From unknown Sun Aug 10 07:24:02 2025 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 X-Mailer: MIME-tools 5.509 (Entity 5.509) Content-Type: text/plain; charset=utf-8 From: bug#39384 <39384@debbugs.gnu.org> To: bug#39384 <39384@debbugs.gnu.org> Subject: Status: [PATCH] gnu: Add emacs-rg. Reply-To: bug#39384 <39384@debbugs.gnu.org> Date: Sun, 10 Aug 2025 14:24:02 +0000 retitle 39384 [PATCH] gnu: Add emacs-rg. reassign 39384 guix-patches submitter 39384 "LaFreniere\, Joseph" severity 39384 normal tag 39384 patch thanks From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 01 15:28:51 2020 Received: (at submit) by debbugs.gnu.org; 1 Feb 2020 20:28:51 +0000 Received: from localhost ([127.0.0.1]:39376 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ixzNq-0007lP-Qd for submit@debbugs.gnu.org; Sat, 01 Feb 2020 15:28:51 -0500 Received: from lists.gnu.org ([209.51.188.17]:58309) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ixzNp-0007lI-UE for submit@debbugs.gnu.org; Sat, 01 Feb 2020 15:28:50 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:45380) by lists.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1ixzNo-0002sl-93 for guix-patches@gnu.org; Sat, 01 Feb 2020 15:28:49 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=0.8 required=5.0 tests=BAYES_50,RCVD_IN_DNSWL_NONE, URIBL_BLOCKED autolearn=disabled version=3.3.2 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1ixzNm-0008SQ-F2 for guix-patches@gnu.org; Sat, 01 Feb 2020 15:28:47 -0500 Received: from mx.kolabnow.com ([95.128.36.41]:42446) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1ixzNm-0008Lt-2f for guix-patches@gnu.org; Sat, 01 Feb 2020 15:28:46 -0500 Received: from localhost (unknown [127.0.0.1]) by ext-mx-out002.mykolab.com (Postfix) with ESMTP id 0217D6AE for ; Sat, 1 Feb 2020 21:28:43 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=kolabnow.com; h= content-type:content-type:mime-version:message-id:date:date :subject:subject:from:from:received:received:received; s= dkim20160331; t=1580588922; x=1582403323; bh=PrLljFH6FOLETuEksE3 z+CUefuaq/9vuhVXwvYDomLI=; b=q3K7n4Cn7lQQKWSI2o4kME0xRmSRIDm02fP QHm1xeM2TJ+G5mIIDAGQkQksj2LjCUizwmKVz6EgBLxwUBIVmmOMz4f/3IMz5r2X F7Mb1XMPYAVklS9O8WeW+hiam7g7ze2ydC7Xbiqpykb8zexTTRrMQzC/rOBTvU67 U5oJKo/qW+ss0gr+KmRBf1Wyie43uWicX0j3D+r5N6hnXhWbzKkmmzVdlpoS9hFR PXin0ApqHi7vSBSLTDufUuT51ixtWvW6+qYME626g7aY/kjdW+S6SzWkDNZmqsc1 Upm4YlLcVVTqb2yjighpqHUhTSqhXxiHfQTjWSnUOjtPFYFBHvLOpuQP9fd73gmy COLbyF87LyV1xr52OPQId4Cs5keB/5/OJKMA034ZdvdR0unqWYiZ7O6Ol/E0UMH5 4k5QiFCECA+eJPVCK+3+IgirJE/jbrOSy9TQczgGb/SlpjLtzUDVzTL7kHQ8J6sg UYeVRYkjE9R118Q3rTiPWQAv+PTaaj9O5XRU7HLBva5956krnJFITOzAUnI1U8HH KP8a6sAzI7DuMnI6y6JG/sY8xTZQ+rr2nkADaB5HlAEaFM6WcoGwep0oQCYFIDy5 N3+ERfDMjAfwFJR65k+lyc4X7i36sI6nbzp8gfTCwJj4Hl627KbmTwIHTD/JCMvZ rCVHL2P0= X-Virus-Scanned: amavisd-new at mykolab.com Received: from mx.kolabnow.com ([127.0.0.1]) by localhost (ext-mx-out002.mykolab.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id BwkQGRFGlWVK for ; Sat, 1 Feb 2020 21:28:42 +0100 (CET) Received: from int-mx003.mykolab.com (unknown [10.9.13.3]) by ext-mx-out002.mykolab.com (Postfix) with ESMTPS id 614F6273 for ; Sat, 1 Feb 2020 21:28:42 +0100 (CET) Received: from ext-subm002.mykolab.com (unknown [10.9.6.2]) by int-mx003.mykolab.com (Postfix) with ESMTPS id 27249105B for ; Sat, 1 Feb 2020 21:28:42 +0100 (CET) From: "LaFreniere\, Joseph" To: guix-patches@gnu.org Subject: [PATCH] gnu: Add emacs-rg. Date: Sat, 01 Feb 2020 14:28:37 -0600 Message-ID: <87v9oqrr0q.fsf@lafreniere.xyz> MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="=-=-=" X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] [fuzzy] X-Received-From: 95.128.36.41 X-Spam-Score: 3.2 (+++) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Patch file is attached to package https://github.com/dajva/rg.el.git. -- Joseph LaFreniere From d3e76096a6c44764d51ef06aedb171682f92c85e Mon Sep 17 00:00:00 2001 From: Joseph LaFreniere Date: Sat, 1 Feb 2020 14:23:36 -0600 Subject: [PATCH] gnu: Add emacs-rg. Content analysis details: (3.2 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: kolabnow.com] 1.8 PDS_OTHER_BAD_TLD Untrustworthy TLDs [URI: lafreniere.xyz (xyz)] 0.0 SPF_HELO_NONE SPF: HELO does not publish an SPF Record 0.9 SPF_FAIL SPF: sender does not match SPF record (fail) [SPF failed: Please see http://www.openspf.org/Why?s=mfrom; id=joseph%40lafreniere.xyz; ip=209.51.188.17; r=debbugs.gnu.org] -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at https://www.dnswl.org/, low trust [209.51.188.17 listed in list.dnswl.org] 0.5 FROM_SUSPICIOUS_NTLD From abused NTLD 0.6 FROM_SUSPICIOUS_NTLD_FP From abused NTLD X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 1.5 (+) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Patch file is attached to package https://github.com/dajva/rg.el.git. -- Joseph LaFreniere From d3e76096a6c44764d51ef06aedb171682f92c85e Mon Sep 17 00:00:00 2001 From: Joseph LaFreniere Date: Sat, 1 Feb 2020 14:23:36 -0600 Subject: [PATCH] gnu: Add emacs-rg. Content analysis details: (1.5 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: readthedocs.io] -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at https://www.dnswl.org/, low trust [209.51.188.17 listed in list.dnswl.org] 1.8 PDS_OTHER_BAD_TLD Untrustworthy TLDs [URI: lafreniere.xyz (xyz)] 0.0 SPF_HELO_NONE SPF: HELO does not publish an SPF Record 0.9 SPF_FAIL SPF: sender does not match SPF record (fail) [SPF failed: Please see http://www.openspf.org/Why?s=mfrom;id=joseph%40lafreniere.xyz;ip=209.51.188.17;r=debbugs.gnu.org] -1.0 MAILING_LIST_MULTI Multiple indicators imply a widely-seen list manager 0.5 FROM_SUSPICIOUS_NTLD From abused NTLD --=-=-= Content-Type: text/plain; format=flowed Patch file is attached to package https://github.com/dajva/rg.el.git. -- Joseph LaFreniere --=-=-= Content-Type: text/x-patch; charset=utf-8 Content-Disposition: attachment; filename=0001-gnu-Add-emacs-rg.patch Content-Transfer-Encoding: quoted-printable >From d3e76096a6c44764d51ef06aedb171682f92c85e Mon Sep 17 00:00:00 2001 From: Joseph LaFreniere Date: Sat, 1 Feb 2020 14:23:36 -0600 Subject: [PATCH] gnu: Add emacs-rg. * gnu/packages/emacs-xyz.scm (emacs-rg): New variable. --- gnu/packages/emacs-xyz.scm | 29 +++++++++++++++++++++++++++++ 1 file changed, 29 insertions(+) diff --git a/gnu/packages/emacs-xyz.scm b/gnu/packages/emacs-xyz.scm index f95ad26e4b..c8b87ce712 100644 --- a/gnu/packages/emacs-xyz.scm +++ b/gnu/packages/emacs-xyz.scm @@ -2751,6 +2751,35 @@ column by drawing a thin line down the length of the= editing window.") "This Emacs package allows managing multiple grep buffers.") (license license:gpl3+))) =20 +(define-public emacs-rg + (package + (name "emacs-rg") + (version "1.8.1") + (source + (origin + (method git-fetch) + (uri (git-reference + (url "https://github.com/dajva/rg.el.git") + (commit version))) + (file-name (git-file-name name version)) + (sha256 + (base32 + "0k7x5z7mh9flwih35cqy8chs54rack3nswdcpw5wcpgv6xim227y")))) + (build-system emacs-build-system) + (propagated-inputs + `(("emacs-s" ,emacs-s) + ("emacs-wgrep" ,emacs-wgrep) + ("ripgrep" ,ripgrep))) + (home-page "https://rgel.readthedocs.io/en/latest/") + (synopsis "A search tool based on @code{ripgrep}") + (description + "An Emacs search package based on the @code{ripgrep} command line +tool. It allows you to interactively create searches, doing automatic sear= ches +based on the editing context, refining and modifying search results and mu= ch +more. It is also highly configurable to be able to fit different users=E2= =80=99 +needs.") + (license license:gpl3+))) + (define-public emacs-inf-ruby (package (name "emacs-inf-ruby") --=20 2.25.0 --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 01 17:09:32 2020 Received: (at 39384) by debbugs.gnu.org; 1 Feb 2020 22:09:32 +0000 Received: from localhost ([127.0.0.1]:39405 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iy0xI-0001wi-D0 for submit@debbugs.gnu.org; Sat, 01 Feb 2020 17:09:32 -0500 Received: from relay4-d.mail.gandi.net ([217.70.183.196]:49005) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iy0xG-0001wY-K7 for 39384@debbugs.gnu.org; Sat, 01 Feb 2020 17:09:31 -0500 X-Originating-IP: 185.131.40.67 Received: from localhost (40-67.ipv4.commingeshautdebit.fr [185.131.40.67]) (Authenticated sender: admin@nicolasgoaziou.fr) by relay4-d.mail.gandi.net (Postfix) with ESMTPSA id 89043E0007; Sat, 1 Feb 2020 22:09:28 +0000 (UTC) From: Nicolas Goaziou To: "LaFreniere\, Joseph" Subject: Re: [bug#39384] [PATCH] gnu: Add emacs-rg. References: <87v9oqrr0q.fsf@lafreniere.xyz> Date: Sat, 01 Feb 2020 23:09:19 +0100 In-Reply-To: <87v9oqrr0q.fsf@lafreniere.xyz> (Joseph LaFreniere's message of "Sat, 01 Feb 