct same + { typedef T2 type; }; +@@ -15661,7 +15665,7 @@ $as_echo "$enable_int128" >&6; } + rm -f conftest* +=20 + cat > conftest.$ac_ext << EOF +-#line 15664 "configure" ++#line 15668 "configure" + template + struct same + { typedef T2 type; }; +@@ -81674,6 +81678,19 @@ fi + { $as_echo "$as_me:${as_lineno-$LINENO}: result: $version_specific_libs= " >&5 + $as_echo "$version_specific_libs" >&6; } +=20 ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ + # Default case for install directory for include files. + if test $version_specific_libs =3D no && test $gxx_include_dir =3D no; = then + gxx_include_dir=3D'include/c++/${gcc_version}' +@@ -81704,7 +81721,14 @@ $as_echo "$version_specific_libs" >&6; } + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + glibcxx_toolexecdir=3D'${exec_prefix}/${host_alias}' +- glibcxx_toolexeclibdir=3D'${toolexecdir}/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ glibcxx_toolexeclibdir=3D'${toolexecdir}/lib' ++ ;; ++ *) ++ glibcxx_toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + glibcxx_toolexecdir=3D'${libdir}/gcc/${host_alias}' + glibcxx_toolexeclibdir=3D'${libdir}' +diff --git a/libstdc++-v3/doc/Makefile.in b/libstdc++-v3/doc/Makefile.in +index c98c42fce98..c61f0dc1aa0 100644 +--- a/libstdc++-v3/doc/Makefile.in ++++ b/libstdc++-v3/doc/Makefile.in +@@ -69,6 +69,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/include/Makefile.in b/libstdc++-v3/include/Makef= ile.in +index 980cabb80e2..e57652bbda0 100644 +--- a/libstdc++-v3/include/Makefile.in ++++ b/libstdc++-v3/include/Makefile.in +@@ -69,6 +69,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/libsupc++/Makefile.in b/libstdc++-v3/libsupc++/M= akefile.in +index 7386771d475..c0296d0a342 100644 +--- a/libstdc++-v3/libsupc++/Makefile.in ++++ b/libstdc++-v3/libsupc++/Makefile.in +@@ -71,6 +71,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/po/Makefile.in b/libstdc++-v3/po/Makefile.in +index d92d8b8ac6a..1166a4f55d1 100644 +--- a/libstdc++-v3/po/Makefile.in ++++ b/libstdc++-v3/po/Makefile.in +@@ -69,6 +69,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/python/Makefile.in b/libstdc++-v3/python/Makefil= e.in +index df8285226fa..188a3ab1a5d 100644 +--- a/libstdc++-v3/python/Makefile.in ++++ b/libstdc++-v3/python/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/Makefile.in b/libstdc++-v3/src/Makefile.in +index f0755f015a1..b168f992be8 100644 +--- a/libstdc++-v3/src/Makefile.in ++++ b/libstdc++-v3/src/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/c++11/Makefile.in b/libstdc++-v3/src/c++11/M= akefile.in +index 73852e75c25..8dff9e75ab6 100644 +--- a/libstdc++-v3/src/c++11/Makefile.in ++++ b/libstdc++-v3/src/c++11/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/c++17/Makefile.in b/libstdc++-v3/src/c++17/M= akefile.in +index 26a4713831d..07a88759fb2 100644 +--- a/libstdc++-v3/src/c++17/Makefile.in ++++ b/libstdc++-v3/src/c++17/Makefile.in +@@ -105,6 +105,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4= \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/c++98/Makefile.in b/libstdc++-v3/src/c++98/M= akefile.in +index c0a55171935..1e168815777 100644 +--- a/libstdc++-v3/src/c++98/Makefile.in ++++ b/libstdc++-v3/src/c++98/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/filesystem/Makefile.in b/libstdc++-v3/src/fi= lesystem/Makefile.in +index 3312d0306ca..bf32707c781 100644 +--- a/libstdc++-v3/src/filesystem/Makefile.in ++++ b/libstdc++-v3/src/filesystem/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/testsuite/Makefile.in b/libstdc++-v3/testsuite/M= akefile.in +index 5797a55b728..61cd1317a16 100644 +--- a/libstdc++-v3/testsuite/Makefile.in ++++ b/libstdc++-v3/testsuite/Makefile.in +@@ -69,6 +69,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libvtv/Makefile.in b/libvtv/Makefile.in +index 59d0b11bdd0..3a529115879 100644 +--- a/libvtv/Makefile.in ++++ b/libvtv/Makefile.in +@@ -68,6 +68,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lthostflags.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libvtv/aclocal.m4 b/libvtv/aclocal.m4 +index 1e73dcc4a24..b0a3872166f 100644 +--- a/libvtv/aclocal.m4 ++++ b/libvtv/aclocal.m4 +@@ -1030,6 +1030,7 @@ m4_include([../config/libstdc++-raw-cxx.m4]) + m4_include([../config/lthostflags.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libvtv/configure b/libvtv/configure +index dfb9162c79f..74a728e7aba 100755 +--- a/libvtv/configure ++++ b/libvtv/configure +@@ -754,6 +754,7 @@ enable_version_specific_runtime_libs + enable_vtable_verify + enable_dependency_tracking + enable_maintainer_mode ++with_toolexeclibdir + enable_shared + enable_static + with_pic +@@ -1408,6 +1409,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -4575,6 +4579,22 @@ fi +=20 +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -4590,7 +4610,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -12066,7 +12093,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 12069 "configure" ++#line 12096 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -12172,7 +12199,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 12175 "configure" ++#line 12202 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libvtv/configure.ac b/libvtv/configure.ac +index 33b1e7913c6..005e46e2386 100644 +--- a/libvtv/configure.ac ++++ b/libvtv/configure.ac +@@ -79,6 +79,8 @@ AM_MAINTAINER_MODE +=20 + LIBVTV_CONFIGURE +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -94,7 +96,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libvtv/testsuite/Makefile.in b/libvtv/testsuite/Makefile.in +index b5dfd29973c..c296f38f6cb 100644 +--- a/libvtv/testsuite/Makefile.in ++++ b/libvtv/testsuite/Makefile.in +@@ -61,6 +61,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lthostflags.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/zlib/Makefile.in b/zlib/Makefile.in +index 82b72a16367..5ccc47b1173 100644 +--- a/zlib/Makefile.in ++++ b/zlib/Makefile.in +@@ -62,6 +62,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/depstand= .m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 \ +diff --git a/zlib/aclocal.m4 b/zlib/aclocal.m4 +index fab04ed5c47..8ce1dc9d31d 100644 +--- a/zlib/aclocal.m4 ++++ b/zlib/aclocal.m4 +@@ -992,6 +992,7 @@ m4_include([../config/depstand.m4]) + m4_include([../config/lead-dot.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/zlib/configure b/zlib/configure +index ee5527c4a40..e8d7c00dbcf 100755 +--- a/zlib/configure ++++ b/zlib/configure +@@ -738,6 +738,7 @@ with_pic + enable_fast_install + with_gnu_ld + enable_libtool_lock ++with_toolexeclibdir + enable_host_shared + ' + ac_precious_vars=3D'build_alias +@@ -1385,6 +1386,9 @@ Optional Packages: + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR +=20 + Some influential environment variables: + CC C compiler command +@@ -10406,7 +10410,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10409 "configure" ++#line 10413 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -10512,7 +10516,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10515 "configure" ++#line 10519 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11173,10 +11177,33 @@ fi + done +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/zlib/configure.ac b/zlib/configure.ac +index fb8d943905e..c679b37e2a5 100644 +--- a/zlib/configure.ac ++++ b/zlib/configure.ac +@@ -91,10 +91,19 @@ AC_SUBST(target_all) +=20 + AC_CHECK_HEADERS(unistd.h) +=20 ++GCC_WITH_TOOLEXECLIBDIR ++ + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +--=20 +2.24.0 + --=20 2.24.0 --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sun Mar 15 13:14:02 2020 Received: (at 39941) by debbugs.gnu.org; 15 Mar 2020 17:14:02 +0000 Received: from localhost ([127.0.0.1]:35414 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jDWpu-000259-48 for submit@debbugs.gnu.org; Sun, 15 Mar 2020 13:14:02 -0400 Received: from eggs.gnu.org ([209.51.188.92]:33830) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jDWps-00024Y-Ko for 39941@debbugs.gnu.org; Sun, 15 Mar 2020 13:14:00 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:55326) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1jDWpn-0001xp-Gi; Sun, 15 Mar 2020 13:13:55 -0400 Received: from [2a01:e0a:1d:7270:af76:b9b:ca24:c465] (port=41150 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1jDWpm-0005uq-UJ; Sun, 15 Mar 2020 13:13:55 -0400 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Mathieu Othacehe Subject: Re: bug#39941: Disk-image size increase on core-updates. References: <87sgimdjcj.fsf@gmail.com> <87eeu0h8d6.fsf@gmail.com> <87a74nhstf.fsf@gnu.org> <87zhcnympn.fsf@gmail.com> <87r1xyfx7o.fsf@gnu.org> <87a74jnr4f.fsf@gmail.com> <87y2s3ktkn.fsf@devup.no> <875zf5lv79.fsf@gmail.com> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 26 =?utf-8?Q?Vent=C3=B4se?= an 228 de la =?utf-8?Q?R?= =?utf-8?Q?=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Sun, 15 Mar 2020 18:13:52 +0100 In-Reply-To: <875zf5lv79.fsf@gmail.com> (Mathieu Othacehe's message of "Sun, 15 Mar 2020 12:21:46 +0100") Message-ID: <87tv2pilrj.