From unknown Wed Jun 18 23:05:31 2025 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 X-Mailer: MIME-tools 5.509 (Entity 5.509) Content-Type: text/plain; charset=utf-8 From: bug#37347 <37347@debbugs.gnu.org> To: bug#37347 <37347@debbugs.gnu.org> Subject: Status: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page Reply-To: bug#37347 <37347@debbugs.gnu.org> Date: Thu, 19 Jun 2025 06:05:31 +0000 retitle 37347 'guix environment' fails after trying to follow the steps fro= m "Running Guix Before It Is Installed" page reassign 37347 guix submitter 37347 Jan severity 37347 normal thanks From debbugs-submit-bounces@debbugs.gnu.org Sun Sep 08 20:49:39 2019 Received: (at submit) by debbugs.gnu.org; 9 Sep 2019 00:49:39 +0000 Received: from localhost ([127.0.0.1]:39336 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1i77sB-00058M-DD for submit@debbugs.gnu.org; Sun, 08 Sep 2019 20:49:39 -0400 Received: from lists.gnu.org ([209.51.188.17]:40630) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1i77s9-00058E-96 for submit@debbugs.gnu.org; Sun, 08 Sep 2019 20:49:37 -0400 Received: from eggs.gnu.org ([2001:470:142:3::10]:47610) by lists.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1i77s7-0003fc-Ib for bug-guix@gnu.org; Sun, 08 Sep 2019 20:49:37 -0400 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: * X-Spam-Status: No, score=1.0 required=5.0 tests=BAYES_40,FREEMAIL_FROM, RCVD_IN_DNSWL_LOW,SPOOFED_FREEMAIL,URIBL_BLOCKED autolearn=disabled version=3.3.2 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1i77s6-0002IE-7R for bug-guix@gnu.org; Sun, 08 Sep 2019 20:49:35 -0400 Received: from smtpo.poczta.interia.pl ([217.74.65.153]:60242) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1i77s5-0002Ga-It for bug-guix@gnu.org; Sun, 08 Sep 2019 20:49:34 -0400 X-Interia-R: Interia X-Interia-R-IP: 89.64.25.42 X-Interia-R-Helo: Received: from kompiuter (89-64-25-42.dynamic.chello.pl [89.64.25.42]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (No client certificate requested) by poczta.interia.pl (INTERIA.PL) with ESMTPSA for ; Mon, 9 Sep 2019 02:49:29 +0200 (CEST) Date: Mon, 9 Sep 2019 02:49:17 +0200 From: Jan To: bug-guix@gnu.org Subject: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page Message-ID: <20190909024917.19b37a23@kompiuter> X-Mailer: Claws Mail 3.14.1 (GTK+ 2.24.31; x86_64-pc-linux-gnu) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Interia-Antivirus: OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=interia.pl; s=biztos; t=1567990171; bh=hmDu1GhwZuvACkumqTeuo4Gy5/mVW8BV5BN4Pcpaxng=; h=X-Interia-R:X-Interia-R-IP:X-Interia-R-Helo:Date:From:To:Subject: Message-ID:X-Mailer:MIME-Version:Content-Type: Content-Transfer-Encoding:X-Interia-Antivirus; b=YThmQBDK/osreyaUGcl/mgvlDAPZw8vYHYqUHzPK8AO0N+f0n4naE4JyYceEnyzHf +aX3XBMyFxJHzhOvYetFH2letLg/7jzHB9N3h7oHTiEN30wTAVbmNn4v0FNKGcH4zr G0Sao1HX9W8snHGLda1r6JTHifwj7NVuvHNzevMo= X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x (no timestamps) [generic] X-Received-From: 217.74.65.153 X-Spam-Score: 0.4 (/) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.6 (/) Hi, I'm a new Guix user and I wanted to hack on Guix and update a package, I hadn't known exactly how to do this, so I started following instructions from https://guix.gnu.org/manual/en/html_node/Running-Guix-Before-It-Is-Installed.html#Running-Guix-Before-It-Is-Installed and https://guix.gnu.org/blog/2018/a-packaging-tutorial-for-guix/ The situation started to be interesting, when the tutorial told me to run "cd $GUIX_CHECKOUT" and "./pre-inst-env guix package --list-available=ruby" I was confused, because I couldn't find any "./pre-inst-env" file, so I used 'find' to search for it and there were one file with a similar name in $GUIX_CHECKOUT/build-aux - ./pre-inst-env.in (as I'm composing this email now I see that's stupid, but I tried using this file, as I don't know what I was doing (still don't know)) So I started running the following stupid commands: ---------------- user@machine ~/Prog/repo/guix [env]$ sudo -E ./pre-inst-env.in guix-daemon --build-users-group=guixbuild sudo: /gnu/store/z26h622slm8p61myhk45v3jjg8p7qm8z-profile/bin/sudo must be owned by uid 0 and have the setuid bit set user@machine ~/Prog/repo/guix [env]$ ./pre-inst-env.in bash: ./pre-inst-env.in: No such file or directory user@machine ~/Prog/repo/guix [env]$ cd build-aux/ user@machine ~/Prog/repo/guix/build-aux [env]$ sudo -E ./pre-inst-env.in guix-daemon --build-users-group=guixbuild sudo: /gnu/store/z26h622slm8p61myhk45v3jjg8p7qm8z-profile/bin/sudo must be owned by uid 0 and have the setuid bit set user@machine ~/Prog/repo/guix/build-aux [env]$ exit --------------- And then: ------------------ user@machine ~/Prog/repo/guix/build-aux$ chmod +x ./pre-inst-env.in user@machine ~/Prog/repo/guix/build-aux$ sudo -E ./pre-inst-env.in guix-daemon --build-users-group=guixbuild Password: ./pre-inst-env.in: line 33: cd: @abs_top_srcdir@: there is no such file or directory ./pre-inst-env.in: line 34: cd: @abs_top_builddir@: there is no such file or directory -------------------- And after that I couldn't run "guix environment" anymore, it threw an error: guix environment: error: failed to connect to `/var/guix/daemon-socket/socket': Connection refused Restarting the computer helps, but doing the same stuff breaks it again, so guess it's reproducible. After doing it I ran the "history" command so you can know what I did exactly (some commands were unfortunately run in an environment and I can't provide them), here it is: 371 git clone --recurse-submodules git://git.savannah.gnu.org/guix.git 372 guix environment guix --pure 373 sudo -E 374 sudo --help 375 guix environment guix --pure 376 guix environment guix --pure --ad-hoc sudo 377 ls 378 cd guix/ 379 ls 380 cd build-aux/ 381 ls 382 . 