2020 14:28:37 -0600") Message-ID: <878slmc640.fsf@nicolasgoaziou.fr> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: 1.1 (+) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Hello, "LaFreniere, Joseph" writes: > Patch file is attached to package https://github.com/dajva/rg.el.git. Content analysis details: (1.1 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: readthedocs.io] -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at https://www.dnswl.org/, low trust [217.70.183.196 listed in list.dnswl.org] 0.0 RCVD_IN_MSPIKE_H3 RBL: Good reputation (+3) [217.70.183.196 listed in wl.mailspike.net] 1.8 PDS_OTHER_BAD_TLD Untrustworthy TLDs [URI: lafreniere.xyz (xyz)] 0.0 SPF_HELO_NONE SPF: HELO does not publish an SPF Record -0.0 SPF_PASS SPF: sender matches SPF record 0.0 RCVD_IN_MSPIKE_WL Mailspike good senders X-Debbugs-Envelope-To: 39384 Cc: 39384@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.1 (/) Hello, "LaFreniere, Joseph" writes: > Patch file is attached to package https://github.com/dajva/rg.el.git. Thank you! Some comments follow. > + (sha256 > + (base32 > + "0k7x5z7mh9flwih35cqy8chs54rack3nswdcpw5wcpgv6xim227y")))) Nitpick: I think the trend is to align `base32' with the string. > + (build-system emacs-build-system) > + (propagated-inputs > + `(("emacs-s" ,emacs-s) > + ("emacs-wgrep" ,emacs-wgrep) > + ("ripgrep" ,ripgrep))) > + (home-page "https://rgel.readthedocs.io/en/latest/") > + (synopsis "A search tool based on @code{ripgrep}") You may want to lint your package. In particular, the synopsis should be akin to "Search tool based ..." > + (description > + "An Emacs search package based on the @code{ripgrep} command line The description must start with a full sentence, e.g., "rg.el" is an Emacs search package... > +tool. It allows you to interactively create searches, doing automatic se= arches Texinfo requires two spaces after the full stop. > +based on the editing context, refining and modifying search results and = much > +more. It is also highly configurable to be able to fit different users= =E2=80=99 Ditto. Besides, the quote after "users" looks suspicious. You should use a regular quote. Could you send an updated patch? Regards, --=20 Nicolas Goaziou From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 02 09:22:10 2020 Received: (at 39384) by debbugs.gnu.org; 2 Feb 2020 14:22:10 +0000 Received: from localhost ([127.0.0.1]:39673 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iyG8Y-0002hB-5C for submit@debbugs.gnu.org; Sun, 02 Feb 2020 09:22:10 -0500 Received: from mx.kolabnow.com ([95.128.36.40]:57660) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iyG8V-0002ge-4R for 39384@debbugs.gnu.org; Sun, 02 Feb 2020 09:22:09 -0500 Received: from localhost (unknown [127.0.0.1]) by ext-mx-out003.mykolab.com (Postfix) with ESMTP id E45CF40410; Sun, 2 Feb 2020 15:22:00 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=kolabnow.com; h= content-type:content-type:mime-version:message-id:date:date :in-reply-to:subject:subject:from:from:references:received :received:received; s=dkim20160331; t=1580653318; x=1582467719; bh=VF8IMR0KvVvIjY8q8mV+M7O9HaUT2QZQk05ZPN8cr6g=; b=rWI/sTHk74RX OS2C/RZ8nI6Drpn9fH0/1Csm3Q+Mwd9HK9gw8QOXTiS+dSijSZif4IFBBgxOppYN Uzg02ZBPmH/L+HgKss+5gMYd3lWZ4ZxrjdED8sjjHvCKgHcZESw2ycpdcN0a//hP 5WUpWSplOv5j+Hi/MV7/sZd11rK8Akgbog38z+Tct0+tWnt9eklSULvprYtpiPqG 80tyyOV6AJSL26WVonw48Ex//SysPhCuj+egykcJf02vXJ7mOo4FRdcxJ/bLoggx EKvpIPcKqRUReFrZPE8n75KB5I1qYASZuosRKzUrgTR8fGbLTLKTnXziyK+pS0fq lohsZb6T9P5XvHKv8hPVAhiBGCWvnHtMwxyXPj3Z0vC2ByzCZAOAFB4UVdGFylmF +6nEOFrQLqUav9VbaqgQ3QtIzgx0cV1rJP5hCgrhvlM9J6VLiCL6qen0DKKXgPZw 6BZ0N8Gq82WzMzyeeZ2sNhkup8uAfODIu1Vgbm6IrXOm3edm4YrQLJXwE20j5ci/ Vaz1edM7ByHQ3650AZl4bGs9OSoDTI59rxp8EDJgL6r64BPQIH66QizLTrjArTwB n6fW5bcqwQWsRB+F+jiG+Q+/rScqSQZDr3xc72m5mZgl/FbuiHylKmXQ0JgcKW59 AO5TyP9DCDfcvQYce/L/SN4wtHG7Eqo= X-Virus-Scanned: amavisd-new at mykolab.com X-Spam-Flag: NO X-Spam-Score: -1.9 X-Spam-Level: X-Spam-Status: No, score=-1.9 tagged_above=-10 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no Received: from mx.kolabnow.com ([127.0.0.1]) by localhost (ext-mx-out003.mykolab.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id J3dmq1pGmSi3; Sun, 2 Feb 2020 15:21:58 +0100 (CET) Received: from int-mx001.mykolab.com (unknown [10.9.13.1]) by ext-mx-out003.mykolab.com (Postfix) with ESMTPS id 158C7403FC; Sun, 2 Feb 2020 15:21:57 +0100 (CET) Received: from ext-subm002.mykolab.com (unknown [10.9.6.2]) by int-mx001.mykolab.com (Postfix) with ESMTPS id C13061E0; Sun, 2 Feb 2020 15:21:57 +0100 (CET) References: <87v9oqrr0q.fsf@lafreniere.xyz> <878slmc640.fsf@nicolasgoaziou.fr> From: "LaFreniere\, Joseph" To: Nicolas Goaziou Subject: Re: [bug#39384] [PATCH] gnu: Add emacs-rg. In-reply-to: <878slmc640.fsf@nicolasgoaziou.fr> Date: Sun, 02 Feb 2020 08:21:52 -0600 Message-ID: <87pnexrrwf.fsf@lafreniere.xyz> MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="=-=-=" X-Spam-Score: 2.0 (++) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Thank you for the fast feedback! Nicolas Goaziou writes: > Nitpick: I think the trend is to align `base32' with the string. > You may want to lint your package. In particular, the synopsis > should be > akin to "Search tool based ..." Content analysis details: (2.0 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: nicolasgoaziou.fr] -0.0 RCVD_IN_DNSWL_NONE RBL: Sender listed at https://www.dnswl.org/, no trust [95.128.36.40 listed in list.dnswl.org] 1.5 PDS_OTHER_BAD_TLD Untrustworthy TLDs [URI: lafreniere.xyz (xyz)] 0.0 SPF_HELO_NONE SPF: HELO does not publish an SPF Record -0.0 SPF_PASS SPF: sender matches SPF record 0.5 FROM_SUSPICIOUS_NTLD From abused NTLD X-Debbugs-Envelope-To: 39384 Cc: 39384@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 2.0 (++) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Thank you for the fast feedback! Nicolas Goaziou writes: > Nitpick: I think the trend is to align `base32' with the string. > You may want to lint your package. In particular, the synopsis > should be > akin to "Search tool based ..." Content analysis details: (2.0 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: lafreniere.xyz] -0.0 RCVD_IN_DNSWL_NONE RBL: Sender listed at https://www.dnswl.org/, no trust [95.128.36.40 listed in list.dnswl.org] 1.5 PDS_OTHER_BAD_TLD Untrustworthy TLDs [URI: lafreniere.xyz (xyz)] 0.0 SPF_HELO_NONE SPF: HELO does not publish an SPF Record -0.0 SPF_PASS SPF: sender matches SPF record 0.5 FROM_SUSPICIOUS_NTLD From abused NTLD 1.0 BULK_RE_SUSP_NTLD Precedence bulk and RE: from a suspicious TLD -1.0 MAILING_LIST_MULTI Multiple indicators imply a widely-seen list manager --=-=-= Content-Type: text/plain; format=flowed Thank you for the fast feedback! Nicolas Goaziou writes: > Nitpick: I think the trend is to align `base32' with the string. > You may want to lint your package. In particular, the synopsis > should be > akin to "Search tool based ..." > The description must start with a full sentence, e.g., "rg.el" > is an > Emacs search package... > Texinfo requires two spaces after the full stop. > Ditto. Besides, the quote after "users" looks suspicious. You > should use > a regular quote. A patch file is attached that addresses all of the above feedback. The output of `guix lint emacs-rg` is now clean on my system; thank you for making me aware of that utility. The only part of the package I'm uncertain about is declaring ripgrep as a propagated dependency. ripgrep is not needed for this Emacs package to be able to byte-compile successfully, but `rg` does not need to be on PATH for the package to be useful at all. So while I imagine the majority of the uses-cases would want to have ripgrep installed locally, it's definitely plausible that one could only ever want to use emacs-rg via TRAMP in which case pulling in ripgrep would be completely unnecessary. Please let me know what you think. -- Joseph LaFreniere --=-=-= Content-Type: text/x-patch Content-Disposition: attachment; filename=0001-gnu-Add-emacs-rg.patch >From 9a17c333ceee4bb72dcb1ee36aaf45a7d2ce4276 Mon Sep 17 00:00:00 2001 From: Joseph LaFreniere Date: Sat, 1 Feb 2020 14:23:36 -0600 Subject: [PATCH] gnu: Add emacs-rg. * gnu/packages/emacs-xyz.scm (emacs-rg): New variable. --- gnu/packages/emacs-xyz.scm | 27 +++++++++++++++++++++++++++ 1 file changed, 27 insertions(+) diff --git a/gnu/packages/emacs-xyz.scm b/gnu/packages/emacs-xyz.scm index f95ad26e4b..29928364e0 100644 --- a/gnu/packages/emacs-xyz.scm +++ b/gnu/packages/emacs-xyz.scm @@ -134,6 +134,7 @@ #:use-module (gnu packages package-management) #:use-module (gnu packages perl) #:use-module (gnu packages pdf) + #:use-module (gnu packages rust-apps) #:use-module (gnu packages scheme) #:use-module (gnu packages speech) #:use-module (gnu packages xiph) @@ -2751,6 +2752,32 @@ column by drawing a thin line down the length of the editing window.") "This Emacs package allows managing multiple grep buffers.") (license license:gpl3+))) +(define-public emacs-rg + (package + (name "emacs-rg") + (version "1.8.1") + (source + (origin + (method git-fetch) + (uri (git-reference + (url "https://github.com/dajva/rg.el.git") + (commit version))) + (file-name (git-file-name name version)) + (sha256 + (base32 "0k7x5z7mh9flwih35cqy8chs54rack3nswdcpw5wcpgv6xim227y")))) + (build-system emacs-build-system) + (propagated-inputs + `(("emacs-s" ,emacs-s) + ("emacs-wgrep" ,emacs-wgrep) + ("ripgrep" ,ripgrep))) + (home-page "https://rgel.readthedocs.io/en/latest/") + (synopsis "Search tool based on @code{ripgrep}") + (description + "@code{rg} is an Emacs search package based on the @code{ripgrep} command +line tool. It allows one to interactively search based on the editing context +then refine or modify the search results.") + (license license:gpl3+))) + (define-public emacs-inf-ruby (package (name "emacs-inf-ruby") -- 2.25.0 --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 02 13:48:37 2020 Received: (at 39384) by debbugs.gnu.org; 2 Feb 2020 18:48:37 +0000 Received: from localhost ([127.0.0.1]:40540 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iyKIO-0005Yd-U2 for submit@debbugs.gnu.org; Sun, 02 Feb 2020 13:48:37 -0500 Received: from flashner.co.il ([178.62.234.194]:52270) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iyKIM-0005YP-My for 39384@debbugs.gnu.org; Sun, 02 Feb 2020 13:48:35 -0500 Received: from localhost (unknown [141.226.13.108]) by flashner.co.il (Postfix) with ESMTPSA id C68DF40438; Sun, 2 Feb 2020 18:48:28 +0000 (UTC) Date: Sun, 2 Feb 2020 20:47:57 +0200 From: Efraim Flashner To: "LaFreniere, Joseph" Subject: Re: [bug#39384] [PATCH] gnu: Add emacs-rg. Message-ID: <20200202184757.GH9517@E5400> References: <87v9oqrr0q.fsf@lafreniere.xyz> <878slmc640.fsf@nicolasgoaziou.fr> <87pnexrrwf.fsf@lafreniere.xyz> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="2nTeH+t2PBomgucg" Content-Disposition: inline In-Reply-To: <87pnexrrwf.fsf@lafreniere.xyz> X-PGP-Key-ID: 0x41AAE7DCCA3D8351 X-PGP-Key: https://flashner.co.il/~efraim/efraim_flashner.asc X-PGP-Fingerprint: A28B F40C 3E55 1372 662D 14F7 41AA E7DC CA3D 8351 X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 39384 Cc: 39384@debbugs.gnu.org, Nicolas Goaziou X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --2nTeH+t2PBomgucg Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Sun, Feb 02, 2020 at 08:21:52AM -0600, LaFreniere, Joseph wrote: > Thank you for the fast feedback! >=20 > Nicolas Goaziou writes: > > Nitpick: I think the trend is to align `base32' with the string. >=20 > > You may want to lint your package. In particular, the synopsis should be > > akin to "Search tool based ..." >=20 > > The description must start with a full sentence, e.g., "rg.el" is an > > Emacs search package... >=20 > > Texinfo requires two spaces after the full stop. >=20 > > Ditto. Besides, the quote after "users" looks suspicious. You should use > > a regular quote. >=20 > A patch file is attached that addresses all of the above feedback. The > output of `guix lint emacs-rg` is now clean on my system; thank you for > making me aware of that utility. >=20 > The only part of the package I'm uncertain about is declaring ripgrep as a > propagated dependency. ripgrep is not needed for this Emacs package to be > able to byte-compile successfully, but `rg` does not need to be on PATH f= or > the package to be useful at all. So while I imagine the majority of the > uses-cases would want to have ripgrep installed locally, it's definitely > plausible that one could only ever want to use emacs-rg via TRAMP in which > case pulling in ripgrep would be completely unnecessary. >=20 > Please let me know what you think. Is it possible to patch the invocations of `rg` to refer to ripgrep directly? --=20 Efraim Flashner =D7=90=D7=A4=D7=A8=D7=99=D7=9D = =D7=A4=D7=9C=D7=A9=D7=A0=D7=A8 GPG key =3D A28B F40C 3E55 1372 662D 14F7 41AA E7DC CA3D 8351 Confidentiality cannot be guaranteed on emails sent or received unencrypted --2nTeH+t2PBomgucg Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEoov0DD5VE3JmLRT3Qarn3Mo9g1EFAl43GV0ACgkQQarn3Mo9 g1GUIQ/9EJOzbMqPqV51d9C2DV88GCxzBAeh2iH23f/QMWHdPvJAM24MUdWujbMQ xdRuPFh1+X31Iofs49Albc+979JXBfEhcsBxPkd0vDBxN6W620gZJJRcGxtnLkF4 ADMZkw9IjaWVBWHXYBVJrrFS7FGkT9BH7+5+LC3gzbJwji/R7aQEEenGdaC1VIsK GbyxoeQ3/gy2uf8/xYMWkr+jlhOET23DpSUmgKGbql/c0f1NDkKMRPqQ9H8iYsJU VMf2xi2yDg8CJfYe5aHZk9sanUBJDRfXDU6teB0x56k6Ix00cSJFUMVQodmaqbla LHtJPLzDfHlS+TQBctAmfOC45gsLz72+bP8EhNoHS753e+eCbasGZ3wPSArHIhHu Xg3v6px/4FuL+mo/A9LDzqJHkw/lrMUdj/y8Ed7A33YoqB/xacFFQlnAbdgLnA/r TPLcOmJGkJHMtcLIncQxzC3yVtsvUhpdZxUBipvq31aaFFKMGptetbN/1wlAfNlO wDfh62adJJA2TvbEiHpcLKhbr0RkpqC4dvxYGqHF2l6f57zpy3AGCTI9jmWyK8pn ufIaKODMRvtXjSyXb8G47apxlqmP0XE/slIEG/AwXHhJqU8J+PnaWnxGZOt1C1pn NnBxhXdnbXXXpxDCRXZlJcawpqbpXwOhBZ4jJzfW1cmdWjrPZGY= =rFw6 -----END PGP SIGNATURE----- --2nTeH+t2PBomgucg-- From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 02 22:41:56 2020 Received: (at 39384) by debbugs.gnu.org; 3 Feb 2020 03:41:56 +0000 Received: from localhost ([127.0.0.1]:40788 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iyScW-0005b9-Eg for submit@debbugs.gnu.org; Sun, 02 Feb 2020 22:41:56 -0500 Received: from mx.kolabnow.com ([95.128.36.40]:5496) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iyScU-0005aq-B9 for 39384@debbugs.gnu.org; Sun, 02 Feb 2020 22:41:55 -0500 Received: from localhost (unknown [127.0.0.1]) by ext-mx-out003.mykolab.com (Postfix) with ESMTP id CE97C40413; Mon, 3 Feb 2020 04:41:47 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=kolabnow.com; h= content-type:content-type:mime-version:message-id:date:date :in-reply-to:subject:subject:from:from:references:received :received:received; s=dkim20160331; t=1580701306; x=1582515707; bh=qVxLVkQPniKsvclzy9i0HXUKi2mx1uy/X6IcPh1kX90=; b=0J7iQy7soQRz 7i+tn8Xgps7kx5nETIDRC5/6k5SWI6S5JNm9qcBsGvvpJ75YpmWppAbpabZseRiy NUIzoNY9jvbqgGiQZJRFwqD9raSe7tXh0lSS2/Xa9dSAWRqNFE9/OAVgpeVcFLeJ vi0c+Vcv1hleJPvKNcVC9u0hA3gV5G3AFNLjgb/mdiGFFJOJrG7dhtrWNSeicqAh hG8wSzjvPKD0gC/6UIYdlWHqL9DDEznc1YlaeOr1hdduUdMCsMDMqpvE+eAZmKkP X73fhr2PiqE6mQWZ+/xucQhtqyrd/+mJj+YNw10KCdyXrB8NiHAqYB/HKRcitW/b pnVaZNX/LilGbQDMNrpC8y7kRGe1PPj9iOMp6BoZpM3WFUCbRe9uN+UNvTHioizW 4OTl3/z27nYdgHtcvRLE+WBf5sBQZnkXm18GTvySr3GUGc526dsVo+Z/QeiwBdJC N4a2XSJIFSbtVaQtfIbxN4e1vnytVXluNMmJC3YGLBcgKYDhgFeHSqEecJGzhj9S XJr+wFo6EQCFa+owGJAWAIYOhL/4JBxkMwi2xikQqUB0oNwMq2ctKun2Tl7HQrtQ matCkWafnUbFdN6HPdHSEcFUrR4hXf2do6YaWfXiUXZl5JJIBdO5+BhFR3Fa0rnQ V/9FkarecdM0lw13BTTVci19uGIrdzY= X-Virus-Scanned: amavisd-new at mykolab.com X-Spam-Flag: NO X-Spam-Score: -1.9 X-Spam-Level: X-Spam-Status: No, score=-1.9 tagged_above=-10 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no Received: from mx.kolabnow.com ([127.0.0.1]) by localhost (ext-mx-out003.mykolab.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id tQLE_NPtI8KO; Mon, 3 Feb 2020 04:41:46 +0100 (CET) Received: from int-mx003.mykolab.com (unknown [10.9.13.3]) by ext-mx-out003.mykolab.com (Postfix) with ESMTPS id 91889403F5; Mon, 3 Feb 2020 04:41:46 +0100 (CET) Received: from ext-subm002.mykolab.com (unknown [10.9.6.2]) by int-mx003.mykolab.com (Postfix) with ESMTPS id 2A0F7ABD; Mon, 3 Feb 2020 04:41:46 +0100 (CET) References: <87v9oqrr0q.fsf@lafreniere.xyz> <878slmc640.fsf@nicolasgoaziou.fr> <87pnexrrwf.fsf@lafreniere.xyz> <20200202184757.GH9517@E5400> From: "LaFreniere\, Joseph" To: Efraim Flashner Subject: Re: [bug#39384] [PATCH] gnu: Add emacs-rg. In-reply-to: <20200202184757.GH9517@E5400> Date: Sun, 02 Feb 2020 21:41:41 -0600 Message-ID: <87o8ugs5fu.fsf@lafreniere.xyz> MIME-Version: 1.0 Content-Type: text/plain; format=flowed X-Spam-Score: 0.5 (/) X-Debbugs-Envelope-To: 39384 Cc: 39384@debbugs.gnu.org, Nicolas Goaziou X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.5 (/) Efraim Flashner writes: > Is it possible to patch the invocations of `rg` to refer to > ripgrep directly? Thank you for the input, but I don't understand what you mean by "referring to ripgrep directly". Can you elaborate on that proposal and how it would help resolve the question of whether to include ripgrep as a propagated input? -- Joseph LaFreniere From debbugs-submit-bounces@debbugs.gnu.org Tue Feb 04 04:59:31 2020 Received: (at 39384) by debbugs.gnu.org; 4 Feb 2020 09:59:31 +0000 Received: from localhost ([127.0.0.1]:42618 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iyuzT-0000Pj-Jd for submit@debbugs.gnu.org; Tue, 04 Feb 2020 04:59:31 -0500 Received: from flashner.co.il ([178.62.234.194]:43276) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iyuzR-0000PS-4J for 39384@debbugs.gnu.org; Tue, 04 Feb 2020 04:59:29 -0500 Received: from localhost (unknown [141.226.13.108]) by flashner.co.il (Postfix) with ESMTPSA id DC2B54002B; Tue, 4 Feb 2020 09:59:22 +0000 (UTC) Date: Tue, 4 Feb 2020 11:58:51 +0200 From: Efraim Flashner To: "LaFreniere, Joseph" Subject: Re: [bug#39384] [PATCH] gnu: Add emacs-rg. Message-ID: <20200204095851.GA19864@E5400> References: <87v9oqrr0q.fsf@lafreniere.xyz> <878slmc640.fsf@nicolasgoaziou.fr> <87pnexrrwf.fsf@lafreniere.xyz> <20200202184757.GH9517@E5400> <87o8ugs5fu.fsf@lafreniere.xyz> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="IJpNTDwzlM2Ie8A6" Content-Disposition: inline In-Reply-To: <87o8ugs5fu.fsf@lafreniere.xyz> X-PGP-Key-ID: 0x41AAE7DCCA3D8351 X-PGP-Key: https://flashner.co.il/~efraim/efraim_flashner.asc X-PGP-Fingerprint: A28B F40C 3E55 1372 662D 14F7 41AA E7DC CA3D 8351 X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 39384 Cc: 39384@debbugs.gnu.org, Nicolas Goaziou X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --IJpNTDwzlM2Ie8A6 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Sun, Feb 02, 2020 at 09:41:41PM -0600, LaFreniere, Joseph wrote: >=20 > Efraim Flashner writes: > > Is it possible to patch the invocations of `rg` to refer to ripgrep > > directly? >=20 > Thank you for the input, but I don't understand what you mean by "referri= ng > to ripgrep directly". Can you elaborate on that proposal and how it would > help resolve the question of whether to include ripgrep as a propagated > input? We want to have ripgrep as a regular input, so at the point in the code where it searches through PATH for the rg binary we patch it to refer to the specific binary. One example of this is in (gnu packages emacs-xyz), with emacs-nov-el. --=20 Efraim Flashner =D7=90=D7=A4=D7=A8=D7=99=D7=9D = =D7=A4=D7=9C=D7=A9=D7=A0=D7=A8 GPG key =3D A28B F40C 3E55 1372 662D 14F7 41AA E7DC CA3D 8351 Confidentiality cannot be guaranteed on emails sent or received unencrypted --IJpNTDwzlM2Ie8A6 Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEoov0DD5VE3JmLRT3Qarn3Mo9g1EFAl45QFgACgkQQarn3Mo9 g1Hpvg//TcS2ZHFR5xHLa3ZhrzMG7T+fLCyUDdVJ7PYF+uQXoAMYMywjNHz4jXqy ILVDTAZ41toGSgE6YcxL9nyfXUdCsGEVAyJutjKpZZ3p1XHtUTX7phA+z7+kNzFJ nxMvqlxG3xvLNhSJ1LUKR8YoXTlZpHIlyc4M9dTIMqthJ2OEHsmiy75uxmiqGQxP pRp9QUl2V7mg1laXKr1dQaS6IWz2aZpCg/2eT8DPhXPWGIkKg+rcuEpLZiBqjD/x DqvK1e3upD2oRo5dR83mTi8mpZi9Pl1j1as8xJgSPbFY1RlTUrP5JNGHGUZ1YR3T 38m+9NHVVbI8sc3JESrGsTPoCfNeU1RKyvjoIz2Du0EmFa8mlTbpt/XobdoK4OZW SxHWu7KCcKSxlO8I00SnEvDlEB3ADPhUoKcMUte+LM8QGSLRW4q4G+UNm+sIgKaQ Q0m5zMZeCrTaM2Bk8H8VvocQXbmlYjPsIUujWNa3ryb0aqpS05/I8OcDDgKi+Jgc q/0rzqxIJkpd5TxDsRiK3+1pZXCCPPH7J7mXyKfnw7nY4qwRfOZ4mUEOsXmNq8Pk Q1r5pYcxr5/oZCrWuQKR755TwCM6zmEFwDL2CW5TekoSx1Fm8Ygk1ZPKqFm9Kbuz tm2/ySUsIavvFk6B0xY+NSC/1KgwMnl7d3BNZc+DMEk61l2MxKY= =P4dZ -----END PGP SIGNATURE----- --IJpNTDwzlM2Ie8A6-- From debbugs-submit-bounces@debbugs.gnu.org Tue Feb 04 22:08:29 2020 Received: (at 39384) by debbugs.gnu.org; 5 Feb 2020 03:08:29 +0000 Received: from localhost ([127.0.0.1]:45027 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1izB3F-0004GA-1T for submit@debbugs.gnu.org; Tue, 04 Feb 2020 22:08:29 -0500 Received: from mx.kolabnow.com ([95.128.36.41]:5160) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1izB3C-0004Fu-7U for 39384@debbugs.gnu.org; Tue, 04 Feb 2020 22:08:27 -0500 Received: from localhost (unknown [127.0.0.1]) by ext-mx-out001.mykolab.com (Postfix) with ESMTP id 09553B74; Wed, 5 Feb 2020 04:08:20 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=kolabnow.com; h= content-type:content-type:mime-version:message-id:date:date :in-reply-to:subject:subject:from:from:references:received :received:received; s=dkim20160331; t=1580872098; x=1582686499; bh=xNZp1zCN2rfXm7sHTSk//b9u+D15zHsMqhc4/br1vkY=; b=g6v7E7lTxU93 WOPbJEvyBPyK3N8TsnM6WknG3ZBvCQrKSgR21taMDXhlxAxC0/BIiG53j68tBbTz 6QOIg1Pxw3aenHaDTPlBjtpKbKQoZN51rfpd6cOmbiN8p0rVQAqHIUhgybGPl+E9 iTrem3SGWb9drAyrypZ+I7zCBpRezmjfKTZLRafJCxOMEzHe4mBUmspKfhI48QhU YD2dAs4+hlDsq4u+mtjrbv0voZTJ+j3xhwcv7Q/q9BfPe8heAnsgz5RyVRBt0dc7 d2SCYRJZuHUGPZZBT27Z8sEMzGEdiZDWHTxx6EVVfNUFlYW9USZSppjG+ixAAt+J FgsCInvbMP90cEGRV8lRMDkVqAIs7K3stfvH8qgF2jXEBaf7NpQd4Ov8/9oZcn3u 4jy2mbVIsJqN2lJo9GZ6QLNmor1IJ1xnHMEIKMAoS2O3k3aFUZBXEXynCULEIa+a Uw7H/dg1rsbDfAiBO04z4ts9MJXQUPwSQhEV5pZP72m7j2o+XOdp7ViRB0cZp87n EjZbAmzmGFWFF9TMMYpJTVChWJINR0gY+ShRIj20b7qZpXo+9jJQSVOTRAvVanrQ 2LGPvk0wMWFwbZpdrhSD10XuG9yuKtuYwXbBXX3oO41qrKkxvbOaOVpkP6odcJap z5GyQX9BJkZiJxlTqqZz2+f6A+TvTjY= X-Virus-Scanned: amavisd-new at mykolab.com X-Spam-Flag: NO X-Spam-Score: -1.9 X-Spam-Level: X-Spam-Status: No, score=-1.9 tagged_above=-10 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no Received: from mx.kolabnow.com ([127.0.0.1]) by localhost (ext-mx-out001.mykolab.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id xHaOhIZoxGMa; Wed, 5 Feb 2020 04:08:18 +0100 (CET) Received: from int-mx002.mykolab.com (unknown [10.9.13.2]) by ext-mx-out001.mykolab.com (Postfix) with ESMTPS id 0D259AB0; Wed, 5 Feb 2020 04:08:17 +0100 (CET) Received: from ext-subm001.mykolab.com (unknown [10.9.6.1]) by int-mx002.mykolab.com (Postfix) with ESMTPS id B87A910BE; Wed, 5 Feb 2020 04:08:17 +0100 (CET) References: <87v9oqrr0q.fsf@lafreniere.xyz> <878slmc640.fsf@nicolasgoaziou.fr> <87pnexrrwf.fsf@lafreniere.xyz> <20200202184757.GH9517@E5400> <87o8ugs5fu.fsf@lafreniere.xyz> <20200204095851.GA19864@E5400> From: "LaFreniere\, Joseph" To: Efraim Flashner Subject: Re: [bug#39384] [PATCH] gnu: Add emacs-rg. In-reply-to: <20200204095851.GA19864@E5400> Date: Tue, 04 Feb 2020 21:08:11 -0600 Message-ID: <87mu9xspd0.fsf@lafreniere.xyz> MIME-Version: 1.0 Content-Type: text/plain; format=flowed X-Spam-Score: 0.5 (/) X-Debbugs-Envelope-To: 39384 Cc: 39384@debbugs.gnu.org, Nicolas Goaziou X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.5 (/) Efraim Flashner writes: > We want to have ripgrep as a regular input, so at the point in > the code > where it searches through PATH for the rg binary we patch it to > refer to > the specific binary. One example of this is in (gnu packages > emacs-xyz), > with emacs-nov-el. Ah, I see what you mean now. But wouldn't hard-coding the path to ripgrep in that way prevent the package from being able to use remote systems' ripgrep binaries when running over TRAMP? -- Joseph LaFreniere From debbugs-submit-bounces@debbugs.gnu.org Wed Feb 05 02:13:41 2020 Received: (at 39384) by debbugs.gnu.org; 5 Feb 2020 07:13:41 +0000 Received: from localhost ([127.0.0.1]:45059 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1izEsX-0002Lu-7H for submit@debbugs.gnu.org; Wed, 05 Feb 2020 02:13:41 -0500 Received: from flashner.co.il ([178.62.234.194]:55788) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1izEsT-0002La-M5 for 39384@debbugs.gnu.org; Wed, 05 Feb 2020 02:13:39 -0500 Received: from [127.0.0.1] (unknown [37.26.146.230]) by flashner.co.il (Postfix) with ESMTPSA id 9BECC402AA; Wed, 5 Feb 2020 07:13:30 +0000 (UTC) Date: Wed, 05 Feb 2020 07:13:02 +0000 From: Efraim Flashner To: "LaFreniere, Joseph" Subject: Re: [bug#39384] [PATCH] gnu: Add emacs-rg. User-Agent: K-9 Mail for Android In-Reply-To: <87mu9xspd0.fsf@lafreniere.xyz> References: <87v9oqrr0q.fsf@lafreniere.xyz> <878slmc640.fsf@nicolasgoaziou.fr> <87pnexrrwf.fsf@lafreniere.xyz> <20200202184757.GH9517@E5400> <87o8ugs5fu.fsf@lafreniere.xyz> <20200204095851.GA19864@E5400> <87mu9xspd0.fsf@lafreniere.xyz> Message-ID: MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: 1.5 (+) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: On February 5, 2020 3:08:11 AM UTC, "LaFreniere, Joseph" wrote: > >Efraim Flashner writes: >> We want to have ripgrep as a regular input, so at the poin [...] Content analysis details: (1.5 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.0 SPF_HELO_PASS SPF: HELO matches SPF record -0.0 SPF_PASS SPF: sender matches SPF record 1.5 PDS_OTHER_BAD_TLD Untrustworthy TLDs [URI: lafreniere.xyz (xyz)] 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: flashner.co.il] X-Debbugs-Envelope-To: 39384 Cc: 39384@debbugs.gnu.org, Nicolas Goaziou X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.5 (/) On February 5, 2020 3:08:11 AM UTC, "LaFreniere, Joseph" wrote: > >Efraim Flashner writes: >> We want to have ripgrep as a regular input, so at the point in=20 >> the code >> where it searches through PATH for the rg binary we patch it to=20 >> refer to >> the specific binary=2E One example of this is in (gnu packages=20 >> emacs-xyz), >> with emacs-nov-el=2E > >Ah, I see what you mean now=2E But wouldn't hard-coding the path to=20 >ripgrep in that way prevent the package from