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 39941 Cc: Marius Bakke , 39941@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Hi! Congrats on this, Mathieu! Mathieu Othacehe skribis: > You'll find a trimmed patch attached. I found the GCC patch upstream > (pushed in January), after finding the option in the online manual. [...] > From d8c45710847b504912670ebccf319354746f06f9 Mon Sep 17 00:00:00 2001 > From: Mathieu Othacehe > Date: Sat, 14 Mar 2020 11:39:52 +0100 > Subject: [PATCH] gnu: cross-gcc: Add a "lib" output. > > Add a "lib" output to cross-gcc. This requires an upstream GCC patch addi= ng > support for --with-toolexeclibdir configure option. This option allows to > install cross-built GCC libraries in a specific location. > > This also fixes the computation of TOOLDIR_BASE_PREFIX, that fails when > /gnu/store/... directories are involved. Perhaps add =E2=80=9CFixes .=E2=80=9D [...] > + ;; TOOLDIR_BASE_PREFIX is erroneous when using a separate "lib" > + ;; output. Specify it correctly, otherwise GCC won't find its shared > + ;; libraries installed in the "lib" output. How erroneous is it? Is there a bug report we could link to? > +++ b/gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch > @@ -0,0 +1,2654 @@ > +This patch taken from GCC upstream adds support for overriding cross-com= piled > +shared libraries installation path. This is needed to have a separate "= lib" > +output containing those shared libraries. Could you add a link to the web view of the commit, if possible? >From this patch, I think we should keep only the generated bit (=E2=80=98configure=E2=80=99 and =E2=80=98Makefile.in=E2=80=99 files) and d= iscard everything else. We can probably also discard changes in bundled libraries (zlib, libgc, etc.). The comment should mention that we=E2=80=99ve stripped things compared to t= he upstream commit. Apologies for suggesting some more tedious work, but I think it=E2=80=99ll = be helpful! :-) Thank you! Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Tue Mar 17 07:28:52 2020 Received: (at 39941) by debbugs.gnu.org; 17 Mar 2020 11:28:53 +0000 Received: from localhost ([127.0.0.1]:38231 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jEAOq-0001PK-Bd for submit@debbugs.gnu.org; Tue, 17 Mar 2020 07:28:52 -0400 Received: from mail-wr1-f50.google.com ([209.85.221.50]:46685) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jEAOh-0001Ow-2f for 39941@debbugs.gnu.org; Tue, 17 Mar 2020 07:28:43 -0400 Received: by mail-wr1-f50.google.com with SMTP id w16so8727645wrv.13 for <39941@debbugs.gnu.org>; Tue, 17 Mar 2020 04:28:35 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=references:user-agent:from:to:cc:subject:in-reply-to:date :message-id:mime-version; bh=KzuoyWlVZBvG2bRwAkqyxYADrpT1SadHmNqbup1eOk4=; b=sA/O20Q1QWse4IdPYW2VPwIq+a0HjReYnFSm+tMMdfrOPhhyKlM85wklHJNkmvoobb dRyMFnxNpKM1FPj6IzzqFBCuEUJdQ6invnXYSECir0QagffH7LIbkliEiCQZ15Vg8cWe QLHZo88HFPdRIUxiu1hkqwF+4ZuErSc59lk3tHzRSW3vNWF/Dv7QNxL1q8DI7RQX3KkJ TqpaDIxxG83ywh2bunJDZZChJDXV5GTikXDzaq+K3qJv6JmZRE5GDByesh2T7BzFdIvh JfRH9+rJQjov5faPbaPWKgfEX6MElGKoeKqRg4/YOXmcBTA3VIT01PpnJwKORY0D+6Cu 7WHA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:references:user-agent:from:to:cc:subject :in-reply-to:date:message-id:mime-version; bh=KzuoyWlVZBvG2bRwAkqyxYADrpT1SadHmNqbup1eOk4=; b=qV6v4pkdtYUIHsLWgRj6BcUGwjWz8FONlqupcAjud63DV+t1318+CxonJEe0vMFQbo 9nPNhWcLyIj2JbxY9D3Jszs+c1dncpqvs1ezKQhZT2AUAx/hPUxpoa88UTizPQzEK6iC Ws95KM+3uj9eBQhxYbrYbvdoEL+ax1hEidLaBLLnp1YuiHJwUk+bL9lbbmm+G+W7LadZ Bat+vVLb9ZBMrfGE+ASzINrcq2RJ9xFU2o5Bl16hD1HA4wHdVXANzqATrQQ7g7U1dPHx D12acjRhagztt7j6jWc4uxi5TRDGsp17EvmHAN2HGarKPQE924Pwsfqj8WhQKYXb/uxJ dUrg== X-Gm-Message-State: ANhLgQ0zn7qVSwtl+FQ5a5ayYxqKL7ocq83/r6MnkxGcjpAYT1Fc/vTH 3a2oV0Y3V93PxRbxwEu73YiR4cqG X-Google-Smtp-Source: ADFU+vve6z85ogsNUS+W0/5K3hxf+k/5K2GdD1yYRp2qReTU0UxgmOi1aFwniOZAozcvnhnJSniGgw== X-Received: by 2002:a05:6000:10c6:: with SMTP id b6mr5565583wrx.130.1584444509000; Tue, 17 Mar 2020 04:28:29 -0700 (PDT) Received: from meru ([2a01:cb18:832e:5f00:b890:ea6c:fbe7:6602]) by smtp.gmail.com with ESMTPSA id h13sm4158464wrv.39.2020.03.17.04.28.26 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Tue, 17 Mar 2020 04:28:27 -0700 (PDT) References: <87sgimdjcj.fsf@gmail.com> <87eeu0h8d6.fsf@gmail.com> <87a74nhstf.fsf@gnu.org> <87zhcnympn.fsf@gmail.com> <87r1xyfx7o.fsf@gnu.org> <87a74jnr4f.fsf@gmail.com> <87y2s3ktkn.fsf@devup.no> <875zf5lv79.fsf@gmail.com> <87tv2pilrj.fsf@gnu.org> User-agent: mu4e 1.2.0; emacs 26.3 From: Mathieu Othacehe To: Ludovic =?utf-8?Q?Court=C3=A8s?= Subject: Re: bug#39941: Disk-image size increase on core-updates. In-reply-to: <87tv2pilrj.fsf@gnu.org> Date: Tue, 17 Mar 2020 12:28:25 +0100 Message-ID: <87pndbb4py.fsf@gmail.com> MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="=-=-=" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 39941 Cc: Marius Bakke , 39941@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Hey, > Congrats on this, Mathieu! Thank you :) > Perhaps add =E2=80=9CFixes .=E2=80=9D Well I think it doesn't. In the bug report 39941, I reported a recent increase of the cross-compiled disk-image on core-updates (1.5 -> 2.0 GiB), over the last two months. It is not resolved, and this patch fixes something that has always been around I guess. >> + ;; TOOLDIR_BASE_PREFIX is erroneous when using a separate "lib" >> + ;; output. Specify it correctly, otherwise GCC won't find its shar= ed >> + ;; libraries installed in the "lib" output. > > How erroneous is it? Is there a bug report we could link to? I didn't find any bug report related. The issue is that in gcc/Makefile.in, when computing libsubdir_to_prefix: --8<---------------cut here---------------start------------->8--- libsubdir_to_prefix :=3D \ $(unlibsubdir)/$(shell echo "$(libdir)" | \ sed -e 's|^$(prefix)||' -e 's|/$$||' -e 's|^[^/]|/|' \ -e 's|/[^/]*|../|g') --8<---------------cut here---------------end--------------->8--- unlibsubdir is ../../../ libdir /gnu/store/xxx-gcc-cross-aarch64-linux-gnu-7.5.0-lib/lib prefix is /gnu/store/yyy-gcc-cross-aarch64-linux-gnu-7.5.0 then, libsubdir_to_prefix =3D ../../../../../.. Which then gives a search path that looks like: /gnu/store/5qh73asm77554wj43z2wjdrkl3fjxxbp-gcc-cross-aarch64-linux-gnu-7.5= .0-lib/lib/gcc/aarch64-linux-gnu/7.5.0/../../../../../../../aarch64-linux-g= nu/lib/aarch64-linux-gnu/7.5.0/ So its just that this hack is completely broken for non FHS compliant path I guess. Note that on our native toolchain, we have the same issue. If you run: --8<---------------cut here---------------start------------->8--- `guix build -e '(@@ (gnu packages gcc) gcc-9)'|tail -1`/bin/gcc -print-sea= rch-dirs --8<---------------cut here---------------end--------------->8--- You can see the same kind of wrong path: --8<---------------cut here---------------start------------->8--- /gnu/store/347y0zr1a9s2f5pkcncgi3gd0r33qq81-gcc-9.2.0-lib/lib/gcc/x86_64-un= known-linux-gnu/9.2.0/../../../../../../../x86_64-unknown-linux-gnu/lib/x86= _64-unknown-linux-gnu/9.2.0/ --8<---------------cut here---------------end--------------->8--- and it still works, because of this snippet in GCC, disabled when cross-compiling: --8<---------------cut here---------------start------------->8--- else if (*cross_compile =3D=3D '0') { add_prefix (&startfile_prefixes, concat (gcc_exec_prefix ? gcc_exec_prefix : standard_exec_prefix, machine_suffix, standard_startfile_prefix, NULL), NULL, PREFIX_PRIORITY_LAST, 0, 1); } --8<---------------cut here---------------end--------------->8--- that produces an extra search-path that looks like: --8<---------------cut here---------------start------------->8--- /gnu/store/347y0zr1a9s2f5pkcncgi3gd0r33qq81-gcc-9.2.0-lib/lib/gcc/x86_64-un= known-linux-gnu/9.2.0/../../../ --8<---------------cut here---------------end--------------->8--- In short, quite a big mess... > Apologies for suggesting some more tedious work, but I think it=E2=80=99l= l be > helpful! :-) Hehe no worries, here's an updated patch :) Mathieu --=-=-= Content-Type: text/x-diff; charset=utf-8 Content-Disposition: inline; filename=0001-gnu-cross-gcc-Add-a-lib-output.patch Content-Transfer-Encoding: quoted-printable >From 31402fc14126f04e175081ce851e9794cc3ab218 Mon Sep 17 00:00:00 2001 From: Mathieu Othacehe Date: Sat, 14 Mar 2020 11:39:52 +0100 Subject: [PATCH] gnu: cross-gcc: Add a "lib" output. Add a "lib" output to cross-gcc. This requires an upstream GCC patch adding support for --with-toolexeclibdir configure option. This option allows to install cross-built GCC libraries in a specific location. This also fixes the computation of TOOLDIR_BASE_PREFIX, that fails when /gnu/store/... directories are involved. * gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch: New file. * gnu/local.mk (dist_patch_DATA): Add it. * gnu/packages/cross-base.scm (cross-gcc)[source]: Apply it, [outputs]: add a "lib" output, (cross-gcc-snippet): fix TOOLDIR_BASE_PREFIX. --- gnu/local.mk | 3 +- gnu/packages/cross-base.scm | 41 +- .../patches/gcc-7-cross-toolexeclibdir.patch | 1677 +++++++++++++++++ 3 files changed, 1707 insertions(+), 14 deletions(-) create mode 100644 gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch diff --git a/gnu/local.mk b/gnu/local.mk index 21a149c469..3af841efea 100644 --- a/gnu/local.mk +++ b/gnu/local.mk @@ -14,7 +14,7 @@ # Copyright =C2=A9 2016, 2017, 2018, 2019 Jan (janneke) Nieuwenhuizen # Copyright =C2=A9 2017, 2018, 2019, 2020 Tobias Geerinckx-Rice # Copyright =C2=A9 2017, 2018 Cl=C3=A9ment Lassieur -# Copyright =C2=A9 2017 Mathieu Othacehe +# Copyright =C2=A9 2017, 2020 Mathieu Othacehe # Copyright =C2=A9 2017, 2018, 2019 G=C3=A1bor Boskovits # Copyright =C2=A9 2018 Amirouche Boubekki # Copyright =C2=A9 2018, 2019, 2020 Oleg Pykhalov @@ -911,6 +911,7 @@ dist_patch_DATA =3D \ %D%/packages/patches/gcc-6-source-date-epoch-2.patch \ %D%/packages/patches/gcc-7-cross-mingw.patch \ %D%/packages/patches/gcc-7-cross-environment-variables.patch \ + %D%/packages/patches/gcc-7-cross-toolexeclibdir.patch \ %D%/packages/patches/gcc-8-cross-environment-variables.patch \ %D%/packages/patches/gcc-8-strmov-store-file-names.patch \ %D%/packages/patches/gcc-9-asan-fix-limits-include.patch \ diff --git a/gnu/packages/cross-base.scm b/gnu/packages/cross-base.scm index 667d1f786a..d373e522d5 100644 --- a/gnu/packages/cross-base.scm +++ b/gnu/packages/cross-base.scm @@ -6,6 +6,7 @@ ;;; Copyright =C2=A9 2018 Tobias Geerinckx-Rice ;;; Copyright =C2=A9 2019, 2020 Marius Bakke ;;; Copyright =C2=A9 2019 Carl Dong +;;; Copyright =C2=A9 2020 Mathieu Othacehe ;;; ;;; This file is part of GNU Guix. ;;; @@ -162,6 +163,13 @@ base compiler and using LIBC (which may be either a li= bc package or #f.)" "--disable-libsanitizer" )) =20 + ;; Install cross-built libraries such as libgcc_s.s= o in + ;; the "lib" output. + ,@(if libc + `((string-append "--with-toolexeclibdir=3D" + (assoc-ref %outputs "lib") + "/" ,target "/lib")) + '()) ;; For a newlib (non-glibc) target ,@(if (cross-newlib? target) '("--with-newlib") @@ -196,12 +204,18 @@ base compiler and using LIBC (which may be either a l= ibc package or #f.)" =20 (define (cross-gcc-snippet target) "Return GCC snippet needed for TARGET." - (cond ((target-mingw? target) - '(begin - (copy-recursively "libstdc++-v3/config/os/mingw32-w64" - "libstdc++-v3/config/os/newlib") - #t)) - (else #f))) + `(begin + ,@(if (target-mingw? target) + '((copy-recursively "libstdc++-v3/config/os/mingw32-w64" + "libstdc++-v3/config/os/newlib")) + '()) + ;; TOOLDIR_BASE_PREFIX is erroneous when using a separate "lib" + ;; output. Specify it correctly, otherwise GCC won't find its shared + ;; libraries installed in the "lib" output. + (substitute* "gcc/Makefile.in" + (("-DTOOLDIR_BASE_PREFIX=3D[^ ]*") + "-DTOOLDIR_BASE_PREFIX=3D\\\"../../../../\\\"")) + #t)) =20 (define* (cross-gcc target #:key @@ -220,18 +234,19 @@ target that libc." (patches (append (origin-patches (package-source xgcc)) - (cons (cond - ((version>=3D? (package-version xgcc) "8.0") (searc= h-patch "gcc-8-cross-environment-variables.patch")) - ((version>=3D? (package-version xgcc) "6.0") (searc= h-patch "gcc-6-cross-environment-variables.patch")) - (else (search-patch "gcc-cross-environment-variabl= es.patch"))) + (append (cond + ((version>=3D? (package-version xgcc) "8.0") + (search-patches "gcc-8-cross-environment-variables= .patch")) + ((version>=3D? (package-version xgcc) "6.0") + (search-patches "gcc-7-cross-toolexeclibdir.patch" + "gcc-6-cross-environment-variables= .patch")) + (else (search-patches "gcc-cross-environment-varia= bles.patch"))) (cross-gcc-patches xgcc target)))) (modules '((guix build utils))) (snippet (cross-gcc-snippet target)))) =20 - ;; For simplicity, use a single output. Otherwise libgcc_s & co. are = not - ;; found by default, etc. - (outputs '("out")) + (outputs '("out" "lib")) =20 (arguments `(#:implicit-inputs? #f diff --git a/gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch b/gnu/pa= ckages/patches/gcc-7-cross-toolexeclibdir.patch new file mode 100644 index 0000000000..109e6f8b02 --- /dev/null +++ b/gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch @@ -0,0 +1,1677 @@ +This patch taken from GCC upstream adds support for overriding cross-compi= led +shared libraries installation path. This is needed to have a separate "li= b" +output containing those shared libraries. + +See: +https://gcc.gnu.org/git/?p=3Dgcc.git;a=3Dcommit;h=3De8e66971cdc6d1390d47a2= 27899e2e340ff44d66 + +This commit has been stripped. Some modifications to Changelogs and +configure.ac scripts were removed. + +From fe6b5640a52a6e75dddea834e357974c205c737c Mon Sep 17 00:00:00 2001 +From: "Maciej W. Rozycki" +Date: Fri, 24 Jan 2020 11:24:25 +0000 +Subject: [PATCH] Add `--with-toolexeclibdir=3D' configuration option + +Provide means, in the form of a `--with-toolexeclibdir=3D' configuration +option, to override the default installation directory for target +libraries, otherwise known as $toolexeclibdir. This is so that it is +possible to get newly-built libraries, particularly the shared ones, +installed in a common place, so that they can be readily used by the +target system as their host libraries, possibly over NFS, without a need +to manually copy them over from the currently hardcoded location they +would otherwise be installed in. + +In the presence of the `--enable-version-specific-runtime-libs' option +and for configurations building native GCC the option is ignored. + +diff --git a/config/toolexeclibdir.m4 b/config/toolexeclibdir.m4 +new file mode 100644 +index 00000000000..5dd89786219 +--- /dev/null ++++ b/config/toolexeclibdir.m4 +@@ -0,0 +1,31 @@ ++dnl toolexeclibdir override support. ++dnl Copyright (C) 2020 Free Software Foundation, Inc. ++dnl ++dnl This program is free software; you can redistribute it and/or modify ++dnl it under the terms of the GNU General Public License as published by ++dnl the Free Software Foundation; either version 3, or (at your option) ++dnl any later version. ++dnl ++dnl This program is distributed in the hope that it will be useful, ++dnl but WITHOUT ANY WARRANTY; without even the implied warranty of ++dnl MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ++dnl GNU General Public License for more details. ++dnl ++dnl You should have received a copy of the GNU General Public License ++dnl along with this program; see the file COPYING3. If not see ++dnl . ++ ++AC_DEFUN([GCC_WITH_TOOLEXECLIBDIR], ++[AC_ARG_WITH(toolexeclibdir, ++ [AS_HELP_STRING([--with-toolexeclibdir=3DDIR], ++ [install libraries built with a cross compiler within DIR])], ++ [dnl ++case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac], ++ [with_toolexeclibdir=3Dno]) ++]) +diff --git a/gcc/doc/install.texi b/gcc/doc/install.texi +index 77ba08d3f21..28cb6d88da8 100644 +--- a/gcc/doc/install.texi ++++ b/gcc/doc/install.texi +@@ -2083,6 +2083,10 @@ shorthand for + The following options only apply to building cross compilers. +=20 + @table @code ++@item --with-toolexeclibdir=3D@var{dir} ++Specify the installation directory for libraries built with a cross compi= ler. ++The default is @option{$@{gcc_tooldir@}/lib}. ++ + @item --with-sysroot + @itemx --with-sysroot=3D@var{dir} + Tells GCC to consider @var{dir} as the root of a tree that contains +diff --git a/libatomic/Makefile.in b/libatomic/Makefile.in +index f6eeab312ea..86d7ba20c19 100644 +--- a/libatomic/Makefile.in ++++ b/libatomic/Makefile.in +@@ -72,6 +72,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libatomic/aclocal.m4 b/libatomic/aclocal.m4 +index 1363e7b9cbc..f1a3f1dda26 100644 +--- a/libatomic/aclocal.m4 ++++ b/libatomic/aclocal.m4 +@@ -1017,6 +1017,7 @@ m4_include([../config/lthostflags.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libatomic/configure b/libatomic/configure +index 2ae9b8d40f3..0fa531ec4a3 100755 +--- a/libatomic/configure ++++ b/libatomic/configure +@@ -755,6 +755,7 @@ enable_option_checking + enable_version_specific_runtime_libs + enable_generated_files_in_srcdir + enable_multilib ++with_toolexeclibdir + enable_dependency_tracking + enable_shared + enable_static +@@ -1414,6 +1415,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -3185,6 +3189,22 @@ fi + ac_config_commands=3D"$ac_config_commands default-1" +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -3200,7 +3220,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -11115,7 +11142,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11118 "configure" ++#line 11145 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11221,7 +11248,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11224 "configure" ++#line 11251 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libatomic/testsuite/Makefile.in b/libatomic/testsuite/Makefil= e.in +index adfc231484a..a2a76e07502 100644 +--- a/libatomic/testsuite/Makefile.in ++++ b/libatomic/testsuite/Makefile.in +@@ -61,6 +61,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libffi/Makefile.in b/libffi/Makefile.in +index 8a99ee58b68..032dadf4c4a 100644 +--- a/libffi/Makefile.in ++++ b/libffi/Makefile.in +@@ -72,6 +72,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/acinclude.m4 \ +diff --git a/libffi/aclocal.m4 b/libffi/aclocal.m4 +index 6d6207eb897..9cd050aaaf5 100644 +--- a/libffi/aclocal.m4 ++++ b/libffi/aclocal.m4 +@@ -1051,6 +1051,7 @@ m4_include([../config/depstand.m4]) + m4_include([../config/lead-dot.