383 guix environment guix --pure 384 chmod +x ./pre-inst-env.in 385 sudo -E ./pre-inst-env.in guix-daemon --build-users-group=guixbuild 386 ls 387 cd .. 388 ./configure 389 guix environment guix --pure 390 history As stupid and complicated as it is, something is definitely broken here. Sincerely, Jan Wielkiewicz From debbugs-submit-bounces@debbugs.gnu.org Sun Sep 08 21:14:15 2019 Received: (at 37347) by debbugs.gnu.org; 9 Sep 2019 01:14:15 +0000 Received: from localhost ([127.0.0.1]:39357 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1i78Fy-0005mL-PK for submit@debbugs.gnu.org; Sun, 08 Sep 2019 21:14:15 -0400 Received: from mail-pg1-f181.google.com ([209.85.215.181]:41138) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1i78Fw-0005m5-Md for 37347@debbugs.gnu.org; Sun, 08 Sep 2019 21:14:13 -0400 Received: by mail-pg1-f181.google.com with SMTP id x15so6803770pgg.8 for <37347@debbugs.gnu.org>; Sun, 08 Sep 2019 18:14:12 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=message-id:subject:from:to:in-reply-to:references:date:mime-version :content-transfer-encoding; bh=+8R2GC4RsOjTSwdVTReKywKyfV7EaDVFQxsmYqRDKVQ=; b=LWdhI66eiVvLQAIbTCMNVNSa3NqRLu5z53wdSFq4JakVNKT/WA+GuqsroNFUIp6Gxy dpLzNxpTweeaNNQnh9ZABd7tcWhZNNzJZGYPhtbng/Q6trZfrPxlLodoE3VDMEayCCPq TbgzCX5BQKf/+/+447BBY4UEtT8tKLS5pC7/0T1hQCEG87sE5goJkYyY/Y4+6BXxgsOp wd+KSfHp9u9gsvxaqbl5hDRL4N+K4bO4kzoydwOVteNse84wCSqwxhdFFpkX5t9vWtsD /C0vSJLIrY2a0OEtGgeW1VKpeRNZ2E8s/wFdKlHQyEiQIBacBOSxB5gfBNbZZ2aXces3 OkRw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:message-id:subject:from:to:in-reply-to :references:date:mime-version:content-transfer-encoding; bh=+8R2GC4RsOjTSwdVTReKywKyfV7EaDVFQxsmYqRDKVQ=; b=Rl/KVLODNL94kpDwgeGJMrEwU3bvzRuVltIJR1EWS03cFHeAibkAigEgvYrhH7DMFZ 4lIF5ocgRwFofcNGMAhd1d5KjCXyKWCg/QGwyb2ZsQlH1pdzqKS910rQcOopcXliSiIh T8qAJr8Rqsi5bjeZldh+GpvI+Z3eOzSiUqhv5gJlAR3w0YnpFdAsyxqJ19IQBhgYmVHa 8T5P1mDcfA8IRZ6vuXfDA9W806JePl1BcuuGJOR3BxrPvUtsYNf1yjQq8f/X94W0tHkk CK7XUOt46lMUMJTHaB9M1/4Ke3VoBuheZbFrat8eOPDhrkq/EusBHutPzyZSwzdIBv4A Pwmw== X-Gm-Message-State: APjAAAWDNDCfj+Y9ewF1h6QEkB2i+4cg4a2Q46E8ULnTN3M70XBzqomH cAeEOnQg+IQjz7U5QMTHzB7XykEr X-Google-Smtp-Source: APXvYqxnYmxpseEXnsqWmG3IQI8atf8ii0q3poOVzk0w3P45toJ6ZBXg5hBUoz94z06TJkcVVAehZQ== X-Received: by 2002:a62:ea0d:: with SMTP id t13mr18545324pfh.171.1567991646798; Sun, 08 Sep 2019 18:14:06 -0700 (PDT) Received: from piranhaplant.local ([199.68.53.171]) by smtp.googlemail.com with ESMTPSA id k15sm14032261pfk.168.2019.09.08.18.14.05 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sun, 08 Sep 2019 18:14:06 -0700 (PDT) Message-ID: Subject: Re: bug#37347: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page From: Jesse Gibbons To: Jan , 37347@debbugs.gnu.org In-Reply-To: <20190909024917.19b37a23@kompiuter> References: <20190909024917.19b37a23@kompiuter> Content-Type: text/plain; charset="UTF-8" Date: Sun, 08 Sep 2019 19:14:05 -0600 Mime-Version: 1.0 X-Mailer: Evolution 3.28.1 Content-Transfer-Encoding: 7bit X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 37347 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) On Mon, 2019-09-09 at 02:49 +0200, Jan wrote: > Hi, I'm a new Guix user and I wanted to hack on Guix and update a > package, I hadn't known exactly how to do this, so I started > following > instructions from > https://guix.gnu.org/manual/en/html_node/Running-Guix-Before-It-Is-In > stalled.html#Running-Guix-Before-It-Is-Installed > and > https://guix.gnu.org/blog/2018/a-packaging-tutorial-for-guix/ > > The situation started to be interesting, when the tutorial told me to > run "cd $GUIX_CHECKOUT" and "./pre-inst-env guix package > --list-available=ruby" > I was confused, because I couldn't find any "./pre-inst-env" file, so > I > used 'find' to search for it and there were one file with a similar > name > in $GUIX_CHECKOUT/build-aux - ./pre-inst-env.in (as I'm composing > this > email now I see that's stupid, but I tried using this file, as I > don't > know what I was doing (still don't know)) > So I started running the following stupid commands: > > ---------------- > user@machine ~/Prog/repo/guix [env]$ sudo -E ./pre-inst-env.in > guix-daemon --build-users-group=guixbuild > > sudo: /gnu/store/z26h622slm8p61myhk45v3jjg8p7qm8z-profile/bin/sudo > must > be owned by uid 0 and have the setuid bit set > > user@machine ~/Prog/repo/guix [env]$ ./pre-inst-env.in > bash: ./pre-inst-env.in: No such file or directory > user@machine ~/Prog/repo/guix [env]$ cd build-aux/ > user@machine ~/Prog/repo/guix/build-aux [env]$ sudo > -E ./pre-inst-env.in guix-daemon --build-users-group=guixbuild > sudo: /gnu/store/z26h622slm8p61myhk45v3jjg8p7qm8z-profile/bin/sudo > must > be owned by uid 0 and have the setuid bit set > user@machine ~/Prog/repo/guix/build-aux [env]$ exit > --------------- > > And then: > > ------------------ > user@machine ~/Prog/repo/guix/build-aux$ chmod +x ./pre-inst-env.in > user@machine ~/Prog/repo/guix/build-aux$ sudo -E ./pre-inst-env.in > guix-daemon --build-users-group=guixbuild Password: > ./pre-inst-env.in: line 33: cd: @abs_top_srcdir@: > there is no such file or directory > ./pre-inst-env.in: line 34: cd: > @abs_top_builddir@: there is no such file or directory > -------------------- > > And after that I couldn't run "guix > environment" anymore, it threw an error: > > guix environment: error: failed to connect to > `/var/guix/daemon-socket/socket': Connection refused > > Restarting the computer helps, but doing the same stuff breaks it > again, so guess it's reproducible. > > After doing it I ran the "history" command so you can know what I did > exactly (some commands were unfortunately run in an environment and I > can't provide them), here it is: > > 371 git clone --recurse-submodules > git://git.savannah.gnu.org/guix.git > 372 guix environment guix --pure > 373 sudo -E > 374 sudo --help > 375 guix environment guix --pure > 376 guix environment guix --pure --ad-hoc sudo > 377 ls > 378 cd guix/ > 379 ls > 380 cd build-aux/ > 381 ls > 382 . > 383 guix environment guix --pure > 384 chmod +x ./pre-inst-env.in > 385 sudo -E ./pre-inst-env.in guix-daemon > --build-users-group=guixbuild > 386 ls > 387 cd .. > 388 ./configure > 389 guix environment guix --pure > 390 history > > As stupid and complicated as it is, something is definitely broken > here. > > Sincerely, > Jan Wielkiewicz > > > pre-inst-env.in is for generating the pre-inst-env script. Have you tried: ./bootstrap ./configure This should generate pre-inst-env for you. Also, make sure the guix daemon is running after you restart. From debbugs-submit-bounces@debbugs.gnu.org Mon Sep 09 02:27:20 2019 Received: (at 37347) by debbugs.gnu.org; 9 Sep 2019 06:27:20 +0000 Received: from localhost ([127.0.0.1]:39475 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1i7D8y-00012P-89 for submit@debbugs.gnu.org; Mon, 09 Sep 2019 02:27:20 -0400 Received: from lepiller.eu ([89.234.186.109]:36686) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1i7D8v-00012C-TE for 37347@debbugs.gnu.org; Mon, 09 Sep 2019 02:27:18 -0400 Received: from lepiller.eu (localhost [127.0.0.1]) by lepiller.eu (OpenSMTPD) with ESMTP id 4bf56f46; Mon, 9 Sep 2019 06:27:12 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=lepiller.eu; h=date :in-reply-to:references:mime-version:content-type :content-transfer-encoding:subject:to:from:message-id; s=dkim; bh=7bi1ZiiikLCzdX01l3sDgBoj3p4=; b=AwlM9KdOF8OYiF3U0Ti7cuNNUq+X bz4Dc7z44s6rFE+7VSb4uUtxiY40AcZSWs9nm8SNbaUGz/M7ABRiAaezlLWvU98N AkRIWXGgyvpUwPKY6nsl/iiVdzOV3gpCKHcy0uN21L6xcI90gY9IfLnbu2IDgrXl zuYIXAjZA8KkdBYKmlTywscuHmxaXcNcF4BTY/Zq6RksBy4EHG8YC8+n5VyDtryv DRSmUu6PBbHpAUzOpMWPqh9egZbXmK9HG5tnyU3pqzjxKA0sE150K2vIFqF4dxQc J/u21H9ZvdjxKlRE2lQyas2LhpjwSvpZ/XkHaUZ1h6liUK3+Xgz7pI1qYw== DomainKey-Signature: a=rsa-sha1; c=nofws; d=lepiller.eu; h=date :in-reply-to:references:mime-version:content-type :content-transfer-encoding:subject:to:from:message-id; q=dns; s= dkim; b=dANZ9M2pwshlJea47aT+6S8jGUalafIV8d+xiwCGnbfLQWTzXIME1efQ o0bWtHh2B2y5ZdOX/yQu6VzNBDVPmjxAJ3f5Z7LkBeLCMKYjFWNgN+CUF4hqHBCX ZenUpB7csXBz/HCVeiNURUJEiK7AFgd5C4Rxquus+dSqZBIpTuf85+3PVTLrdQSR acHilsck9ZDfMTq8uFSJbUAn7ioM+92qw1TvyrYcfluhL9wpGSoOiiEwHWODTfgm T/fSTVEzPNEqRixYhFkQCk+Q5/INeBKNsUvb9UKtDE8sXDXgiV38XLhxjdF3Ti37 06ML8WwkSQ5cAQ/laW+BiWUri2BtWQ== Received: by lepiller.eu (OpenSMTPD) with ESMTPSA id 33cd9d8f (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256:NO); Mon, 9 Sep 2019 06:27:11 +0000 (UTC) Date: Mon, 09 Sep 2019 08:23:50 +0200 User-Agent: K-9 Mail for Android In-Reply-To: References: <20190909024917.19b37a23@kompiuter> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Subject: Re: bug#37347: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page To: Jesse Gibbons , Jan , 37347@debbugs.gnu.org From: Julien Lepiller Message-ID: X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 37347 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Le 9 septembre 2019 03:14:05 GMT+02:00, Jesse Gibbons a =C3=A9crit : >On Mon, 2019-09-09 at 02:49 +0200, Jan wrote: >> Hi, I'm a new Guix user and I wanted to hack on Guix and update a >> package, I hadn't known exactly how to do this, so I started >> following >> instructions from >> https://guix=2Egnu=2Eorg/manual/en/html_node/Running-Guix-Before-It-Is-= In >> stalled=2Ehtml#Running-Guix-Before-It-Is-Installed >> and >> https://guix=2Egnu=2Eorg/blog/2018/a-packaging-tutorial-for-guix/ >>=20 >> The situation started to be interesting, when the tutorial told me to >> run "cd $GUIX_CHECKOUT" and "=2E/pre-inst-env guix package >> --list-available=3Druby" >> I was confused, because I couldn't find any "=2E/pre-inst-env" file, so >> I >> used 'find' to search for it and there were one file with a similar >> name >> in $GUIX_CHECKOUT/build-aux - =2E/pre-inst-env=2Ein (as I'm composing >> this >> email now I see that's stupid, but I tried using this file, as I >> don't >> know what I was doing (still don't know)) >> So I started running the following stupid commands: >>=20 >> ---------------- >> user@machine ~/Prog/repo/guix [env]$ sudo -E =2E/pre-inst-env=2Ein >> guix-daemon --build-users-group=3Dguixbuild >>=20 >> sudo: /gnu/store/z26h622slm8p61myhk45v3jjg8p7qm8z-profile/bin/sudo >> must >> be owned by uid 0 and have the setuid bit set=20 >>=20 >> user@machine ~/Prog/repo/guix [env]$ =2E/pre-inst-env=2Ein >> bash: =2E/pre-inst-env=2Ein: No such file or directory=20 >> user@machine ~/Prog/repo/guix [env]$ cd build-aux/=20 >> user@machine ~/Prog/repo/guix/build-aux [env]$ sudo >> -E =2E/pre-inst-env=2Ein guix-daemon --build-users-group=3Dguixbuild >> sudo: /gnu/store/z26h622slm8p61myhk45v3jjg8p7qm8z-profile/bin/sudo >> must >> be owned by uid 0 and have the setuid bit set=20 >> user@machine ~/Prog/repo/guix/build-aux [env]$ exit >> --------------- >>=20 >> And then: >>=20 >> ------------------ >> user@machine ~/Prog/repo/guix/build-aux$ chmod +x =2E/pre-inst-env=2Ein= =20 >> user@machine ~/Prog/repo/guix/build-aux$ sudo -E =2E/pre-inst-env=2Ein >> guix-daemon --build-users-group=3Dguixbuild Password:=20 >> =2E/pre-inst-env=2Ein: line 33: cd: @abs_top_srcdir@: >> there is no such file or directory=20 >> =2E/pre-inst-env=2Ein: line 34: cd: >> @abs_top_builddir@: there is no such file or directory >> -------------------- >>=20 >> And after that I couldn't run "guix >> environment" anymore, it threw an error: >>=20 >> guix environment: error: failed to connect to >> `/var/guix/daemon-socket/socket': Connection refused >>=20 >> Restarting the computer helps, but doing the same stuff breaks it >> again, so guess it's reproducible=2E >>=20 >> After doing it I ran the "history" command so you can know what I did >> exactly (some commands were unfortunately run in an environment and I >> can't provide them), here it is: >>=20 >> 371 git clone --recurse-submodules >> git://git=2Esavannah=2Egnu=2Eorg/guix=2Egit=20 >> 372 guix environment guix --pure >> 373 sudo -E >> 374 sudo --help >> 375 guix environment guix --pure >> 376 guix environment guix --pure --ad-hoc sudo=20 >> 377 ls >> 378 cd guix/ >> 379 ls >> 380 cd build-aux/ >> 381 ls >> 382 =2E >> 383 guix environment guix --pure >> 384 chmod +x =2E/pre-inst-env=2Ein=20 >> 385 sudo -E =2E/pre-inst-env=2Ein guix-daemon >> --build-users-group=3Dguixbuild=20 >> 386 ls >> 387 cd =2E=2E >> 388 =2E/configure=20 >> 389 guix environment guix --pure >> 390 history >>=20 >> As stupid and complicated as it is, something is definitely broken >> here=2E >>=20 >> Sincerely, >> Jan Wielkiewicz >>=20 >>=20 >>=20 > >pre-inst-env=2Ein is for generating the pre-inst-env script=2E Have you >tried: >=2E/bootstrap >=2E/configure > >This should generate pre-inst-env for you=2E > >Also, make sure the guix daemon is running after you restart=2E Do not run =2E/configure alone, always specify --localstatedir=3D/var unle= ss you plan to run the daemon from the repo too (then it's fine without the= option, but you won't be able to pull or you'll get into trouble iiuc)=2E From debbugs-submit-bounces@debbugs.gnu.org Wed Sep 11 16:53:28 2019 Received: (at 37347) by debbugs.gnu.org; 11 Sep 2019 20:53:28 +0000 Received: from localhost ([127.0.0.1]:42818 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1i89cG-0002Zo-5t for submit@debbugs.gnu.org; Wed, 11 Sep 2019 16:53:28 -0400 Received: from smtpo.poczta.interia.pl ([217.74.65.153]:34059) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1i89cE-0002ZX-65 for 37347@debbugs.gnu.org; Wed, 11 Sep 2019 16:53:27 -0400 X-Interia-R: Interia X-Interia-R-IP: 89.64.26.126 X-Interia-R-Helo: Received: from localhost (89-64-26-126.dynamic.chello.pl [89.64.26.126]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (No client certificate requested) by poczta.interia.pl (INTERIA.PL) with ESMTPSA; Wed, 11 Sep 2019 22:53:19 +0200 (CEST) Date: Wed, 11 Sep 2019 22:53:18 +0200 From: Jan To: Julien Lepiller Subject: Re: bug#37347: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page Message-ID: <20190911225318.49617ba0@interia.pl> In-Reply-To: References: <20190909024917.19b37a23@kompiuter> X-Mailer: Claws Mail 3.17.3 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Interia-Antivirus: OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=interia.pl; s=biztos; t=1568235199; bh=GNh9KvbxMSxeLHZCN8eEYIztacUP+ec6PUm2V9Omz7M=; h=X-Interia-R:X-Interia-R-IP:X-Interia-R-Helo:Date:From:To:Cc: Subject:Message-ID:In-Reply-To:References:X-Mailer:MIME-Version: Content-Type:Content-Transfer-Encoding:X-Interia-Antivirus; b=VpX2u1BYZD6EDHyKu619eIkSEBnzjZoFl2TAg4rz+XleqIM1uJdLC6rhZaXSkm71i 3lvuyQo8WvCXvGFqUkz+4eP3cmAnoI54SxHFLqYTHuI76RvZfd7pVRBWdDfbJ72WoM t8wR8kfd77dLI4KvLsuoWPp3KL7teXffTnfMA7dI= X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 37347 Cc: Jesse Gibbons , 37347@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) > Do not run ./configure alone, always specify --localstatedir=/var > unless you plan to run the daemon from the repo too (then it's fine > without the option, but you won't be able to pull or you'll get into > trouble iiuc). Thank you all for advice, after running ./configure --localstatedir=/var the file has been generated. Then to be able to run Guix, I had to do "make check". Now I have Guix available and I would like to update a package, like showed in the manual or the tutorial, but running for example "./pre-inst-env guix refresh opendht" throws the following error: Backtrace: 18 (apply-smob/1 #) In ice-9/boot-9.scm: 705:2 17 (call-with-prompt _ _ #) In ice-9/eval.scm: 619:8 16 (_ #(#(#))) In guix/ui.scm: 1692:12 15 (run-guix-command _ . _) In ice-9/boot-9.scm: 829:9 14 (catch _ _ # ?) 