being able to use=20 >remote systems' ripgrep binaries when running over TRAMP? > Unfortunately that's not something I know=2E I remember that for the tramp= package itself there were some changes related to PATH to make it work whe= n connecting between a Guix System and a foreign one=2E Hopefully someone k= nows the answer=2E --=20 Sent from my Android device with K-9 Mail=2E Please excuse my brevity=2E From debbugs-submit-bounces@debbugs.gnu.org Wed Feb 05 16:33:36 2020 Received: (at 39384) by debbugs.gnu.org; 5 Feb 2020 21:33:36 +0000 Received: from localhost ([127.0.0.1]:46885 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1izSIi-0000VG-CR for submit@debbugs.gnu.org; Wed, 05 Feb 2020 16:33:36 -0500 Received: from wout4-smtp.messagingengine.com ([64.147.123.20]:57737) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1izSIh-0000V3-Do for 39384@debbugs.gnu.org; Wed, 05 Feb 2020 16:33:35 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.west.internal (Postfix) with ESMTP id 8F922798; Wed, 5 Feb 2020 16:33:29 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Wed, 05 Feb 2020 16:33:29 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=ouV6LB8IIPvms6/ZED3GTfiEbo QN0JT5PUdxBdlDcFE=; b=Hnl26uaVTnOpo3ma73auqyUFfxiZGkYjdwad7QiaJJ zHyrSsLkhmgofwLTKRf1WSZ1z9DrSSlTiu6F5X2RcZvvp9bbVkiqRhiwZZP54X5j +CbfaLjfbK+br1tNu75lZ7ESqlAOvjHFhLQvB49jVgFq8Ty2p68KlEZTQPyMIP3U Yqmcq0BJpc2fi4HewpHfk15PzS3gSL+mMMLg8VJSgxpq4SO0T6toRtug51sy9YWi H6W5vWaCT+R0b7HtXh+snwVDX+3VnaJARPni5QzaH5K0fpbLTLmv47nLK+s0KQkQ Drpd3y0meFxI6YkZvJ+E2ad2d00c2EorHMB25YW3J+zg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=ouV6LB 8IIPvms6/ZED3GTfiEboQN0JT5PUdxBdlDcFE=; b=u1Ap/maD776OzXxjUMFI/b Y8gUcXuTD6vvsyVA5OoSJKI8hBFyeF5qS+eJhdINXGPzmoLQT0d9E959kIjIP+MA lSjwaF7v3QLGu5zUMu/2s79IVUHT+gaxLb0GxCEIrHhcpHFJIbqxswpcJh70p7nq XNaBf2N9xzYHxhgxDzCAIaBtV4alO2ikAVY/9KxRmyH6vrUTKp73NkCKfvJosTNx 7tsr+fKuHJtnGXIM5jZN/aCt9GhJ6S6DhzdnpySKx2GlLmvBV1FCgz3tnh0tbkeX GVk/y17MbLR60E9DsnGMb3FDiCcOeMWhl1dL3KoQHqdWC/KD4f1cph7K8tRzBkBg == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedugedrhedugddugeehucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmne gfrhhlucfvnfffucdludejmdenucfjughrpefhvffujghffgffkfggtgesghdtreertder tdenucfhrhhomhepofgrrhhiuhhsuceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrg hilhdrtghomheqnecukfhppeekgedrvddtvddrieelrddvheefnecuvehluhhsthgvrhfu ihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrg hilhdrtghomh X-ME-Proxy: Received: from localhost (ti0006q161-3035.bb.online.no [84.202.69.253]) by mail.messagingengine.com (Postfix) with ESMTPA id 689223280060; Wed, 5 Feb 2020 16:33:28 -0500 (EST) From: Marius Bakke To: "LaFreniere\, Joseph" , Efraim Flashner Subject: Re: [bug#39384] [PATCH] gnu: Add emacs-rg. In-Reply-To: <87mu9xspd0.fsf@lafreniere.xyz> References: <87v9oqrr0q.fsf@lafreniere.xyz> <878slmc640.fsf@nicolasgoaziou.fr> <87pnexrrwf.fsf@lafreniere.xyz> <20200202184757.GH9517@E5400> <87o8ugs5fu.fsf@lafreniere.xyz> <20200204095851.GA19864@E5400> <87mu9xspd0.fsf@lafreniere.xyz> User-Agent: Notmuch/0.29.3 (https://notmuchmail.org) Emacs/26.3 (x86_64-pc-linux-gnu) Date: Wed, 05 Feb 2020 22:33:26 +0100 Message-ID: <87lfpg4t3t.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: 0.9 (/) X-Debbugs-Envelope-To: 39384 Cc: 39384@debbugs.gnu.org, Nicolas Goaziou X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.1 (/) --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable "LaFreniere\, Joseph" writes: > Efraim Flashner writes: >> We want to have ripgrep as a regular input, so at the point in=20 >> the code >> where it searches through PATH for the rg binary we patch it to=20 >> refer to >> the specific binary. One example of this is in (gnu packages=20 >> emacs-xyz), >> with emacs-nov-el. > > Ah, I see what you mean now. But wouldn't hard-coding the path to=20 > ripgrep in that way prevent the package from being able to use=20 > remote systems' ripgrep binaries when running over TRAMP? Perhaps we could patch it to do both? Use the store prefix if it exists, and fall back to searching in PATH? --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl47NKcACgkQoqBt8qM6 VPrJmgf/cDeRvpBwGA2GkAreu4xBplIl8OfUJrfuKgJyh6fpK7rC7Za3bP9oR+Lm QHcYeWbBq91ibqVSFLeHt/81GfkCfpCN/A02HVMM405zKCyhM0Y2BgMNVkAfnbKu 5tpLVh4WcQ13BxZ3FJdS3E1B5n3HP9zrBpkTSJxzeKcSAV2+nOKyHlmlB95Pjm5I xKSuNEqGhJtCtgMUWGGvY63pyP9BgcM93lNUjVwp3sG+JeaouN9GBJIHOmyq2xc3 HLq0gNvYnw7aHec8PKTgDypHDDK1GC/4qI+zpcI6Q6mFVAZ/4lCHhUCm9GqT6A30 pLzQpcyKa86bg5wlhYmIZUSDe1XNSg== =9YYu -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Thu Feb 06 19:47:39 2020 Received: (at 39384) by debbugs.gnu.org; 7 Feb 2020 00:47:39 +0000 Received: from localhost ([127.0.0.1]:48770 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1izro3-0005C0-BU for submit@debbugs.gnu.org; Thu, 06 Feb 2020 19:47:39 -0500 Received: from mx.kolabnow.com ([95.128.36.40]:53340) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1izro1-00056U-D9 for 39384@debbugs.gnu.org; Thu, 06 Feb 2020 19:47:37 -0500 Received: from localhost (unknown [127.0.0.1]) by ext-mx-out003.mykolab.com (Postfix) with ESMTP id C28EB40E99; Fri, 7 Feb 2020 01:47:30 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=kolabnow.com; h= content-type:content-type:mime-version:message-id:date:date :in-reply-to:subject:subject:from:from:references:received :received:received; s=dkim20160331; t=1581036450; x=1582850851; bh=jJiXowmuhXC46FDRWImd4ERkztiEzFZoYx7m48ar5bE=; b=cgO/vxFmdHLJ Oh7j+9i8j6Ymztwmb+zeqkPY34DgTpvM6GsznN93ShQKJTMmxJghFuQKa/mOIPlL ii5hb7dJBO8EDP+P6OZn8Sfk4tSrVJkmCfjMyzAlLUUmGP4JemJuezZtZvRN8ZcT 0ofBgSDCgpI7F+OQZEkyXWY2DBURs/wvrunhblM82jMwHwjZkBEvLxNFDd61n0vr HhXdDYhSOnQZK+PI75pM7kgjNDUVKdTNYL81Br8LydAHd+Yj45Bs9epsb9+neRbH aXQPh1lgo4t9M681woXR/cwFgoyyoOcUpOAO8vIeg8/nBS6wstrxRjio9cCRJ3dr yYrYkifk6zLqPSUVVb50eXsHVqyckhrWOwzOBzVJNMFeZa7kgYiB4oChmj6b9llH 3llKCpxd22m9UXenWDz+D8k08o/wSMeqTcvVmgr2k/DlMPnxeayjRJKyHlgECZXD hcdNfAEdwqMPRqbj4/r5ps8QUx2hMj6jCoDzkORXJi24zrlJ2GikUomIHotqv96a 3wpjiOxb6q/db0ClSugjA5dKPbkXfTuDgK4bg6XbTFUFjBctlvdai2JdZgq64FDG LE6Foa00+E+VAPzc1Qg5b46k+Dwe3YEGWvKaYPYUXyYKcu9ZbDJWmS3U4nk9XQhv pd5G2jKLxeWb7UoJutnDqSoIdA7DTlA= X-Virus-Scanned: amavisd-new at mykolab.com X-Spam-Flag: NO X-Spam-Score: -1.9 X-Spam-Level: X-Spam-Status: No, score=-1.9 tagged_above=-10 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no Received: from mx.kolabnow.com ([127.0.0.1]) by localhost (ext-mx-out003.mykolab.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id QxbOwODjayVa; Fri, 7 Feb 2020 01:47:30 +0100 (CET) Received: from int-mx003.mykolab.com (unknown [10.9.13.3]) by ext-mx-out003.mykolab.com (Postfix) with ESMTPS id 4E40740AB6; Fri, 7 Feb 2020 01:47:30 +0100 (CET) Received: from ext-subm001.mykolab.com (unknown [10.9.6.1]) by int-mx003.mykolab.com (Postfix) with ESMTPS id E747018EC; Fri, 7 Feb 2020 01:47:29 +0100 (CET) References: <87v9oqrr0q.fsf@lafreniere.xyz> <878slmc640.fsf@nicolasgoaziou.fr> <87pnexrrwf.fsf@lafreniere.xyz> <20200202184757.GH9517@E5400> <87o8ugs5fu.fsf@lafreniere.xyz> <20200204095851.GA19864@E5400> <87mu9xspd0.fsf@lafreniere.xyz> <87lfpg4t3t.fsf@devup.no> From: "LaFreniere\, Joseph" To: Marius Bakke Subject: Re: [bug#39384] [PATCH] gnu: Add emacs-rg. In-reply-to: <87lfpg4t3t.fsf@devup.no> Date: Thu, 06 Feb 2020 18:47:23 -0600 Message-ID: <87lfpfrzok.fsf@lafreniere.xyz> MIME-Version: 1.0 Content-Type: text/plain; format=flowed X-Spam-Score: 2.1 (++) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Marius Bakke writes: > "LaFreniere\, Joseph" writes: >> Ah, I see what you mean now. But wouldn't hard-coding the path >> to >> ripgrep in that way preven [...] Content analysis details: (2.1 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.0 SPF_PASS SPF: sender matches SPF record 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: fastmail.com] -0.0 RCVD_IN_DNSWL_NONE RBL: Sender listed at https://www.dnswl.org/, no trust [95.128.36.40 listed in list.dnswl.org] 1.6 PDS_OTHER_BAD_TLD Untrustworthy TLDs [URI: lafreniere.xyz (xyz)] 0.0 SPF_HELO_NONE SPF: HELO does not publish an SPF Record 0.5 FROM_SUSPICIOUS_NTLD From abused NTLD X-Debbugs-Envelope-To: 39384 Cc: 39384@debbugs.gnu.org, Efraim Flashner , Nicolas Goaziou X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 2.1 (++) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Marius Bakke writes: > "LaFreniere\, Joseph" writes: >> Ah, I see what you mean now. But wouldn't hard-coding the path >> to >> ripgrep in that way preven [...] Content analysis details: (2.1 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: lafreniere.xyz] -0.0 RCVD_IN_DNSWL_NONE RBL: Sender listed at https://www.dnswl.org/, no trust [95.128.36.40 listed in list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 