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/libffi/configure b/libffi/configure +index 790a291011f..6e37039e84c 100755 +--- a/libffi/configure ++++ b/libffi/configure +@@ -777,6 +777,7 @@ enable_debug + enable_structs + enable_raw_api + enable_purify_safety ++with_toolexeclibdir + enable_symvers + with_gcc_major_version_only + ' +@@ -1436,6 +1437,9 @@ Optional Packages: + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-gcc-major-version-only + use only GCC major number in filesystem paths +=20 +@@ -11390,7 +11394,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11393 "configure" ++#line 11397 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11496,7 +11500,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11499 "configure" ++#line 11507 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -16002,10 +16006,33 @@ $as_echo "#define USING_PURIFY 1" >>confdefs.h + fi +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libffi/include/Makefile.in b/libffi/include/Makefile.in +index e0c75992327..3762e6c9b68 100644 +--- a/libffi/include/Makefile.in ++++ b/libffi/include/Makefile.in +@@ -62,6 +62,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/acinclude.m4 \ +diff --git a/libffi/man/Makefile.in b/libffi/man/Makefile.in +index 0243bdbedfa..12e61e485eb 100644 +--- a/libffi/man/Makefile.in ++++ b/libffi/man/Makefile.in +@@ -60,6 +60,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/acinclude.m4 \ +diff --git a/libffi/testsuite/Makefile.in b/libffi/testsuite/Makefile.in +index b7da4b0b3e7..469b251b17f 100644 +--- a/libffi/testsuite/Makefile.in ++++ b/libffi/testsuite/Makefile.in +@@ -60,6 +60,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/acinclude.m4 \ +diff --git a/libgcc/Makefile.in b/libgcc/Makefile.in +index a1a392de88d..3a94dab2fdd 100644 +--- a/libgcc/Makefile.in ++++ b/libgcc/Makefile.in +@@ -163,6 +163,7 @@ AUTOCONF =3D autoconf + configure_deps =3D \ + $(srcdir)/../config/enable.m4 \ + $(srcdir)/../config/tls.m4 \ ++ $(srcdir)/../config/toolexeclibdir.m4 \ + $(srcdir)/../config/acx.m4 \ + $(srcdir)/../config/no-executables.m4 \ + $(srcdir)/../config/lib-ld.m4 \ +diff --git a/libgcc/configure b/libgcc/configure +index 441601a1f76..976827dc57e 100644 +--- a/libgcc/configure ++++ b/libgcc/configure +@@ -669,6 +669,7 @@ enable_shared + enable_vtable_verify + with_aix_soname + enable_version_specific_runtime_libs ++with_toolexeclibdir + with_slibdir + enable_maintainer_mode + with_build_libsubdir +@@ -1329,6 +1330,9 @@ Optional Packages: + --with-aix-soname=3Daix|svr4|both + shared library versioning (aka "SONAME") varian= t to + provide on AIX ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-slibdir=3DDIR shared libraries in DIR LIBDIR + --with-build-libsubdir=3DDIR Directory where to find libraries for bui= ld system + --with-system-libunwind use installed libunwind +@@ -2403,6 +2407,22 @@ fi + $as_echo "$version_specific_libs" >&6; } +=20 +=20 ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ ++ + # Check whether --with-slibdir was given. + if test "${with_slibdir+set}" =3D set; then : + withval=3D$with_slibdir; slibdir=3D"$with_slibdir" +@@ -2410,7 +2430,14 @@ else + if test "${version_specific_libs}" =3D yes; then + slibdir=3D'$(libsubdir)' + elif test -n "$with_cross_host" && test x"$with_cross_host" !=3D x"no"; t= hen +- slibdir=3D'$(exec_prefix)/$(host_noncanonical)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ slibdir=3D'$(exec_prefix)/$(host_noncanonical)/lib' ++ ;; ++ *) ++ slibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + slibdir=3D'$(libdir)' + fi +@@ -2640,7 +2667,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_noncanonical)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_noncanonical)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libgomp/Makefile.in b/libgomp/Makefile.in +index 920d29d1c4c..9deafc4e0ce 100644 +--- a/libgomp/Makefile.in ++++ b/libgomp/Makefile.in +@@ -101,6 +101,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4= \ + $(top_srcdir)/../config/lthostflags.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/stdint.m4 \ + $(top_srcdir)/../config/tls.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libgomp/aclocal.m4 b/libgomp/aclocal.m4 +index a1f51f27651..c244c2549e5 100644 +--- a/libgomp/aclocal.m4 ++++ b/libgomp/aclocal.m4 +@@ -998,6 +998,7 @@ m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) + m4_include([../config/tls.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libgomp/configure b/libgomp/configure +index 06166c66120..6b3beae0f63 100755 +--- a/libgomp/configure ++++ b/libgomp/configure +@@ -782,6 +782,7 @@ enable_option_checking + enable_version_specific_runtime_libs + enable_generated_files_in_srcdir + enable_multilib ++with_toolexeclibdir + enable_dependency_tracking + enable_shared + enable_static +@@ -1455,6 +1456,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -3338,6 +3342,22 @@ fi + ac_config_commands=3D"$ac_config_commands default-1" +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -3353,7 +3373,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -11155,7 +11182,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11158 "configure" ++#line 11185 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11261,7 +11288,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11264 "configure" ++#line 11295 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libgomp/testsuite/Makefile.in b/libgomp/testsuite/Makefile.in +index 6edb7ae7ade..0492e7788ab 100644 +--- a/libgomp/testsuite/Makefile.in ++++ b/libgomp/testsuite/Makefile.in +@@ -63,6 +63,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lthostflags.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/stdint.m4 \ + $(top_srcdir)/../config/tls.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libhsail-rt/Makefile.in b/libhsail-rt/Makefile.in +index 528cdb0b423..0b6596b79bc 100644 +--- a/libhsail-rt/Makefile.in ++++ b/libhsail-rt/Makefile.in +@@ -106,6 +106,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4= \ + $(top_srcdir)/../config/depstand.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/configure.ac +diff --git a/libhsail-rt/aclocal.m4 b/libhsail-rt/aclocal.m4 +index 505744c695a..05de587bda2 100644 +--- a/libhsail-rt/aclocal.m4 ++++ b/libhsail-rt/aclocal.m4 +@@ -992,6 +992,7 @@ m4_include([../config/acx.m4]) + m4_include([../config/depstand.m4]) + m4_include([../config/lead-dot.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/libhsail-rt/configure b/libhsail-rt/configure +index a4fcc10c1f9..1b4f2a953d0 100755 +--- a/libhsail-rt/configure ++++ b/libhsail-rt/configure +@@ -737,6 +737,7 @@ enable_option_checking + enable_maintainer_mode + enable_dependency_tracking + enable_version_specific_runtime_libs ++with_toolexeclibdir + enable_shared + enable_static + with_pic +@@ -1395,6 +1396,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -4418,6 +4422,22 @@ fi + { $as_echo "$as_me:${as_lineno-$LINENO}: result: $enable_version_specific= _runtime_libs" >&5 + $as_echo "$enable_version_specific_runtime_libs" >&6; } +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -4433,7 +4453,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -10973,7 +11000,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10976 "configure" ++#line 11003 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11079,7 +11106,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11082 "configure" ++#line 11113 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libitm/Makefile.in b/libitm/Makefile.in +index bd16ce0cfb8..851c6b37f0b 100644 +--- a/libitm/Makefile.in ++++ b/libitm/Makefile.in +@@ -74,6 +74,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ + $(top_srcdir)/../config/tls.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/weakref.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ +diff --git a/libitm/aclocal.m4 b/libitm/aclocal.m4 +index 26de26b7808..3b67780342a 100644 +--- a/libitm/aclocal.m4 ++++ b/libitm/aclocal.m4 +@@ -1022,6 +1022,7 @@ m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) + m4_include([../config/tls.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../config/weakref.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/libitm/configure b/libitm/configure +index 96c494d4a3f..ed47fab3c83 100644 +--- a/libitm/configure ++++ b/libitm/configure +@@ -766,6 +766,7 @@ enable_option_checking + enable_version_specific_runtime_libs + enable_generated_files_in_srcdir + enable_multilib ++with_toolexeclibdir + enable_dependency_tracking + enable_shared + enable_static +@@ -1430,6 +1431,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -3371,6 +3375,22 @@ fi + ac_config_commands=3D"$ac_config_commands default-1" +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${enable_version_specific_runtime_libs} in +@@ -3386,7 +3406,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -11794,7 +11821,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11797 "configure" ++#line 11824 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11900,7 +11927,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11903 "configure" ++#line 11934 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libitm/testsuite/Makefile.in b/libitm/testsuite/Makefile.in +index eb9e992279d..88d2120c156 100644 +--- a/libitm/testsuite/Makefile.in ++++ b/libitm/testsuite/Makefile.in +@@ -66,6 +66,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ + $(top_srcdir)/../config/tls.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/weakref.