829:9 13 (catch _ _ # ?) In guix/store.scm: 623:10 12 (call-with-store _) 1803:24 11 (run-with-store # _ # _ ?) In guix/scripts/refresh.scm: 541:14 10 (_ _) In srfi/srfi-1.scm: 640:9 9 (for-each # ?) In guix/scripts/refresh.scm: 344:2 8 (check-for-package-update # ?) In guix/import/github.scm: 231:25 7 (latest-release #) 200:22 6 (latest-released-version "https://github.com/savoirfai?" ?) 163:2 5 (fetch-releases-or-tags _) In ice-9/boot-9.scm: 829:9 4 (catch srfi-34 # ?) In guix/import/json.scm: 41:19 3 (_) In guix/http-client.scm: 88:25 2 (http-fetch _ #:port _ #:text? _ #:buffered? _ # _ # _ # ?) In guix/build/download.scm: 426:4 1 (open-connection-for-uri _ #:timeout _ # _) 313:6 0 (tls-wrap # _ # _) guix/build/download.scm:313:6: In procedure tls-wrap: X.509 certificate of 'api.github.com' could not be verified: signer-not-found invalid Am I missing a dependency in my environment? Running "guix refresh" without ./pre-inst-env and "guix environment guix --pure" works. ---- Jan Wielkiewicz From debbugs-submit-bounces@debbugs.gnu.org Mon Sep 16 12:01:14 2019 Received: (at 37347) by debbugs.gnu.org; 16 Sep 2019 16:01:14 +0000 Received: from localhost ([127.0.0.1]:50878 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1i9tRC-0003OR-4t for submit@debbugs.gnu.org; Mon, 16 Sep 2019 12:01:14 -0400 Received: from eggs.gnu.org ([209.51.188.92]:57026) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1i9tRA-0003OC-9N for 37347@debbugs.gnu.org; Mon, 16 Sep 2019 12:01:12 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:53084) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1i9tR4-0005dc-2w; Mon, 16 Sep 2019 12:01:06 -0400 Received: from [2001:660:6102:320:e120:2c8f:8909:cdfe] (port=49554 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1i9tR3-0006oU-J6; Mon, 16 Sep 2019 12:01:05 -0400 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Jan Subject: Re: bug#37347: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page References: <20190909024917.19b37a23@kompiuter> <20190911225318.49617ba0@interia.pl> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 30 Fructidor an 227 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Mon, 16 Sep 2019 18:01:04 +0200 In-Reply-To: <20190911225318.49617ba0@interia.pl> (Jan's message of "Wed, 11 Sep 2019 22:53:18 +0200") Message-ID: <87tv9c5iyn.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 37347 Cc: Julien Lepiller , Jesse Gibbons , 37347@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Hi Jan, Jan skribis: > guix/build/download.scm:313:6: In procedure tls-wrap: > X.509 certificate of 'api.github.com' could not be verified: > signer-not-found > invalid It looks like X.509 certificates used to authenticate web sites over HTTPS could not be found. Did you set environment variables and all as described at ? HTH, Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Mon Sep 16 14:40:25 2019 Received: (at 37347) by debbugs.gnu.org; 16 Sep 2019 18:40:25 +0000 Received: from localhost ([127.0.0.1]:51041 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1i9vvF-0001bk-3e for submit@debbugs.gnu.org; Mon, 16 Sep 2019 14:40:25 -0400 Received: from smtpo.poczta.interia.pl ([217.74.65.153]:49722) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1i9vvD-0001bU-3e for 37347@debbugs.gnu.org; Mon, 16 Sep 2019 14:40:23 -0400 X-Interia-R: Interia X-Interia-R-IP: 89.64.26.126 X-Interia-R-Helo: Received: from localhost (89-64-26-126.dynamic.chello.pl [89.64.26.126]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (No client certificate requested) by poczta.interia.pl (INTERIA.PL) with ESMTPSA; Mon, 16 Sep 2019 19:40:07 +0200 (CEST) Date: Mon, 16 Sep 2019 19:40:07 +0200 From: Jan To: Ludovic =?UTF-8?B?Q291cnTDqHM=?= Subject: Re: bug#37347: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page Message-ID: <20190916194007.0008c175@interia.pl> In-Reply-To: <87tv9c5iyn.fsf@gnu.org> References: <20190909024917.19b37a23@kompiuter> <20190911225318.49617ba0@interia.pl> <87tv9c5iyn.fsf@gnu.org> X-Mailer: Claws Mail 3.17.3 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Interia-Antivirus: OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=interia.pl; s=biztos; t=1568655609; bh=PSDXV8Uft0B6YtgHB+mI7lnzgdPNtYvv3ihb15Jxp+I=; h=X-Interia-R:X-Interia-R-IP:X-Interia-R-Helo:Date:From:To:Cc: Subject:Message-ID:In-Reply-To:References:X-Mailer:MIME-Version: Content-Type:Content-Transfer-Encoding:X-Interia-Antivirus; b=Nxur+MWRBzUPZ6VKyg54f4YvpP+HMTopQt3M36b5K6Kvez4O4+sPoK0EXKdiSIiD5 sc9L7yGRm0gJxeUODlp44U38TB86+LLfyOZ3xRL3AhLB6aqY8qUOU2jdnxs9ofXE9h 69Hvo+S3pNARGCCDP3C5MWqqCmLYDEgwQs9XLJ3g= X-EOM: H-lo10 X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 37347 Cc: Julien Lepiller , Jesse Gibbons , 37347@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Dnia 2019-09-16, o godz. 18:01:04 Ludovic Court=C3=A8s napisa=C5=82(a): > Hi Jan, >=20 > Jan skribis: >=20 > > guix/build/download.scm:313:6: In procedure tls-wrap: > > X.509 certificate of 'api.github.com' could not be verified: > > signer-not-found > > invalid >=20 > It looks like X.509 certificates used to authenticate web sites over > HTTPS could not be found. >=20 > Did you set environment