1.6 PDS_OTHER_BAD_TLD Untrustworthy TLDs [URI: lafreniere.xyz (xyz)] 0.0 SPF_HELO_NONE SPF: HELO does not publish an SPF Record 0.5 FROM_SUSPICIOUS_NTLD From abused NTLD 1.0 BULK_RE_SUSP_NTLD Precedence bulk and RE: from a suspicious TLD -1.0 MAILING_LIST_MULTI Multiple indicators imply a widely-seen list manager Marius Bakke writes: > "LaFreniere\, Joseph" writes: >> Ah, I see what you mean now. But wouldn't hard-coding the path >> to >> ripgrep in that way prevent the package from being able to use >> remote systems' ripgrep binaries when running over TRAMP? > > Perhaps we could patch [emacs-rg] to do both? Use the store > prefix if it > exists, and fall back to searching in PATH? What would be the advantage of that over just searching PATH to start with? -- Joseph LaFreniere From debbugs-submit-bounces@debbugs.gnu.org Fri Feb 07 05:55:14 2020 Received: (at 39384) by debbugs.gnu.org; 7 Feb 2020 10:55:14 +0000 Received: from localhost ([127.0.0.1]:48918 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1j01I2-0004Ex-KC for submit@debbugs.gnu.org; Fri, 07 Feb 2020 05:55:14 -0500 Received: from flashner.co.il ([178.62.234.194]:51284) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1j01I0-0004ET-5G for 39384@debbugs.gnu.org; Fri, 07 Feb 2020 05:55:12 -0500 Received: from localhost (unknown [141.226.13.108]) by flashner.co.il (Postfix) with ESMTPSA id 32117402AA; Fri, 7 Feb 2020 10:55:06 +0000 (UTC) Date: Fri, 7 Feb 2020 12:54:35 +0200 From: Efraim Flashner To: "LaFreniere, Joseph" Subject: Re: [bug#39384] [PATCH] gnu: Add emacs-rg. Message-ID: <20200207105435.GG7827@E5400> References: <87v9oqrr0q.fsf@lafreniere.xyz> <878slmc640.fsf@nicolasgoaziou.fr> <87pnexrrwf.fsf@lafreniere.xyz> <20200202184757.GH9517@E5400> <87o8ugs5fu.fsf@lafreniere.xyz> <20200204095851.GA19864@E5400> <87mu9xspd0.fsf@lafreniere.xyz> <87lfpg4t3t.fsf@devup.no> <87lfpfrzok.fsf@lafreniere.xyz> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="aYDVKSzuImP48n7V" Content-Disposition: inline In-Reply-To: <87lfpfrzok.fsf@lafreniere.xyz> X-PGP-Key-ID: 0x41AAE7DCCA3D8351 X-PGP-Key: https://flashner.co.il/~efraim/efraim_flashner.asc X-PGP-Fingerprint: A28B F40C 3E55 1372 662D 14F7 41AA E7DC CA3D 8351 X-Spam-Score: 1.6 (+) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: On Thu, Feb 06, 2020 at 06:47:23PM -0600, LaFreniere, Joseph wrote: > > Marius Bakke writes: > > "LaFreniere\, Joseph" writes: > > > Ah, I see what you me [...] Content analysis details: (1.6 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: fastmail.com] -0.0 SPF_PASS SPF: sender matches SPF record 1.6 PDS_OTHER_BAD_TLD Untrustworthy TLDs [URI: lafreniere.xyz (xyz)] -0.0 SPF_HELO_PASS SPF: HELO matches SPF record X-Debbugs-Envelope-To: 39384 Cc: 39384@debbugs.gnu.org, Marius Bakke , Nicolas Goaziou X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.6 (/) --aYDVKSzuImP48n7V Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Thu, Feb 06, 2020 at 06:47:23PM -0600, LaFreniere, Joseph wrote: >=20 > Marius Bakke writes: > > "LaFreniere\, Joseph" writes: > > > Ah, I see what you mean now. But wouldn't hard-coding the path to > > > ripgrep in that way prevent the package from being able to use > > > remote systems' ripgrep binaries when running over TRAMP? > >=20 > > Perhaps we could patch [emacs-rg] to do both? Use the store prefix if > > it > > exists, and fall back to searching in PATH? >=20 > What would be the advantage of that over just searching PATH to start wit= h? It will still work even if you don't have ripgrep specifically installed. --=20 Efraim Flashner =D7=90=D7=A4=D7=A8=D7=99=D7=9D = =D7=A4=D7=9C=D7=A9=D7=A0=D7=A8 GPG key =3D A28B F40C 3E55 1372 662D 14F7 41AA E7DC CA3D 8351 Confidentiality cannot be guaranteed on emails sent or received unencrypted --aYDVKSzuImP48n7V Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEoov0DD5VE3JmLRT3Qarn3Mo9g1EFAl49QeYACgkQQarn3Mo9 g1GeKA//UXj7JLrTAlwj0PkrgVjVvLSiNU93fm59/yWNs9HO+isUXhX+tlpLXPWz /WZd3q5oQKjd/deXfTelJH/hTAKAR/XIwaOOL7FKmdx22EVhEX7BIHfi2e6Xvwa4 OdbEOwWzug0rlLrEuOMOR9ep4iVMcQQfqJmLs2L9CRRTyZ+3/PL5VsiKqqNGZJxJ jygoqqydi5xQTOSCAGk2abNPhVKcpknb6WzgxqrAvImST2SW+wQv42aBa6CwGSS4 G52+qReDtRN5AJrCyxONtsrGP/2679Xi7uJGVkZlnQwVY6cNeXIcc70CZbbNqVHb aEKN4qLh1t5nuX5B5wWcFXAbKnQGW7ryVL2dHxQ1nByFJEILxqByyDr6lajfhieK BMQu+OqCwa+QA5b3jdEHGgem7h+Fwa6JC/3AQaUqFeAaPHPIbgoWtg4Hj538l6KX OabJIyDodz+H8WSnCjZcOEVZYK022yIymxf26TVnJgLPeiLY081cWCoA/3g4Eu5x lYk3hsUHGTy9LYjTEgh3rnPaB9ShjnYupKUK4Nf9LqYOxlVq0VS0cSq6q9nisLOV AOKKq2I/epoGUuriODIEkeYAaWHe9OyjqYYquhboOqRhimzaabX8X80iAKWjI2Bk RMQDeniEjvXBm3yvEAwZOtvnVAZvlArsR522aY0GKpWcMFfXJik= =jTUl -----END PGP SIGNATURE----- --aYDVKSzuImP48n7V-- From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 08 17:23:24 2020 Received: (at 39384) by debbugs.gnu.org; 8 Feb 2020 22:23:24 +0000 Received: from localhost ([127.0.0.1]:51921 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1j0YVX-0002OI-NJ for submit@debbugs.gnu.org; Sat, 08 Feb 2020 17:23:23 -0500 Received: from mx.kolabnow.com ([95.128.36.42]:23264) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1j0YVV-0002O3-Ht for 39384@debbugs.gnu.org; Sat, 08 Feb 2020 17:23:22 -0500 Received: from localhost (unknown [127.0.0.1]) by ext-mx-out002.mykolab.com (Postfix) with ESMTP id C361BB4C; Sat, 8 Feb 2020 23:23:14 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=kolabnow.com; h= content-type:content-type:mime-version:date:date:in-reply-to :message-id:subject:subject:from:from:references:received :received:received; s=dkim20160331; t=1581200593; x=1583014994; bh=1qt69xgsxTle6hJMEybQNLigLuq3ADSllt+VqbLD4vw=; b=Nn9VOncOD+43 DRisFrKz5WQd7sCe6MnaiXplxXuzK+M1Nx5B9hUTRPJlX/t6uea4ijzP2I28g0I/ 2ytD8SOWdyJ1SNm3p0rTkWwh6z+kRc5AshNrlKyuJuumIvqfKtqyDZu9rJQPHNq0 6ZJAjYxw7r/LnR3JeDm23byStF6j68jeJieAXMgAu+Pnc6DOI+9vWT/BOxsJui2g 5+DWfR6KcSN/vWPNwETi3NnHYC8BdRUmgAju/TfPtTi/k+4E2avliwhvXteJi770 4EShW1l/Z7uAQSljeycRGdlkI7oQwnEgPNbjCZOUXDI+3ZIDLepvBgc69efHtd1O kBj2JSlRmLlc9Gnx2TYOgDi7c8Sr6vtOwobMkMv2dAjxl2Td/kj1RGjYZA0PqazY 9UEfcxk60SrlHNe40c1/ZZdHUD8xEA1OGjtZdvf/TB4Y8HlnYzcZiCHd9s9nD503 FQt0+0Dag5lwfKkakWp/JPGPbuupX5mDoB3kwGQmhl/RRUdFCbqFU6J41zFlwroR BA7S7VKvzxtomoq1FTimGUezhx43jbp/e86S6EMG4MPMxi0eOOKnqPxg6GXG4QQa SQSaszyMp45A9Ts3BIPUC6D67PhAyw8n/x1wg769CDf618ifx4Asz86dp7PtyC6t Lmirfch6urGfWZUhG5duBG84C6hiH5M= X-Virus-Scanned: amavisd-new at mykolab.com X-Spam-Flag: NO X-Spam-Score: -1.9 X-Spam-Level: X-Spam-Status: No, score=-1.9 tagged_above=-10 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no Received: from mx.kolabnow.com ([127.0.0.1]) by localhost (ext-mx-out002.mykolab.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id gVst6dv0yASS; Sat, 8 Feb 2020 23:23:13 +0100 (CET) Received: from int-mx002.mykolab.com (unknown [10.9.13.2]) by ext-mx-out002.mykolab.com (Postfix) with ESMTPS id 83555135; Sat, 8 Feb 2020 23:23:13 +0100 (CET) Received: from ext-subm003.mykolab.com (unknown [10.9.6.3]) by int-mx002.mykolab.com (Postfix) with ESMTPS id 25D492602; Sat, 8 Feb 2020 23:23:13 +0100 (CET) References: <87v9oqrr0q.fsf@lafreniere.xyz> <878slmc640.fsf@nicolasgoaziou.fr> <87pnexrrwf.fsf@lafreniere.xyz> <20200202184757.GH9517@E5400> <87o8ugs5fu.fsf@lafreniere.xyz> <20200204095851.GA19864@E5400> <87mu9xspd0.fsf@lafreniere.xyz> <87lfpg4t3t.fsf@devup.no> <87lfpfrzok.fsf@lafreniere.xyz> <20200207105435.GG7827@E5400> From: "LaFreniere\, Joseph" To: Efraim Flashner Subject: Re: [bug#39384] [PATCH] gnu: Add emacs-rg. Message-ID: <87h800soqr.fsf@lafreniere.xyz> In-reply-to: <20200207105435.GG7827@E5400> Date: Sat, 08 Feb 2020 16:23:08 -0600 MIME-Version: 1.0 Content-Type: text/plain; format=flowed X-Spam-Score: 2.3 (++) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Efraim Flashner writes: > On Thu, Feb 06, 2020 at 06:47:23PM -0600, LaFreniere, Joseph > wrote: >> >> Marius Bakke writes: >> > "LaFreniere\, Joseph" , Nicolas Goaziou X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 2.3 (++) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Efraim Flashner writes: > On Thu, Feb 06, 2020 at 06:47:23PM -0600, LaFreniere, Joseph > wrote: >> >> Marius Bakke writes: >> > "LaFreniere\, Joseph" writes: > On Thu, Feb 06, 2020 at 06:47:23PM -0600, LaFreniere, Joseph > wrote: >> >> Marius Bakke writes: >> > "LaFreniere\, Joseph" writes: >> > > Ah, I see what you mean now. But wouldn't hard-coding the >> > > path to >> > > ripgrep in that way prevent the package from being able to >> > > use >> > > remote systems' ripgrep binaries when running over TRAMP? >> > >> > Perhaps we could patch [emacs-rg] to do both? Use the store >> > prefix if >> > it >> > exists, and fall back to searching in PATH? >> >> What would be the advantage of that over just searching PATH to >> start with? > > It