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ +diff --git a/liboffloadmic/Makefile.in b/liboffloadmic/Makefile.in +index f4470c6e4d4..d42745a49e0 100644 +--- a/liboffloadmic/Makefile.in ++++ b/liboffloadmic/Makefile.in +@@ -94,6 +94,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/lead-dot.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/configure.ac +diff --git a/liboffloadmic/aclocal.m4 b/liboffloadmic/aclocal.m4 +index 4bb1d43a5e5..c62ed26f6b1 100644 +--- a/liboffloadmic/aclocal.m4 ++++ b/liboffloadmic/aclocal.m4 +@@ -993,6 +993,7 @@ m4_include([../config/depstand.m4]) + m4_include([../config/lead-dot.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/liboffloadmic/configure b/liboffloadmic/configure +index f873716991b..6dfe9e37642 100644 +--- a/liboffloadmic/configure ++++ b/liboffloadmic/configure +@@ -739,6 +739,7 @@ enable_maintainer_mode + enable_dependency_tracking + enable_multilib + enable_version_specific_runtime_libs ++with_toolexeclibdir + enable_shared + enable_static + with_pic +@@ -1397,6 +1398,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -5003,6 +5007,22 @@ else + fi +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir. + # Also toolexecdir, though it's only used in toolexeclibdir. + case ${enable_version_specific_runtime_libs} in +@@ -5018,7 +5038,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -11108,7 +11135,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11111 "configure" ++#line 11138 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11214,7 +11241,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11217 "configure" ++#line 11248 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/liboffloadmic/plugin/Makefile.in b/liboffloadmic/plugin/Makef= ile.in +index 2a7c8d2ec6c..6e180f6a23c 100644 +--- a/liboffloadmic/plugin/Makefile.in ++++ b/liboffloadmic/plugin/Makefile.in +@@ -90,6 +90,7 @@ DIST_COMMON =3D $(srcdir)/Makefile.in $(srcdir)/Makefile= .am \ + ACLOCAL_M4 =3D $(top_srcdir)/aclocal.m4 + am__aclocal_m4_deps =3D $(top_srcdir)/../../config/acx.m4 \ + $(top_srcdir)/../../config/depstand.m4 \ ++ $(top_srcdir)/../../config/toolexeclibdir.m4 \ + $(top_srcdir)/../../config/lead-dot.m4 \ + $(top_srcdir)/../../config/multi.m4 \ + $(top_srcdir)/../../config/override.m4 \ +diff --git a/liboffloadmic/plugin/aclocal.m4 b/liboffloadmic/plugin/acloca= l.m4 +index a4179ef40ac..6d90e5d6e16 100644 +--- a/liboffloadmic/plugin/aclocal.m4 ++++ b/liboffloadmic/plugin/aclocal.m4 +@@ -990,6 +990,7 @@ AC_SUBST([am__untar]) +=20 + m4_include([../../config/acx.m4]) + m4_include([../../config/depstand.m4]) ++m4_include([../../config/toolexeclibdir.m4]) + m4_include([../../config/lead-dot.m4]) + m4_include([../../config/multi.m4]) + m4_include([../../config/override.m4]) +diff --git a/liboffloadmic/plugin/configure b/liboffloadmic/plugin/configu= re +index c031eb3e7fa..570758344b4 100644 +--- a/liboffloadmic/plugin/configure ++++ b/liboffloadmic/plugin/configure +@@ -735,6 +735,7 @@ enable_maintainer_mode + enable_dependency_tracking + enable_multilib + enable_version_specific_runtime_libs ++with_toolexeclibdir + enable_shared + enable_static + with_pic +@@ -1394,6 +1395,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -4311,6 +4315,22 @@ fi + $as_echo "$enable_version_specific_runtime_libs" >&6; } +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir. + # Also toolexecdir, though it's only used in toolexeclibdir. + case ${enable_version_specific_runtime_libs} in +@@ -4326,7 +4346,14 @@ case ${enable_version_specific_runtime_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -10815,7 +10842,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10818 "configure" ++#line 10845 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -10921,7 +10948,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10924 "configure" ++#line 10955 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libquadmath/Makefile.in b/libquadmath/Makefile.in +index 428e0158aca..e5c7aba84b7 100644 +--- a/libquadmath/Makefile.in ++++ b/libquadmath/Makefile.in +@@ -67,6 +67,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libquadmath/aclocal.m4 b/libquadmath/aclocal.m4 +index b9ebb8a9ed4..59009468a47 100644 +--- a/libquadmath/aclocal.m4 ++++ b/libquadmath/aclocal.m4 +@@ -1030,6 +1030,7 @@ m4_include([../config/lthostflags.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/no-executables.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libquadmath/configure b/libquadmath/configure +index 76a2c20b7e1..e887071aeb2 100755 +--- a/libquadmath/configure ++++ b/libquadmath/configure +@@ -749,6 +749,7 @@ enable_fast_install + with_gnu_ld + enable_libtool_lock + enable_maintainer_mode ++with_toolexeclibdir + enable_symvers + enable_generated_files_in_srcdir + with_gcc_major_version_only +@@ -1408,6 +1409,9 @@ Optional Packages: + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-gcc-major-version-only + use only GCC major number in filesystem paths +=20 +@@ -10572,7 +10576,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10575 "configure" ++#line 10579 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -10678,7 +10682,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10681 "configure" ++#line 10689 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11917,6 +11921,22 @@ ac_link=3D'$CC -o conftest$ac_exeext $CFLAGS $CPP= FLAGS $LDFLAGS conftest.$ac_ext $ + ac_compiler_gnu=3D$ac_cv_c_compiler_gnu +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -11932,7 +11952,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libsanitizer/Makefile.in b/libsanitizer/Makefile.in +index 1f4bb8cd6bb..fb533c253ea 100644 +--- a/libsanitizer/Makefile.in ++++ b/libsanitizer/Makefile.in +@@ -71,6 +71,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/aclocal.m4 b/libsanitizer/aclocal.m4 +index 55e063530f6..f51347671e3 100644 +--- a/libsanitizer/aclocal.m4 ++++ b/libsanitizer/aclocal.m4 +@@ -1017,6 +1017,7 @@ m4_include([../config/libstdc++-raw-cxx.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) + m4_include([../ltversion.m4]) +diff --git a/libsanitizer/asan/Makefile.in b/libsanitizer/asan/Makefile.in +index 4dad60ba1ae..f079e07f0da 100644 +--- a/libsanitizer/asan/Makefile.in ++++ b/libsanitizer/asan/Makefile.in +@@ -66,6 +66,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/configure b/libsanitizer/configure +index a3a08d635f4..5f4cdcad38d 100755 +--- a/libsanitizer/configure ++++ b/libsanitizer/configure +@@ -767,6 +767,7 @@ enable_multilib + enable_version_specific_runtime_libs + enable_dependency_tracking + enable_maintainer_mode ++with_toolexeclibdir + enable_shared + enable_static + with_pic +@@ -1425,6 +1426,9 @@ Optional Features: + Optional Packages: + --with-PACKAGE[=3DARG] use PACKAGE [ARG=3Dyes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=3Dno) ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] +@@ -4773,6 +4777,22 @@ fi +=20 +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -4788,7 +4808,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +@@ -12032,7 +12059,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 12035 "configure" ++#line 12062 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -12138,7 +12165,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 12141 "configure" ++#line 12168 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +diff --git a/libsanitizer/interception/Makefile.in b/libsanitizer/intercep= tion/Makefile.in +index c71fb57b8b8..ed9c996b5eb 100644 +--- a/libsanitizer/interception/Makefile.in ++++ b/libsanitizer/interception/Makefile.in +@@ -62,6 +62,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/libbacktrace/Makefile.in b/libsanitizer/libbackt= race/Makefile.in +index dff04cfa3ea..22655306594 100644 +--- a/libsanitizer/libbacktrace/Makefile.in ++++ b/libsanitizer/libbacktrace/Makefile.in +@@ -94,6 +94,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/lsan/Makefile.in b/libsanitizer/lsan/Makefile.in +index baa8367cd40..efae691d3ef 100644 +--- a/libsanitizer/lsan/Makefile.in ++++ b/libsanitizer/lsan/Makefile.in +@@ -63,6 +63,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/sanitizer_common/Makefile.in b/libsanitizer/sani= tizer_common/Makefile.in +index c375f63a380..27c8b410ef7 100644 +--- a/libsanitizer/sanitizer_common/Makefile.in ++++ b/libsanitizer/sanitizer_common/Makefile.in +@@ -68,6 +68,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/tsan/Makefile.in b/libsanitizer/tsan/Makefile.in +index 770c053e64f..a77cda3d0f3 100644 +--- a/libsanitizer/tsan/Makefile.in ++++ b/libsanitizer/tsan/Makefile.in +@@ -65,6 +65,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libsanitizer/ubsan/Makefile.in b/libsanitizer/ubsan/Makefile.= in +index 1664ce9497e..108505c3c67 100644 +--- a/libsanitizer/ubsan/Makefile.in ++++ b/libsanitizer/ubsan/Makefile.in +@@ -64,6 +64,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../ltoptions.m4 $(top_srcdir)/../ltsugar.m4 \ + $(top_srcdir)/../ltversion.m4 $(top_srcdir)/../lt~obsolete.m4 \ + $(top_srcdir)/acinclude.m4 $(top_srcdir)/../libtool.m4 \ +diff --git a/libssp/Makefile.in b/libssp/Makefile.in +index 96b03ae1248..c119ef3e8a2 100644 +--- a/libssp/Makefile.in ++++ b/libssp/Makefile.in +@@ -67,6 +67,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/multi.