variables and all as described at > ? >=20 > HTH, > Ludo=E2=80=99. I have nss-certs installed as a global package in my config.scm and refreshing only doesn't work in the environment created by "guix environmnet guix --pure" - it works without an environment. Tried using "--ad-hoc nss-certs", but it didn't work. The manual says I have to add certs manually if I'm an unprivileged user or running Guix on a foreign distro, but I'm running Guix natively on my machine. Do I have to define variables like this anyway? --- Jan Wielkiewicz From debbugs-submit-bounces@debbugs.gnu.org Thu Oct 03 12:40:09 2019 Received: (at 37347) by debbugs.gnu.org; 3 Oct 2019 16:40:09 +0000 Received: from localhost ([127.0.0.1]:40967 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iG49A-0002lD-PG for submit@debbugs.gnu.org; Thu, 03 Oct 2019 12:40:09 -0400 Received: from smtpo.poczta.interia.pl ([217.74.65.208]:55415) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iG495-0002kV-L8 for 37347@debbugs.gnu.org; Thu, 03 Oct 2019 12:40:07 -0400 X-Interia-R: Interia X-Interia-R-IP: 89.64.26.126 X-Interia-R-Helo: Received: from kompiuter (89-64-26-126.dynamic.chello.pl [89.64.26.126]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (No client certificate requested) by poczta.interia.pl (INTERIA.PL) with ESMTPSA; Thu, 3 Oct 2019 18:39:53 +0200 (CEST) Date: Thu, 3 Oct 2019 18:39:45 +0200 From: Jan Wielkiewicz To: Ludovic =?UTF-8?B?Q291cnTDqHM=?= Subject: Re: bug#37347: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page Message-ID: <20191003183945.2397bacf@kompiuter> In-Reply-To: <87tv9c5iyn.fsf@gnu.org> References: <20190909024917.19b37a23@kompiuter> <20190911225318.49617ba0@interia.pl> <87tv9c5iyn.fsf@gnu.org> X-Mailer: Claws Mail 3.14.1 (GTK+ 2.24.31; x86_64-pc-linux-gnu) MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Interia-Antivirus: OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=interia.pl; s=biztos; t=1570120796; bh=EMtrhjCi2Aaihv0h4l6j27GSnX9ShWJswPojB0Ut5Qo=; h=X-Interia-R:X-Interia-R-IP:X-Interia-R-Helo:Date:From:To:Cc: Subject:Message-ID:In-Reply-To:References:X-Mailer:MIME-Version: Content-Type:Content-Transfer-Encoding:X-Interia-Antivirus; b=nQVH+M8GPl9SH6k+SfhBWtAQMSTDWpYc/PIxU5ZL5dJs0RmqdQuNLjzeUwhS4fEUt 8cpA9LJCzwVEpMv6K0aBesF+8GzxaJ22PDJwEvejfP7gJFnQpEf/GG5C4RD2U+bU2F J4zE9Oe8pm8XzWNxwFv9JdmZusU+ggmkA6+Qde6c= X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 37347 Cc: Julien Lepiller , Jesse Gibbons , 37347@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) On Mon, 16 Sep 2019 18:01:04 +0200 Ludovic Court=C3=A8s wrote: > It looks like X.509 certificates used to authenticate web sites over > HTTPS could not be found. >=20 > Did you set environment variables and all as described at > ? >=20 > HTH, > Ludo=E2=80=99. Hi again, I've tried setting these variables in the environment but the same effect. How can I get "guix refresh" to work in the environment? I think this should be explained somewhere a bit more, because after reading the packaging tutorial and parts of the documentation I couldn't set up the development environment for Guix.=20 A simple step-by-step tutorial or just list of things to do would make it more understandable. Is this already work in progress in the Cookbook? For example in this section: https://guix.gnu.org/manual/en/html_node/Building-from-Git.html#Building-fr= om-Git It is easy to miss the last step - running "make check", because it isn't explained that running "make check" is necessary to be able to run ./pre-inst-env. I thought I could just skip this and start hacking. It would be more clear if the manual or the cookbook contained a step-by-step list like this: Quick setting up the environment: 1. git clone ... 2. ./bootstrap 3. ./configure --localstatedir=3D/var/ 4. make check 5. setting certificates to be able to update a package etc. Jan Wielkiewicz From debbugs-submit-bounces@debbugs.gnu.org Thu Oct 03 16:12:19 2019 Received: (at 37347) by debbugs.gnu.org; 3 Oct 2019 20:12:19 +0000 Received: from localhost ([127.0.0.1]:41336 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iG7SU-00060R-PT for submit@debbugs.gnu.org; Thu, 03 Oct 2019 16:12:19 -0400 Received: from imta-37.everyone.net ([216.200.145.37]:58000 helo=imta-38.everyone.net) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iG7SS-00060I-MU for 37347@debbugs.gnu.org; Thu, 03 Oct 2019 16:12:17 -0400 Received: from pps.filterd (localhost.localdomain [127.0.0.1]) by imta-38.everyone.net (8.16.0.27/8.16.0.27) with SMTP id x93K8e1r001037; Thu, 3 Oct 2019 13:12:15 -0700 X-Eon-Originating-Account: -cUV3Mv871YqLGAt2JkftxZDPIIxME4MjQ4KxwbTBN8 X-Eon-Dm: m0116293.ppops.net Received: by m0116293.mta.everyone.net (EON-AUTHRELAY2 - 32d0d199) id m0116293.5d8d412f.106225; Thu, 3 Oct 2019 12:57:56 -0700 X-Eon-Sig: AQMHrIJdllLEZU6VewIAAAAE,661b02ef3c67c7246d73496ea7a109cc X-Eip: qs8d58IKXkNPGg0caBevWTW5Q5BC7VkK0MemCUJB7l4 Date: Thu, 3 Oct 2019 12:57:46 -0700 From: Bengt Richter To: Ludovic =?utf-8?Q?Court=C3=A8s?