will still work even if you don't have ripgrep specifically > installed. Can you point me to the Guix documentation where the functionality you're describing is explained? I have read through the description of package inputs in section 6.2.1 of Guix's manual, but I still do not explain what advantage patching the search path offers. My understanding is that if we want to preserve both local and remote-via-TRAMP functionality, we can either - just include ripgrep as a propagated input, or - include ripgrep as a propagated input _and_ patch the package to look for ripgrep in a hardcoded location (for local) as well as PATH (for TRAMP). Both options would have ripgrep included as propagated input. As soon as ripgrep is installed in a user's profile, its binary will be available on PATH. If that is correct, then I don't see any advantage to patching in a hardcoded path to ripgrep. -- Joseph LaFreniere From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 09 08:29:22 2020 Received: (at 39384) by debbugs.gnu.org; 9 Feb 2020 13:29:22 +0000 Received: from localhost ([127.0.0.1]:52188 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1j0meH-0002d9-PQ for submit@debbugs.gnu.org; Sun, 09 Feb 2020 08:29:22 -0500 Received: from flashner.co.il ([178.62.234.194]:33222) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1j0meG-0002ct-3O for 39384@debbugs.gnu.org; Sun, 09 Feb 2020 08:29:20 -0500 Received: from localhost (unknown [141.226.13.108]) by flashner.co.il (Postfix) with ESMTPSA id 33C7E402AA; Sun, 9 Feb 2020 13:29:12 +0000 (UTC) Date: Sun, 9 Feb 2020 15:28:41 +0200 From: Efraim Flashner To: "LaFreniere, Joseph" Subject: Re: [bug#39384] [PATCH] gnu: Add emacs-rg. Message-ID: <20200209132841.GA9296@E5400> References: <878slmc640.fsf@nicolasgoaziou.fr> <87pnexrrwf.fsf@lafreniere.xyz> <20200202184757.GH9517@E5400> <87o8ugs5fu.fsf@lafreniere.xyz> <20200204095851.GA19864@E5400> <87mu9xspd0.fsf@lafreniere.xyz> <87lfpg4t3t.fsf@devup.no> <87lfpfrzok.fsf@lafreniere.xyz> <20200207105435.GG7827@E5400> <87h800soqr.fsf@lafreniere.xyz> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="7AUc2qLy4jB3hD7Z" Content-Disposition: inline In-Reply-To: <87h800soqr.fsf@lafreniere.xyz> X-PGP-Key-ID: 0x41AAE7DCCA3D8351 X-PGP-Key: https://flashner.co.il/~efraim/efraim_flashner.asc X-PGP-Fingerprint: A28B F40C 3E55 1372 662D 14F7 41AA E7DC CA3D 8351 X-Spam-Score: 1.6 (+) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: On Sat, Feb 08, 2020 at 04:23:08PM -0600, LaFreniere, Joseph wrote: > > Efraim Flashner writes: > > On Thu, Feb 06, 2020 at 06:47:23PM -0600, LaFreniere, Joseph wrote: > > > > [...] Content analysis details: (1.6 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.0 SPF_PASS SPF: sender matches SPF record 1.6 PDS_OTHER_BAD_TLD Untrustworthy TLDs [URI: lafreniere.xyz (xyz)] -0.0 SPF_HELO_PASS SPF: HELO matches SPF record 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: lafreniere.xyz] X-Debbugs-Envelope-To: 39384 Cc: 39384@debbugs.gnu.org, Marius Bakke , Nicolas Goaziou X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.6 (/) --7AUc2qLy4jB3hD7Z Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Sat, Feb 08, 2020 at 04:23:08PM -0600, LaFreniere, Joseph wrote: >=20 > Efraim Flashner writes: > > On Thu, Feb 06, 2020 at 06:47:23PM -0600, LaFreniere, Joseph wrote: > > >=20 > > > Marius Bakke writes: > > > > "LaFreniere\, Joseph" writes: > > > > > Ah, I see what you mean now. But wouldn't hard-coding the > > > > > path to > > > > > ripgrep in that way prevent the package from being able to > > > > > use > > > > > remote systems' ripgrep binaries when running over TRAMP? > > > > > > > > Perhaps we could patch [emacs-rg] to do both? Use the store > > > > prefix if > > > > it > > > > exists, and fall back to searching in PATH? > > >=20 > > > What would be the advantage of that over just searching PATH to > > > start with? > >=20 > > It will still work even if you don't have ripgrep specifically > > installed. >=20 > Can you point me to the Guix documentation where the functionality you're > describing is explained? I have read through the description of package > inputs in section 6.2.1 of Guix's manual, but I still do not explain what > advantage patching the search path offers. I'm not sure I can find a spot in the manual where it is detailed. It comes down to the difference between "search for this program in PATH" and "call this program located at this location". By calling the rg at it's exact path rg doesn't need to be installed directly. > My understanding is that if we want to preserve both local and > remote-via-TRAMP functionality, we can either > - just include ripgrep as a propagated input, or > - include ripgrep as a propagated input _and_ patch the package to look = for > ripgrep in a hardcoded location (for local) as well as PATH (for TRAMP). The second option is to include ripgrep as an input and patch the package to look for it at a hardcoded location (for local) as well as PATH (for TRAMP). > Both options would have ripgrep included as propagated input. As soon as > ripgrep is installed in a user's profile, its binary will be available on > PATH. If that is correct, then I don't see any advantage to patching in a > hardcoded path to ripgrep. >=20 > -- > Joseph LaFreniere --=20 Efraim Flashner =D7=90=D7=A4=D7=A8=D7=99=D7=9D = =D7=A4=D7=9C=D7=A9=D7=A0=D7=A8 GPG key =3D A28B F40C 3E55 1372 662D 14F7 41AA E7DC CA3D 8351 Confidentiality cannot be guaranteed on emails sent or received unencrypted --7AUc2qLy4jB3hD7Z Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEoov0DD5VE3JmLRT3Qarn3Mo9g1EFAl5ACQgACgkQQarn3Mo9 g1FQIRAAkCP9tvujU2/ydzf9a1bZs5DE8PTQjNS5CvHpRr8g6vSDZ7njKufj6JyH UA5XT9T28Kh5dtUUSu0ncYsLxUrYaDTHXTalu4eN7HSwrPyRW6mCHijFih33VanL bGKU9n32WW7wsqrIGUUpHYEMueAS5qRQNGxvLJUDvzGzdlmksPr7K5GWEwgxTDRY KRUkS246Q9Izz6o0Uw5HXifYBcRgS051MDarKhhim1CeAWOH+xYDKyhx4NPxnj5t 8cAgoSZ2SphwFz+O/o0NScLb3CbgdvEjyxqXeA+Y1MgDvFDDSa5UA3tjBp35gyda diN2U2d8zDd1gvOReDs9XbzagXW1BrlqK3fqIF2QgMdkXMRdDWojHFnIwDoYoS+F XVvwSXeORdx8/vyA49m5+f/40pSl9TQayCyo3bXA2CEvBOqFbN76rbAifUe8x4du tsDWfPkcV7F0l8qgBCE8iEnpEX0kFLQqDVFLlrZlW4GJe0CIVasT7t9PZZ8kWTtg oYLWo7/48jAY7u61sQ8P5g3oinLeYXDE3oBbVP1boLdlq+hi2PBcc6af4PVNFF+R 2tQWqlTljdI7H2L+n1gGSWPw9RK7WuWGoiW13S48YSrhghaEPMiBpXzuRzaDvzaV WosCGPulnKcD3XtZAsy8ar8ySRj26xCcxsz/G6ha+IcXjCT6k1U= =dSJB -----END PGP SIGNATURE----- --7AUc2qLy4jB3hD7Z-- From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 22 18:09:07 2020 Received: (at 39384) by debbugs.gnu.org; 22 Feb 2020 23:09:07 +0000 Received: from localhost ([127.0.0.1]:50201 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1j5dtT-00068w-HU for submit@debbugs.gnu.org; Sat, 22 Feb 2020 18:09:07 -0500 Received: from mx.kolabnow.com ([95.128.36.40]:62698) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1j5dtR-00068P-Ow for 39384@debbugs.gnu.org; Sat, 22 Feb 2020 18:09:06 -0500 Received: from localhost (unknown [127.0.0.1]) by ext-mx-out003.mykolab.com (Postfix) with ESMTP id 5F08640B8C; Sun, 23 Feb 2020 00:08:57 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=kolabnow.com; h= content-type:content-type:mime-version:message-id:date:date :in-reply-to:subject:subject:from:from:references:received :received:received; s=dkim20160331; t=1582412936; x=1584227337; bh=ExVNG2NW6UePyYAodgdQPk0blvWs6jZFv1+qVqvuVZ8=; b=GNZbJ+BL+uvU CdSRpbRtiwwxETC+vQtLojBt2Eg60IjGCQ0DsE/nnYEtD4SP0SJVSBqphDAP1YdQ YffdNkE7IEj0Ph6PMsP9VUaJUL8S1jEdajVZwSTI0SwQ0A36MYzTCrIhpoql4H+0 G3V9Vef0fNv/Sg71ajLjEd491Jjb+1o4vUSHwvZx6iKK5tbDbqvX+yq5/BSqD0Vw XS2w6mNRwvLDmGS9rb2gN4FFFTvR/yQBsFHcqaGlo9VRAqQTdv4Z/afvN1UDkeH/ 1EqCxavvUJtR++3rlA1gdlGo0Z5O93uYEhE6Hr/tBYajVFJYWKnaHsiNVVH6GsiG kfMJtwY6FvIJB9HUCiESbDNvhvt5ULGIeeFdvmbR14acLZChbKRcB/nOlujD3SIM SKXIXea7I2D2BvjAW859IWEGqkFvor0YVt3VO3auTKEiPKjzkyQ2/0FoQr5KayWL HYBQC82OUDXiB7Feq3ThVc6PUUesTM5wFrQWCULFIbvNwyC5bucgBwtuoukWWMCJ pCslJzJIkXlGfYey5GKrh0LRasE7Vu1iQlvb4Q8QQ7aulPIurv0QUV5wSXkAbplN c+Zk7r6P8rsUqijj/qAWi7JV6Aw4B08Nzl5NndvJY8RAcGOtWkK78hpzxIgfS62M S3xfmPNvT0G2Hf6SeMYPw9bxvbiJlrs= X-Virus-Scanned: amavisd-new at mykolab.com X-Spam-Flag: NO X-Spam-Score: -1.9 X-Spam-Level: X-Spam-Status: No, score=-1.9 tagged_above=-10 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no Received: from mx.kolabnow.com ([127.0.0.1]) by localhost (ext-mx-out003.mykolab.