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ + $(top_srcdir)/../lt~obsolete.m4 $(top_srcdir)/configure.ac +diff --git a/libssp/aclocal.m4 b/libssp/aclocal.m4 +index 927988e5814..46585360592 100644 +--- a/libssp/aclocal.m4 ++++ b/libssp/aclocal.m4 +@@ -995,6 +995,7 @@ m4_include([../config/lthostflags.m4]) + m4_include([../config/multi.m4]) + m4_include([../config/no-executables.m4]) + m4_include([../config/override.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) + m4_include([../ltsugar.m4]) +diff --git a/libssp/configure b/libssp/configure +index ee1751d20db..3273cd40ab1 100755 +--- a/libssp/configure ++++ b/libssp/configure +@@ -743,6 +743,7 @@ with_pic + enable_fast_install + with_gnu_ld + enable_libtool_lock ++with_toolexeclibdir + with_gcc_major_version_only + ' + ac_precious_vars=3D'build_alias +@@ -1389,6 +1390,9 @@ Optional Packages: + --with-pic try to use only PIC/non-PIC objects [default=3D= use + both] + --with-gnu-ld assume the C compiler uses GNU ld [default=3Dno] ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-gcc-major-version-only + use only GCC major number in filesystem paths +=20 +@@ -10671,7 +10675,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10674 "configure" ++#line 10678 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -10777,7 +10781,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 10780 "configure" ++#line 10784 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11039,6 +11043,22 @@ esac +=20 +=20 +=20 ++ ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ ++ ++ + # Calculate toolexeclibdir + # Also toolexecdir, though it's only used in toolexeclibdir + case ${version_specific_libs} in +@@ -11054,7 +11074,14 @@ case ${version_specific_libs} in + test x"$with_cross_host" !=3D x"no"; then + # Install a library built with a cross compiler in tooldir, not lib= dir. + toolexecdir=3D'$(exec_prefix)/$(target_alias)' +- toolexeclibdir=3D'$(toolexecdir)/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ toolexeclibdir=3D'$(toolexecdir)/lib' ++ ;; ++ *) ++ toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + toolexecdir=3D'$(libdir)/gcc-lib/$(target_alias)' + toolexeclibdir=3D'$(libdir)' +diff --git a/libstdc++-v3/Makefile.in b/libstdc++-v3/Makefile.in +index 85d56fb6a04..a4242569962 100644 +--- a/libstdc++-v3/Makefile.in ++++ b/libstdc++-v3/Makefile.in +@@ -74,6 +74,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/acinclude.m4 b/libstdc++-v3/acinclude.m4 +index 08319dc5549..b97ff8db335 100644 +--- a/libstdc++-v3/acinclude.m4 ++++ b/libstdc++-v3/acinclude.m4 +@@ -790,6 +790,8 @@ AC_DEFUN([GLIBCXX_EXPORT_INSTALL_INFO], [ + [version_specific_libs=3Dno]) + AC_MSG_RESULT($version_specific_libs) +=20 ++ GCC_WITH_TOOLEXECLIBDIR ++ + # Default case for install directory for include files. + if test $version_specific_libs =3D no && test $gxx_include_dir =3D no; = then + gxx_include_dir=3D'include/c++/${gcc_version}' +@@ -820,7 +822,14 @@ AC_DEFUN([GLIBCXX_EXPORT_INSTALL_INFO], [ + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + glibcxx_toolexecdir=3D'${exec_prefix}/${host_alias}' +- glibcxx_toolexeclibdir=3D'${toolexecdir}/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ glibcxx_toolexeclibdir=3D'${toolexecdir}/lib' ++ ;; ++ *) ++ glibcxx_toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + glibcxx_toolexecdir=3D'${libdir}/gcc/${host_alias}' + glibcxx_toolexeclibdir=3D'${libdir}' +diff --git a/libstdc++-v3/aclocal.m4 b/libstdc++-v3/aclocal.m4 +index 229d0354116..16c6e61cf7e 100644 +--- a/libstdc++-v3/aclocal.m4 ++++ b/libstdc++-v3/aclocal.m4 +@@ -684,6 +684,7 @@ m4_include([../config/multi.m4]) + m4_include([../config/no-executables.m4]) + m4_include([../config/override.m4]) + m4_include([../config/stdint.m4]) ++m4_include([../config/toolexeclibdir.m4]) + m4_include([../config/unwind_ipinfo.m4]) + m4_include([../libtool.m4]) + m4_include([../ltoptions.m4]) +diff --git a/libstdc++-v3/configure b/libstdc++-v3/configure +index de8390703e2..88de3f728d4 100755 +--- a/libstdc++-v3/configure ++++ b/libstdc++-v3/configure +@@ -903,6 +903,7 @@ enable_libstdcxx_threads + enable_libstdcxx_filesystem_ts + with_gxx_include_dir + enable_version_specific_runtime_libs ++with_toolexeclibdir + with_gcc_major_version_only + ' + ac_precious_vars=3D'build_alias +@@ -1623,6 +1624,9 @@ Optional Packages: + set the std::string ABI to use by default + --with-gxx-include-dir=3DDIR + installation directory for include files ++ --with-toolexeclibdir=3DDIR ++ install libraries built with a cross compiler w= ithin ++ DIR + --with-gcc-major-version-only + use only GCC major number in filesystem paths +=20 +@@ -11606,7 +11610,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11609 "configure" ++#line 11613 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -11712,7 +11716,7 @@ else + lt_dlunknown=3D0; lt_dlno_uscore=3D1; lt_dlneed_uscore=3D2 + lt_status=3D$lt_dlunknown + cat > conftest.$ac_ext <<_LT_EOF +-#line 11715 "configure" ++#line 11723 "configure" + #include "confdefs.h" +=20 + #if HAVE_DLFCN_H +@@ -15398,7 +15402,7 @@ $as_echo "$glibcxx_cv_atomic_long_long" >&6; } + # Fake what AC_TRY_COMPILE does. +=20 + cat > conftest.$ac_ext << EOF +-#line 15401 "configure" ++#line 15409 "configure" + int main() + { + typedef bool atomic_type; +@@ -15433,7 +15437,7 @@ $as_echo "$glibcxx_cv_atomic_bool" >&6; } + rm -f conftest* +=20 + cat > conftest.$ac_ext << EOF +-#line 15436 "configure" ++#line 15440 "configure" + int main() + { + typedef short atomic_type; +@@ -15468,7 +15472,7 @@ $as_echo "$glibcxx_cv_atomic_short" >&6; } + rm -f conftest* +=20 + cat > conftest.$ac_ext << EOF +-#line 15471 "configure" ++#line 15475 "configure" + int main() + { + // NB: _Atomic_word not necessarily int. +@@ -15504,7 +15508,7 @@ $as_echo "$glibcxx_cv_atomic_int" >&6; } + rm -f conftest* +=20 + cat > conftest.$ac_ext << EOF +-#line 15507 "configure" ++#line 15511 "configure" + int main() + { + typedef long long atomic_type; +@@ -15585,7 +15589,7 @@ $as_echo "$as_me: WARNING: Performance of certain = classes will degrade as a resu + # unnecessary for this test. +=20 + cat > conftest.$ac_ext << EOF +-#line 15588 "configure" ++#line 15592 "configure" + int main() + { + _Decimal32 d1; +@@ -15627,7 +15631,7 @@ ac_compiler_gnu=3D$ac_cv_cxx_compiler_gnu + # unnecessary for this test. +=20 + cat > conftest.$ac_ext << EOF +-#line 15630 "configure" ++#line 15634 "configure" + template + struct same + { typedef T2 type; }; +@@ -15661,7 +15665,7 @@ $as_echo "$enable_int128" >&6; } + rm -f conftest* +=20 + cat > conftest.$ac_ext << EOF +-#line 15664 "configure" ++#line 15668 "configure" + template + struct same + { typedef T2 type; }; +@@ -81674,6 +81678,19 @@ fi + { $as_echo "$as_me:${as_lineno-$LINENO}: result: $version_specific_libs= " >&5 + $as_echo "$version_specific_libs" >&6; } +=20 ++# Check whether --with-toolexeclibdir was given. ++if test "${with_toolexeclibdir+set}" =3D set; then : ++ withval=3D$with_toolexeclibdir; case ${with_toolexeclibdir} in ++ /) ++ ;; ++ */) ++ with_toolexeclibdir=3D`echo $with_toolexeclibdir | sed 's,/$,,'` ++ ;; ++esac ++else ++ with_toolexeclibdir=3Dno ++fi ++ + # Default case for install directory for include files. + if test $version_specific_libs =3D no && test $gxx_include_dir =3D no; = then + gxx_include_dir=3D'include/c++/${gcc_version}' +@@ -81704,7 +81721,14 @@ $as_echo "$version_specific_libs" >&6; } + if test -n "$with_cross_host" && + test x"$with_cross_host" !=3D x"no"; then + glibcxx_toolexecdir=3D'${exec_prefix}/${host_alias}' +- glibcxx_toolexeclibdir=3D'${toolexecdir}/lib' ++ case ${with_toolexeclibdir} in ++ no) ++ glibcxx_toolexeclibdir=3D'${toolexecdir}/lib' ++ ;; ++ *) ++ glibcxx_toolexeclibdir=3D${with_toolexeclibdir} ++ ;; ++ esac + else + glibcxx_toolexecdir=3D'${libdir}/gcc/${host_alias}' + glibcxx_toolexeclibdir=3D'${libdir}' +diff --git a/libstdc++-v3/doc/Makefile.in b/libstdc++-v3/doc/Makefile.in +index c98c42fce98..c61f0dc1aa0 100644 +--- a/libstdc++-v3/doc/Makefile.in ++++ b/libstdc++-v3/doc/Makefile.in +@@ -69,6 +69,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/include/Makefile.in b/libstdc++-v3/include/Makef= ile.in +index 980cabb80e2..e57652bbda0 100644 +--- a/libstdc++-v3/include/Makefile.in ++++ b/libstdc++-v3/include/Makefile.in +@@ -69,6 +69,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/libsupc++/Makefile.in b/libstdc++-v3/libsupc++/M= akefile.in +index 7386771d475..c0296d0a342 100644 +--- a/libstdc++-v3/libsupc++/Makefile.in ++++ b/libstdc++-v3/libsupc++/Makefile.in +@@ -71,6 +71,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/po/Makefile.in b/libstdc++-v3/po/Makefile.in +index d92d8b8ac6a..1166a4f55d1 100644 +--- a/libstdc++-v3/po/Makefile.in ++++ b/libstdc++-v3/po/Makefile.in +@@ -69,6 +69,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/python/Makefile.in b/libstdc++-v3/python/Makefil= e.in +index df8285226fa..188a3ab1a5d 100644 +--- a/libstdc++-v3/python/Makefile.in ++++ b/libstdc++-v3/python/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/Makefile.in b/libstdc++-v3/src/Makefile.in +index f0755f015a1..b168f992be8 100644 +--- a/libstdc++-v3/src/Makefile.in ++++ b/libstdc++-v3/src/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/c++11/Makefile.in b/libstdc++-v3/src/c++11/M= akefile.in +index 73852e75c25..8dff9e75ab6 100644 +--- a/libstdc++-v3/src/c++11/Makefile.in ++++ b/libstdc++-v3/src/c++11/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/c++17/Makefile.in b/libstdc++-v3/src/c++17/M= akefile.in +index 26a4713831d..07a88759fb2 100644 +--- a/libstdc++-v3/src/c++17/Makefile.in ++++ b/libstdc++-v3/src/c++17/Makefile.in +@@ -105,6 +105,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4= \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/c++98/Makefile.in b/libstdc++-v3/src/c++98/M= akefile.in +index c0a55171935..1e168815777 100644 +--- a/libstdc++-v3/src/c++98/Makefile.in ++++ b/libstdc++-v3/src/c++98/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/src/filesystem/Makefile.in b/libstdc++-v3/src/fi= lesystem/Makefile.in +index 3312d0306ca..bf32707c781 100644 +--- a/libstdc++-v3/src/filesystem/Makefile.in ++++ b/libstdc++-v3/src/filesystem/Makefile.in +@@ -70,6 +70,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +diff --git a/libstdc++-v3/testsuite/Makefile.in b/libstdc++-v3/testsuite/M= akefile.in +index 5797a55b728..61cd1317a16 100644 +--- a/libstdc++-v3/testsuite/Makefile.in ++++ b/libstdc++-v3/testsuite/Makefile.in +@@ -69,6 +69,7 @@ am__aclocal_m4_deps =3D $(top_srcdir)/../config/acx.m4 \ + $(top_srcdir)/../config/no-executables.m4 \ + $(top_srcdir)/../config/override.m4 \ + $(top_srcdir)/../config/stdint.m4 \ ++ $(top_srcdir)/../config/toolexeclibdir.m4 \ + $(top_srcdir)/../config/unwind_ipinfo.m4 \ + $(top_srcdir)/../libtool.m4 $(top_srcdir)/../ltoptions.m4 \ + $(top_srcdir)/../ltsugar.m4 $(top_srcdir)/../ltversion.m4 \ +--=20 +2.24.0 + --=20 2.24.0 --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Tue Mar 24 06:54:34 2020 Received: (at 39941) by debbugs.gnu.org; 24 Mar 2020 10:54:35 +0000 Received: from localhost ([127.0.0.1]:53967 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jGhCY-0003t5-Ld for submit@debbugs.gnu.org; Tue, 24 Mar 2020 06:54:34 -0400 Received: from eggs.gnu.org ([209.51.188.92]:42842) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jGhCT-0003sq-On for 39941@debbugs.gnu.org; Tue, 24 Mar 2020 06:54:29 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:45293) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1jGhCO-0008QP-Ga; Tue, 24 Mar 2020 06:54:20 -0400 Received: from [2a01:e0a:1d:7270:af76:b9b:ca24:c465] (port=44510 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1jGhCN-0001PZ-Bd; Tue, 24 Mar 2020 06:54:20 -0400 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Mathieu Othacehe Subject: Re: bug#39941: Disk-image size increase on core-updates. References: <87sgimdjcj.fsf@gmail.com> <87eeu0h8d6.fsf@gmail.com> <87a74nhstf.fsf@gnu.org> <87zhcnympn.fsf@gmail.com> <87r1xyfx7o.fsf@gnu.org> <87a74jnr4f.fsf@gmail.com> <87y2s3ktkn.fsf@devup.no> <875zf5lv79.fsf@gmail.com> <87tv2pilrj.fsf@gnu.org> <87pndbb4py.fsf@gmail.com> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 5 Germinal an 228 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Tue, 24 Mar 2020 11:54:17 +0100 In-Reply-To: <87pndbb4py.fsf@gmail.com> (Mathieu Othacehe's message of "Tue, 17 Mar 2020 12:28:25 +0100") Message-ID: <87y2rqm3ae.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 39941 Cc: Marius Bakke , 39941@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Hi, Mathieu Othacehe skribis: >> Perhaps add =E2=80=9CFixes .=E2=80=9D > > Well I think it doesn't. In the bug report 39941, I reported a recent > increase of the cross-compiled disk-image on core-updates (1.5 -> 2.0 > GiB), over the last two months. It is not resolved, and this patch fixes > something that has always been around I guess. OK. >>> + ;; TOOLDIR_BASE_PREFIX is erroneous when using a separate "lib" >>> + ;; output. Specify it correctly, otherwise GCC won't find its sha= red >>> + ;; libraries installed in the "lib" output. >> >> How erroneous is it? Is there a bug report we could link to? > > I didn't find any bug report related. The issue is that in > gcc/Makefile.in, when computing libsubdir_to_prefix: > > libsubdir_to_prefix :=3D \ > $(unlibsubdir)/$(shell echo "$(libdir)" | \ > sed -e 's|^$(prefix)||' -e 's|/$$||' -e 's|^[^/]|/|' \ > -e 's|/[^/]*|../|g') > > > unlibsubdir is ../../../ > libdir /gnu/store/xxx-gcc-cross-aarch64-linux-gnu-7.5.0-lib/lib > prefix is /gnu/store/yyy-gcc-cross-aarch64-linux-gnu-7.5.0 > > then, > > libsubdir_to_prefix =3D ../../../../../.. > > Which then gives a search path that looks like: > > /gnu/store/5qh73asm77554wj43z2wjdrkl3fjxxbp-gcc-cross-aarch64-linux-gnu-7= .5.0-lib/lib/gcc/aarch64-linux-gnu/7.5.0/../../../../../../../aarch64-linux= -gnu/lib/aarch64-linux-gnu/7.5.0/ > > So its just that this hack is completely broken for non FHS compliant > path I guess. Uh. Perhaps just link to this bug report in the file, then. > Note that on our native toolchain, we have the same issue. If you run: > > `guix build -e '(@@ (gnu packages gcc) gcc-9)'|tail -1`/bin/gcc -print-s= earch-dirs > > > You can see the same kind of wrong path: > > /gnu/store/347y0zr1a9s2f5pkcncgi3gd0r33qq81-gcc-9.2.0-lib/lib/gcc/x86_64-= unknown-linux-gnu/9.2.0/../../../../../../../x86_64-unknown-linux-gnu/lib/x= 86_64-unknown-linux-gnu/9.2.0/ > > > and it still works, because of this snippet in GCC, disabled when > cross-compiling: > > else if (*cross_compile =3D=3D '0') > { > add_prefix (&startfile_prefixes, > concat (gcc_exec_prefix > ? gcc_exec_prefix : standard_exec_prefix, > machine_suffix, > standard_startfile_prefix, NULL), > NULL, PREFIX_PRIORITY_LAST, 0, 1); > } > > > that produces an extra search-path that looks like: > > /gnu/store/347y0zr1a9s2f5pkcncgi3gd0r33qq81-gcc-9.2.0-lib/lib/gcc/x86_64-= unknown-linux-gnu/9.2.0/../../../ > > In short, quite a big mess... Woow. Indeed. > From 31402fc14126f04e175081ce851e9794cc3ab218 Mon Sep 17 00:00:00 2001 > From: Mathieu Othacehe > Date: Sat, 14 Mar 2020 11:39:52 +0100 > Subject: [PATCH] gnu: cross-gcc: Add a "lib" output. > > Add a "lib" output to cross-gcc. This requires an upstream GCC patch addi= ng > support for --with-toolexeclibdir configure option. This option allows to > install cross-built GCC libraries in a specific location. > > This also fixes the computation of TOOLDIR_BASE_PREFIX, that fails when > /gnu/store/... directories are involved. > > * gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch: New file. > * gnu/local.mk (dist_patch_DATA): Add it. > * gnu/packages/cross-base.scm (cross-gcc)[source]: Apply it, > [outputs]: add a "lib" output, > (cross-gcc-snippet): fix TOOLDIR_BASE_PREFIX. [...] > + (append (cond > + ((version>=3D? (package-version xgcc) "8.0") > + (search-patches "gcc-8-cross-environment-variabl= es.patch")) > + ((version>=3D? (package-version xgcc) "6.0") > + (search-patches "gcc-7-cross-toolexeclibdir.patc= h" > + "gcc-6-cross-environment-variabl= es.patch")) > + (else (search-patches "gcc-cross-environment-var= iables.patch"))) The indentation is off here. > +++ b/gnu/packages/patches/gcc-7-cross-toolexeclibdir.patch > @@ -0,0 +1,1677 @@ > +This patch taken from GCC upstream adds support for overriding cross-com= piled > +shared libraries installation path. This is needed to have a separate "= lib" > +output containing those shared libraries. > + > +See: > +https://gcc.gnu.org/git/?p=3Dgcc.git;a=3Dcommit;h=3De8e66971cdc6d1390d47= a227899e2e340ff44d66 > + > +This commit has been stripped. Some modifications to Changelogs and > +configure.ac scripts were removed. I think we can still remove the M4 files as well as changes to unrelated =E2=80=98configure=E2=80=99 scripts > +From fe6b5640a52a6e75dddea834e357974c205c737c Mon Sep 17 00:00:00 2001 > +From: "Maciej W. Rozycki" > +Date: Fri, 24 Jan 2020 11:24:25 +0000 > +Subject: [PATCH] Add `--with-toolexeclibdir=3D' configuration option > + > +Provide means, in the form of a `--with-toolexeclibdir=3D' configuration > +option, to override the default installation directory for target > +libraries, otherwise known as $toolexeclibdir. This is so that it is > +possible to get newly-built libraries, particularly the shared ones, > +installed in a common place, so that they can be readily used by the > +target system as their host libraries, possibly over NFS, without a need > +to manually copy them over from the currently hardcoded location they > +would otherwise be installed in. > + > +In the presence of the `--enable-version-specific-runtime-libs' option > +and for configurations building native GCC the option is ignored. [...] > +--- a/libgcc/configure > ++++ b/libgcc/configure I suspect this is the only file we need to patch, no? At least, we can remove all the m4 and m4-related Makefile.in changes and the unrelated =E2=80=98configure=E2=80=99 changes. Thanks, Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Tue Mar 24 13:01:26 2020 Received: (at 39941) by debbugs.gnu.org; 24 Mar 2020 17:01:26 +0000 Received: from localhost ([127.0.0.1]:55507 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jGmvT-00035T-F2 for submit@debbugs.gnu.org; Tue, 24 Mar 2020 13:01:26 -0400 Received: from mail-wm1-f42.google.com ([209.85.128.42]:40244) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jGmvR-000350-EE for 39941@debbugs.gnu.org; Tue, 24 Mar 2020 13:01:14 -0400 Received: by mail-wm1-f42.google.com with SMTP id a81so4284998wmf.5 for <39941@debbugs.gnu.org>; Tue, 