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id nIGad8ljQdeG; Sun, 23 Feb 2020 00:08:56 +0100 (CET) Received: from int-mx002.mykolab.com (unknown [10.9.13.2]) by ext-mx-out003.mykolab.com (Postfix) with ESMTPS id 08E624038C; Sun, 23 Feb 2020 00:08:55 +0100 (CET) Received: from ext-subm002.mykolab.com (unknown [10.9.6.2]) by int-mx002.mykolab.com (Postfix) with ESMTPS id 9BE2310BE; Sun, 23 Feb 2020 00:08:55 +0100 (CET) References: <878slmc640.fsf@nicolasgoaziou.fr> <87pnexrrwf.fsf@lafreniere.xyz> <20200202184757.GH9517@E5400> <87o8ugs5fu.fsf@lafreniere.xyz> <20200204095851.GA19864@E5400> <87mu9xspd0.fsf@lafreniere.xyz> <87lfpg4t3t.fsf@devup.no> <87lfpfrzok.fsf@lafreniere.xyz> <20200207105435.GG7827@E5400> <87h800soqr.fsf@lafreniere.xyz> <20200209132841.GA9296@E5400> From: "LaFreniere\, Joseph" To: 39384@debbugs.gnu.org Subject: Re: [bug#39384] [PATCH] gnu: Add emacs-rg. In-reply-to: <20200209132841.GA9296@E5400> Date: Sat, 22 Feb 2020 17:08:51 -0600 Message-ID: <877e0e5if0.fsf@lafreniere.xyz> MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="=-=-=" X-Spam-Score: 2.8 (++) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Efraim Flashner writes: >> Can you point me to the Guix documentation where the >> functionality you're >> describing is explained? I have read through the description >> of pa [...] Content analysis details: (2.8 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: kolabnow.com] -0.0 SPF_PASS SPF: sender matches SPF record 2.0 PDS_OTHER_BAD_TLD Untrustworthy TLDs [URI: lafreniere.xyz (xyz)] 0.0 SPF_HELO_NONE SPF: HELO does not publish an SPF Record -0.0 RCVD_IN_DNSWL_NONE RBL: Sender listed at https://www.dnswl.org/, no trust [95.128.36.40 listed in list.dnswl.org] 0.3 URIBL_RHS_DOB Contains an URI of a new domain (Day Old Bread) [URIs: kolabnow.com] 0.5 FROM_SUSPICIOUS_NTLD From abused NTLD X-Debbugs-Envelope-To: 39384 Cc: Marius Bakke , Efraim Flashner , Nicolas Goaziou X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 2.8 (++) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Efraim Flashner writes: >> Can you point me to the Guix documentation where the >> functionality you're >> describing is explained? I have read through the description >> of pa [...] Content analysis details: (2.8 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: kolabnow.com] 0.3 URIBL_RHS_DOB Contains an URI of a new domain (Day Old Bread) [URIs: kolabnow.com] -0.0 RCVD_IN_DNSWL_NONE RBL: Sender listed at https://www.dnswl.org/, no trust [95.128.36.40 listed in list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 2.0 PDS_OTHER_BAD_TLD Untrustworthy TLDs [URI: lafreniere.xyz (xyz)] 0.0 SPF_HELO_NONE SPF: HELO does not publish an SPF Record 0.5 FROM_SUSPICIOUS_NTLD From abused NTLD 1.0 BULK_RE_SUSP_NTLD Precedence bulk and RE: from a suspicious TLD -1.0 MAILING_LIST_MULTI Multiple indicators imply a widely-seen list manager --=-=-= Content-Type: text/plain; format=flowed Efraim Flashner writes: >> Can you point me to the Guix documentation where the >> functionality you're >> describing is explained? I have read through the description >> of package >> inputs in section 6.2.1 of Guix's manual, but I still do not >> explain what >> advantage patching the search path offers. > > I'm not sure I can find a spot in the manual where it is > detailed. It > comes down to the difference between "search for this program in > PATH" > and "call this program located at this location". By calling the > rg > at it's exact path rg doesn't need to be installed directly. A patch that includes ripgrep as non-propagated inputs is attached. -- Joseph LaFreniere --=-=-= Content-Type: text/x-patch Content-Disposition: attachment; filename=0001-gnu-Add-emacs-rg.patch >From 2035b630c949364e97f08c4ddfd770a3bdfea095 Mon Sep 17 00:00:00 2001 From: Joseph LaFreniere Date: Sat, 1 Feb 2020 14:23:36 -0600 Subject: [PATCH] gnu: Add emacs-rg. * gnu/packages/emacs-xyz.scm (emacs-rg): New variable. --- gnu/packages/emacs-xyz.scm | 38 ++++++++++++++++++++++++++++++++++++++ 1 file changed, 38 insertions(+) diff --git a/gnu/packages/emacs-xyz.scm b/gnu/packages/emacs-xyz.scm index 3a026bec9a..281ca76119 100644 --- a/gnu/packages/emacs-xyz.scm +++ b/gnu/packages/emacs-xyz.scm @@ -135,6 +135,7 @@ #:use-module (gnu packages package-management) #:use-module (gnu packages perl) #:use-module (gnu packages pdf) + #:use-module (gnu packages rust-apps) #:use-module (gnu packages scheme) #:use-module (gnu packages speech) #:use-module (gnu packages xiph) @@ -2779,6 +2780,43 @@ column by drawing a thin line down the length of the editing window.") "This Emacs package allows managing multiple grep buffers.") (license license:gpl3+))) +(define-public emacs-rg + (package + (name "emacs-rg") + (version "1.8.1") + (source + (origin + (method git-fetch) + (uri (git-reference + (url "https://github.com/dajva/rg.el.git") + (commit version))) + (file-name (git-file-name name version)) + (sha256 + (base32 "0k7x5z7mh9flwih35cqy8chs54rack3nswdcpw5wcpgv6xim227y")))) + (build-system emacs-build-system) + (arguments + '(#:phases + (modify-phases %standard-phases + (add-after 'unpack 'hardcode-rg-path + ;; Hardcode the path to ripgrep. + (lambda _ + (let ((file "rg.el")) + (chmod file #o644) + (emacs-substitute-sexps file + ("(defcustom rg-executable" (which "rg"))))))))) + (propagated-inputs + `(("emacs-s" ,emacs-s) + ("emacs-wgrep" ,emacs-wgrep))) + (inputs + `(("ripgrep" ,ripgrep))) + (home-page "https://rgel.readthedocs.io/en/latest/") + (synopsis "Search tool based on @code{ripgrep}") + (description + "@code{rg} is an Emacs search package based on the @code{ripgrep} command +line tool. It allows one to interactively search based on the editing context +then refine or modify the search results.") + (license license:gpl3+))) + (define-public emacs-inf-ruby (package (name "emacs-inf-ruby") -- 2.25.1 --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 23 06:17:39 2020 Received: (at 39384-done) by debbugs.gnu.org; 23 Feb 2020 11:17:39 +0000 Received: from localhost ([127.0.0.1]:50430 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1j5pGV-0001y5-BA for submit@debbugs.gnu.org; Sun, 23 Feb 2020 06:17:39 -0500 Received: from flashner.co.il ([178.62.234.194]:53660) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1j5pGT-0001xp-Kc for 39384-done@debbugs.gnu.org; Sun, 23 Feb 2020 06:17:38 -0500 Received: from localhost (unknown [141.226.13.108]) by flashner.co.il (Postfix) with ESMTPSA id B0C79402FD; Sun, 23 Feb 2020 11:17:31 +0000 (UTC) Date: Sun, 23 Feb 2020 13:17:00 +0200 From: Efraim Flashner To: "LaFreniere, Joseph" Subject: Re: [bug#39384] [PATCH] gnu: Add emacs-rg. Message-ID: <20200223111700.GA6129@E5400> References: <20200202184757.GH9517@E5400> <87o8ugs5fu.fsf@lafreniere.xyz> <20200204095851.GA19864@E5400> <87mu9xspd0.fsf@lafreniere.xyz> <87lfpg4t3t.fsf@devup.no> <87lfpfrzok.fsf@lafreniere.xyz> <20200207105435.GG7827@E5400> <87h800soqr.fsf@lafreniere.xyz> <20200209132841.GA9296@E5400> <877e0e5if0.fsf@lafreniere.xyz> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="LQksG6bCIzRHxTLp" Content-Disposition: inline In-Reply-To: <877e0e5if0.fsf@lafreniere.xyz> X-PGP-Key-ID: 0x41AAE7DCCA3D8351 X-PGP-Key: https://flashner.co.il/~efraim/efraim_flashner.asc X-PGP-Fingerprint: A28B F40C 3E55 1372 662D 14F7 41AA E7DC CA3D 8351 X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 39384-done Cc: 39384-done@debbugs.gnu.org, Marius Bakke , Nicolas Goaziou X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --LQksG6bCIzRHxTLp Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Looks good to me. Patch pushed. Thanks! --=20 Efraim Flashner =D7=90=D7=A4=D7=A8=D7=99=D7=9D = =D7=A4=D7=9C=D7=A9=D7=A0=D7=A8 GPG key =3D A28B F40C 3E55 1372 662D 14F7 41AA E7DC CA3D 8351 Confidentiality cannot be guaranteed on emails sent or received unencrypted --LQksG6bCIzRHxTLp Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEoov0DD5VE3JmLRT3Qarn3Mo9g1EFAl5SXykACgkQQarn3Mo9 g1EaKQ//R2tzbCDasfYoBRiIpg6DHuZh0vyYstDBIwfT+1MvH3aG+j/sqFWvXP98 v1gwgbwSbEcgsdTbM7htI/78HJQvjqQqDW/Sk6xKltHwsx0RhUF+w1m/lGul1ZtD 6LchiS1ntiXVog1k1r3yjUbxpVR57dy8pC3YTP+mCopuo/tYYrxgMEgNUk9sT5lQ qrvoAzavlY3VQM7y/gKiCnOahKqZra8FNIukmKhajc2bsPS5uXgMXlMH3vRx/3Up Q/+O+PJYWx5bh6SJKPT9aC3YN9q2w5fAvlYaFi/jHG86ajQDGsCUE7tRZrqZaXF0 yAUJ4LDR4binAjCYvyPz3HY0CfoIxcBy0KXNYDJlDhVBafXYrKilSCTbaMk4wbh6 EDTTKf2P1eIaWIb8mhgVPUgHy7qLjsUm5v+adJxKdo0hKwaxH6JWCLDkiFnZ/A9l fqUrewZCmScV8pV9OaSLcMI4/V85WlLptPLxlmirsjniPjdxI4KZe2a3JEZXKNMs HWOP6MDQ64GjsP1Wd64VGcyrRIQePpVEarK0H916mrKluAokhdmTpVoosbAdnMhD 5BtO5k1xfn+eGuBXyYEZUOARyfWPJqZWD4gMAf4fdAM9tRdU5Uhqdcg+sys24hX1 TQ4behywNmINkm6NNzGut7QLplnrSZshBfZk4zREBO6odEwkzqQ= =O3AS -----END PGP SIGNATURE----- --LQksG6bCIzRHxTLp-- From unknown Sun Aug 10 07:24:02 2025 Received: (at fakecontrol) by fakecontrolmessage; To: internal_control@debbugs.gnu.org From: Debbugs Internal Request Subject: Internal Control Message-Id: bug archived. Date: Sun, 22 Mar 2020 11:24:05 +0000 User-Agent: Fakemail v42.6.9 # This is a fake control message. # # The action: # bug archived. thanks # This fakemail brought to you by your local debbugs # administrator