24 Mar 2020 10:01:13 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=references:user-agent:from:to:cc:subject:in-reply-to:date :message-id:mime-version:content-transfer-encoding; bh=Jk21fETnLZeMVc9UfdAu3h8AY8JI1TAue7hOCxWJKMI=; b=uE2t5q/VmMFpzcPYiMvVhKhT6tCVUOpwuPrhNcuka8kwCJDkruhQDcdQlRYDDxkahk vMT76v7KI5Uwtr/xeA29dXhtF5pLrPum8pk5hmrvRqdCnQiL+MP694g2VXq5ztHxLY7h vFKMKukUkM7+Y3Do1ld6+vFflGyWpdq33o+iLv0eN3gLu5grLZ1SQ3ZiyaINMi3IsYFS kVZStdn73lXZo9wo9YLe6f6PSc7zqytEzlxichKHzdnpzedLU6EB/7WXPuGorZmAn2DG O8jVhV4pGgLU0qYUzpKuEfLs16XQn4AB8I3CEDfLgRMh/JKSR9t3FwDrgonbhEr2AArM cH2w== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:references:user-agent:from:to:cc:subject :in-reply-to:date:message-id:mime-version:content-transfer-encoding; bh=Jk21fETnLZeMVc9UfdAu3h8AY8JI1TAue7hOCxWJKMI=; b=lECcwKn71WyT5H9Rs0zrBImGowrU6lxaEI7nqUReT0ZSoiy3xC3QgeNogul1Q4gedU C44mkm2EnLvQTnnqfmO7lhp6LdRnizPACe5vrhjdBnmcI7GuzDzKDidqXI1lw5srkYs3 aF4wJ+nru42dDP1HQc5PB6MXLjG8FA44Z9mF2pRSWJrf0BFJ0kDKL54uZ11eqYVcO/mU fTxRy1GM0Agsp9+ZC81KgsQ/ib+R/hUqGiGTlgmLZu2s90n5+dC6oXqSneDmil7aOSTl TQDmDiva7SRj5n7mvDjZe5y/CzC5MaATSNIEwgjqSlRsNccDy+uLunYyu+jZIuBHxKPu Tm1Q== X-Gm-Message-State: ANhLgQ1wQ+0eL95KA+k1XoMF+Db6JXJH1lXfiUH5za7htF7eY6vBC+W9 FFzuCZIU+FJX0pGQL3pHnBp+OyTFJmM= X-Google-Smtp-Source: ADFU+vsx8skebt36dslkvwrLiiXcNURuPh6HBI4FtFu+N0NsMR4OUEVoBa98dgxNtEiCvt8Ukt1ZKw== X-Received: by 2002:a1c:195:: with SMTP id 143mr6679676wmb.0.1585069267236; Tue, 24 Mar 2020 10:01:07 -0700 (PDT) Received: from meru ([2a01:cb18:832e:5f00:c52e:f3b2:4a67:5ae2]) by smtp.gmail.com with ESMTPSA id h81sm5549628wme.42.2020.03.24.10.01.05 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Tue, 24 Mar 2020 10:01:06 -0700 (PDT) References: <87sgimdjcj.fsf@gmail.com> <87eeu0h8d6.fsf@gmail.com> <87a74nhstf.fsf@gnu.org> <87zhcnympn.fsf@gmail.com> <87r1xyfx7o.fsf@gnu.org> <87a74jnr4f.fsf@gmail.com> <87y2s3ktkn.fsf@devup.no> <875zf5lv79.fsf@gmail.com> <87tv2pilrj.fsf@gnu.org> <87pndbb4py.fsf@gmail.com> <87y2rqm3ae.fsf@gnu.org> User-agent: mu4e 1.2.0; emacs 26.3 From: Mathieu Othacehe To: Ludovic =?utf-8?Q?Court=C3=A8s?= Subject: Re: bug#39941: Disk-image size increase on core-updates. In-reply-to: <87y2rqm3ae.fsf@gnu.org> Date: Tue, 24 Mar 2020 18:01:05 +0100 Message-ID: <87ftdxoffy.fsf@gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 39941 Cc: Marius Bakke , 39941@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) >> +--- a/libgcc/configure >> ++++ b/libgcc/configure > > I suspect this is the only file we need to patch, no? At least, we can > remove all the m4 and m4-related Makefile.in changes and the unrelated > =E2=80=98configure=E2=80=99 changes. The configure files of the other libraries are needed too because they end-up in the same folder: --8<---------------cut here---------------start------------->8--- mathieu@elbruz ~/guix [env]$ ls /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja= -gcc-cross-aarch64-linux-gnu-7.5.0-lib/aarch64-linux-gnu/lib/*so /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7.5= .0-lib/aarch64-linux-gnu/lib/libasan.so /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7.5= .0-lib/aarch64-linux-gnu/lib/libatomic.so /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7.5= .0-lib/aarch64-linux-gnu/lib/libgcc_s.so /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7.5= .0-lib/aarch64-linux-gnu/lib/libgomp.so /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7.5= .0-lib/aarch64-linux-gnu/lib/libitm.so /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7.5= .0-lib/aarch64-linux-gnu/lib/liblsan.so /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7.5= .0-lib/aarch64-linux-gnu/lib/libssp.so /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7.5= .0-lib/aarch64-linux-gnu/lib/libstdc++.so /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7.5= .0-lib/aarch64-linux-gnu/lib/libtsan.so /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7.5= .0-lib/aarch64-linux-gnu/lib/libubsan.so --8<---------------cut here---------------end--------------->8--- But the m4 file and m4-related changes are definitely useless. I removed them and pushed! Thanks, Mathieu From debbugs-submit-bounces@debbugs.gnu.org Wed Mar 25 17:35:06 2020 Received: (at 39941) by debbugs.gnu.org; 25 Mar 2020 21:35:06 +0000 Received: from localhost ([127.0.0.1]:57884 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jHDfr-0000jI-KT for submit@debbugs.gnu.org; Wed, 25 Mar 2020 17:35:06 -0400 Received: from eggs.gnu.org ([209.51.188.92]:33360) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jHDfp-0000j5-DF for 39941@debbugs.gnu.org; Wed, 25 Mar 2020 17:34:53 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:49164) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1jHDfk-0008Ow-8s; Wed, 25 Mar 2020 17:34:48 -0400 Received: from [2a01:e0a:1d:7270:af76:b9b:ca24:c465] (port=35870 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1jHDfj-0003oe-Nm; Wed, 25 Mar 2020 17:34:48 -0400 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Mathieu Othacehe Subject: Re: bug#39941: Disk-image size increase on core-updates. References: <87sgimdjcj.fsf@gmail.com> <87eeu0h8d6.fsf@gmail.com> <87a74nhstf.fsf@gnu.org> <87zhcnympn.fsf@gmail.com> <87r1xyfx7o.fsf@gnu.org> <87a74jnr4f.fsf@gmail.com> <87y2s3ktkn.fsf@devup.no> <875zf5lv79.fsf@gmail.com> <87tv2pilrj.fsf@gnu.org> <87pndbb4py.fsf@gmail.com> <87y2rqm3ae.fsf@gnu.org> <87ftdxoffy.fsf@gmail.com> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 6 Germinal an 228 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Wed, 25 Mar 2020 22:34:45 +0100 In-Reply-To: <87ftdxoffy.fsf@gmail.com> (Mathieu Othacehe's message of "Tue, 24 Mar 2020 18:01:05 +0100") Message-ID: <87mu84glu2.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 39941 Cc: Marius Bakke , 39941@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Mathieu Othacehe skribis: >>> +--- a/libgcc/configure >>> ++++ b/libgcc/configure >> >> I suspect this is the only file we need to patch, no? At least, we can >> remove all the m4 and m4-related Makefile.in changes and the unrelated >> =E2=80=98configure=E2=80=99 changes. > > The configure files of the other libraries are needed too because they > end-up in the same folder: Oh, of course. > mathieu@elbruz ~/guix [env]$ ls /gnu/store/ay4agvf29mpdib4v35i557cddc8cvk= ja-gcc-cross-aarch64-linux-gnu-7.5.0-lib/aarch64-linux-gnu/lib/*so > /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7= .5.0-lib/aarch64-linux-gnu/lib/libasan.so > /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7= .5.0-lib/aarch64-linux-gnu/lib/libatomic.so > /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7= .5.0-lib/aarch64-linux-gnu/lib/libgcc_s.so > /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7= .5.0-lib/aarch64-linux-gnu/lib/libgomp.so > /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7= .5.0-lib/aarch64-linux-gnu/lib/libitm.so > /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7= .5.0-lib/aarch64-linux-gnu/lib/liblsan.so > /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7= .5.0-lib/aarch64-linux-gnu/lib/libssp.so > /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7= .5.0-lib/aarch64-linux-gnu/lib/libstdc++.so > /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7= .5.0-lib/aarch64-linux-gnu/lib/libtsan.so > /gnu/store/ay4agvf29mpdib4v35i557cddc8cvkja-gcc-cross-aarch64-linux-gnu-7= .5.0-lib/aarch64-linux-gnu/lib/libubsan.so > > But the m4 file and m4-related changes are definitely useless. I removed > them and pushed! Excellent, thanks! Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Thu Jul 30 11:36:42 2020 Received: (at control) by debbugs.gnu.org; 30 Jul 2020 15:36:42 +0000 Received: from localhost ([127.0.0.1]:36589 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1k1Abp-0008Ty-Q9 for submit@debbugs.gnu.org; Thu, 30 Jul 2020 11:36:42 -0400 Received: from eggs.gnu.org ([209.51.188.92]:37122) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1k1AJs-0005pn-91 for control@debbugs.gnu.org; Thu, 30 Jul 2020 11:18:08 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:39636) by eggs.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1k1AJm-0007GL-Vr for control@debbugs.gnu.org; Thu, 30 Jul 2020 11:18:02 -0400 Received: from [2a01:cb18:832e:5f00:e0a7:8073:f3be:5cd4] (port=45576 helo=cervin) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1k1AJl-0000vM-Mc for control@debbugs.gnu.org; Thu, 30 Jul 2020 11:18:02 -0400 Date: Thu, 30 Jul 2020 17:17:49 +0200 Message-Id: <87eeot821u.fsf@cervin.i-did-not-set--mail-host-address--so-tickle-me> To: control@debbugs.gnu.org From: Mathieu Othacehe Subject: control message for bug #39941 X-Spam-Score: -1.9 (-) X-Debbugs-Envelope-To: control X-Mailman-Approved-At: Thu, 30 Jul 2020 11:36:36 -0400 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.9 (--) close 39941 quit From unknown Fri Sep 05 08:19:38 2025 Received: (at fakecontrol) by fakecontrolmessage; To: internal_control@debbugs.gnu.org From: Debbugs Internal Request Subject: Internal Control Message-Id: bug archived. Date: Fri, 28 Aug 2020 11:24:06 +0000 User-Agent: Fakemail v42.6.9 # This is a fake control message. # # The action: # bug archived. thanks # This fakemail brought to you by your local debbugs # administrator