= Subject: Re: bug#37347: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page Message-ID: <20191003195746.GA96737@PhantoNv4ArchGx.localdomain> References: <20190909024917.19b37a23@kompiuter> <20190911225318.49617ba0@interia.pl> <87tv9c5iyn.fsf@gnu.org> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: 8bit In-Reply-To: <87tv9c5iyn.fsf@gnu.org> User-Agent: Mutt/1.12.1 (2019-06-15) X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:, , definitions=2019-10-03_07:, , signatures=0 X-Proofpoint-Spam-Details: rule=notspam policy=default score=0 priorityscore=1501 malwarescore=0 suspectscore=0 phishscore=0 bulkscore=0 spamscore=0 clxscore=1034 lowpriorityscore=0 mlxscore=0 impostorscore=0 mlxlogscore=999 adultscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.0.1-1908290000 definitions=main-1910030159 X-Spam-Score: -0.5 (/) X-Debbugs-Envelope-To: 37347 Cc: Jan , Jesse Gibbons , 37347@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: Bengt Richter Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.5 (-) On +2019-09-16 18:01:04 +0200, Ludovic Courtès wrote: > Hi Jan, > > Jan skribis: > > > guix/build/download.scm:313:6: In procedure tls-wrap: > > X.509 certificate of 'api.github.com' could not be verified: > > signer-not-found > > invalid > > It looks like X.509 certificates used to authenticate web sites over > HTTPS could not be found. > > Did you set environment variables and all as described at > ? > > HTH, > Ludo’. > > > I could not get to that manual url: https://guix.gnu.org/manual/en/html_node/X_002e509-Certificates.html Not with with lynx, nor emacs M-x eww, nor weston-launch, click for terminal, firefox --private &, paste above url As close as I could get (in firefox, but think lynx and eww would go too): https://www.gnu.org/manual/manual.html Where I found: broken links in the above: https://www.gnu.org/software/guix/manual/ https://www.gnu.org/software/guix/ IOW, I couldn't get to the manual. Am I in a DNS bubble of some kind? If the site is just bogged down busy it shouldn't 404, right? Nor on some auth failure -- that should be another code, right? Doesn't gnu.org have a little broken-link scanner for its own domain? Does no one else encounter access problems and broken links?? TIA for clues. -- Regards, Bengt Richter From debbugs-submit-bounces@debbugs.gnu.org Thu Oct 03 23:06:30 2019 Received: (at 37347) by debbugs.gnu.org; 4 Oct 2019 03:06:31 +0000 Received: from localhost ([127.0.0.1]:41521 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iGDvK-0003a2-J2 for submit@debbugs.gnu.org; Thu, 03 Oct 2019 23:06:30 -0400 Received: from imta-35.everyone.net ([216.200.145.35]:59710 helo=imta-38.everyone.net) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iGDvH-0003Zs-Fu for 37347@debbugs.gnu.org; Thu, 03 Oct 2019 23:06:28 -0400 Received: from pps.filterd (omta001.sj2.proofpoint.com [127.0.0.1]) by imta-38.everyone.net (8.16.0.27/8.16.0.27) with SMTP id x9435nlq014934; Thu, 3 Oct 2019 20:06:24 -0700 X-Eon-Originating-Account: sV_g8trikkOpP24ws4d771g2uHeFVu_rKsBkfYEefx4 X-Eon-Dm: m0116293.ppops.net Received: by m0116293.mta.everyone.net (EON-AUTHRELAY2 - 32d0d199) id m0116293.5d9674b5.55b6; Thu, 3 Oct 2019 20:06:24 -0700 X-Eon-Sig: AQMHrIJdlrcwRCzBOQIAAAAD,28a02df998eaf79f188cb59465aaea56 X-Eip: ilvqB-vMcKSqpjq0GH1tNrKxvUoC3mH3ADYY-zhrSVs Date: Thu, 3 Oct 2019 20:06:12 -0700 From: Bengt Richter To: Ludovic =?utf-8?Q?Court=C3=A8s?= Subject: Re: bug#37347: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page Message-ID: <20191004025708.GA122977@PhantoNv4ArchGx.localdomain> References: <20190909024917.19b37a23@kompiuter> <20190911225318.49617ba0@interia.pl> <87tv9c5iyn.fsf@gnu.org> <20191003195746.GA96737@PhantoNv4ArchGx.localdomain> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline In-Reply-To: <20191003195746.GA96737@PhantoNv4ArchGx.localdomain> User-Agent: Mutt/1.12.1 (2019-06-15) X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:, , definitions=2019-10-04_01:, , signatures=0 X-Proofpoint-Spam-Details: rule=notspam policy=default score=0 priorityscore=1501 malwarescore=0 suspectscore=0 phishscore=0 bulkscore=0 spamscore=0 clxscore=1034 lowpriorityscore=0 mlxscore=0 impostorscore=0 mlxlogscore=999 adultscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.0.1-1908290000 definitions=main-1910040023 X-Spam-Score: -0.5 (/) X-Debbugs-Envelope-To: 37347 Cc: Jesse Gibbons , 37347@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: Bengt Richter Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.5 (-) On +2019-10-03 12:57:46 -0700, Bengt Richter wrote: > > I could not get to that manual url: > https://guix.gnu.org/manual/en/html_node/X_002e509-Certificates.html > > Not with with lynx, nor [...] > IOW, I couldn't get to the manual. > Am I in a DNS bubble of some kind? > > If the site is just bogged down busy it shouldn't 404, right? > Nor on some auth failure -- that should be another code, right? > > Doesn't gnu.org have a little broken-link scanner for its own domain? > > Does no one else encounter access problems and broken links?? > To be clearer, the url does not 404 when lynx tries to access the manual URL -- the 404's were from broken links in another page (see previous in thread). Lynx just can't find the site for https://guix.gnu.org/manual/en/html_node/X_002e509-Certificates.html ------------------------------------------------------------ Alert!: Unable to connect to remote host. Looking up guix.gnu.org Unable to locate remote host guix.gnu.org. Alert!: Unable to connect to remote host. lynx: Can't access startfile https://guix.gnu.org/manual/en/html_node/X_002e509-Certificates.html [19:39 ~/bs]$ stack https://guix.gnu.org/manual/en/html_node/X_002e509-Certificates.html[19:39 ~/bs]$ [19:39 ~/bs]$ stack;echo https://guix.gnu.org/manual/en/html_node/X_002e509-Certificates.html [19:40 ~/bs]$ ping guix.gnu.org ping: guix.gnu.org: Name or service not known [19:40 ~/bs]$ ping gnu.org PING gnu.org (209.51.188.148) 56(84) bytes of data. ^C64 bytes from 209.51.188.148: icmp_seq=1 ttl=49 time=93.4 ms --- gnu.org ping statistics --- 1 packets transmitted, 1 received, 0% packet loss, time 0ms rtt min/avg/max/mdev = 93.404/93.404/93.404/0.000 ms [19:40 ~/bs]$ su -c 'setterm -file lynx-attempt.txt -dump 4' ------------------------------------------------------------ (stack is a little hack I use to append arbitrary strings to a datafile (with lengths on a metafile) using dd to effect push and pop etc, so I can get around not having X running all the time (mostly not :)) TIA again for clues. -- Regards, Bengt Richter From debbugs-submit-bounces@debbugs.gnu.org Fri Oct 04 03:16:02 2019 Received: (at 37347) by debbugs.gnu.org; 4 Oct 2019 07:16:02 +0000 Received: from localhost ([127.0.0.1]:41627 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iGHon-0001KU-Qk for submit@debbugs.gnu.org; Fri, 04 Oct 2019 03:16:02 -0400 Received: from mail1.fsfe.org ([217.69.89.151]:45274) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iGHom-0001K3-7n for 37347@debbugs.gnu.org; Fri, 04 Oct 2019 03:16:00 -0400 From: Jelle Licht To: Bengt Richter , Ludovic =?utf-8?Q?Court=C3=A8s?= Subject: Re: bug#37347: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page In-Reply-To: <20191004025708.GA122977@PhantoNv4ArchGx.localdomain> References: <20190909024917.19b37a23@kompiuter> <20190911225318.49617ba0@interia.pl> <87tv9c5iyn.fsf@gnu.org> <20191003195746.GA96737@PhantoNv4ArchGx.localdomain> <20191004025708.GA122977@PhantoNv4ArchGx.localdomain> Date: Fri, 04 Oct 2019 09:15:56 +0200 Message-ID: <87v9t5ouab.fsf@jlicht.xyz> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -5.0 (-----) X-Debbugs-Envelope-To: 37347 Cc: Jesse Gibbons , 37347@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -6.0 (------) Bengt Richter writes: > [snip] > ... > [19:40 ~/bs]$ ping guix.gnu.org > ping: guix.gnu.org: Name or service not known I actually have this sometimes as well. Are you on a less-than-stellar WiFi-connection perhaps? I noticed the default (nscd?) configuration on Guix systems caches 'negative' results for quite a while. Could you try this command again after issuing: `sudo herd invalidate nscd hosts'? HTH! - Jelle From debbugs-submit-bounces@debbugs.gnu.org Fri Oct 04 18:28:03 2019 Received: (at 37347) by debbugs.gnu.org; 4 Oct 2019 22:28:03 +0000 Received: from localhost ([127.0.0.1]:43560 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iGW3O-0004lG-SD for submit@debbugs.gnu.org; Fri, 04 Oct 2019 18:28:03 -0400 Received: from imta-37.everyone.net ([216.200.145.37]:34492 helo=imta-38.everyone.net) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iGW3N-0004kp-Bh for 37347@debbugs.gnu.org; Fri, 04 Oct 2019 18:28:02 -0400 Received: from pps.filterd (m0004962.ppops.net [127.0.0.1]) by imta-38.everyone.net (8.16.0.27/8.16.0.27) with SMTP id x94MQ3OP008820; Fri, 4 Oct 2019 15:27:59 -0700 X-Eon-Originating-Account: bS-5so0gIzOG3jU5zPrhuCG8ng_0zCn4tThwJFrwg7Q X-Eon-Dm: m0116953.ppops.net Received: by m0116953.mta.everyone.net (EON-AUTHRELAY2 - 32d0d199) id m0116953.5d978780.41b3; Fri, 4 Oct 2019 15:27:57 -0700 X-Eon-Sig: AQMHrIJdl8dtVPSRcQIAAAAE,e751ec95a449189a120e5df4c29d55aa X-Eip: svTQzbFDX5Tcl0EEkWzHs13zCsRSvFRSUULaWJBtJkI Date: Fri, 4 Oct 2019 15:27:47 -0700 From: Bengt Richter To: Jelle Licht Subject: Re: bug#37347: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page Message-ID: <20191004222747.GA18281@PhantoNv4ArchGx.localdomain> References: <20190909024917.19b37a23@kompiuter> <20190911225318.49617ba0@interia.pl> <87tv9c5iyn.fsf@gnu.org> <20191003195746.GA96737@PhantoNv4ArchGx.localdomain> <20191004025708.GA122977@PhantoNv4ArchGx.localdomain> <87v9t5ouab.fsf@jlicht.xyz> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline In-Reply-To: <87v9t5ouab.fsf@jlicht.xyz> User-Agent: Mutt/1.12.1 (2019-06-15) X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:, , definitions=2019-10-04_13:, , signatures=0 X-Proofpoint-Spam-Details: rule=notspam policy=default score=0 priorityscore=1501 malwarescore=0 suspectscore=0 phishscore=0 bulkscore=0 spamscore=0 clxscore=1034 lowpriorityscore=0 mlxscore=0 impostorscore=0 mlxlogscore=999 adultscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.0.1-1908290000 definitions=main-1910040188 X-Spam-Score: -0.5 (/) X-Debbugs-Envelope-To: 37347 Cc: Ludovic =?utf-8?Q?Court=C3=A8s?= , Jesse Gibbons , 37347@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: Bengt Richter Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.5 (-) On +2019-10-04 09:15:56 +0200, Jelle Licht wrote: > Bengt Richter writes: > > > [snip] > > ... > > [19:40 ~/bs]$ ping guix.gnu.org > > ping: guix.gnu.org: Name or service not known > I actually have this sometimes as well. Are you on a less-than-stellar > WiFi-connection perhaps? I noticed the default (nscd?) configuration on > Guix systems caches 'negative' results for quite a while. > > Could you try this command again after issuing: > `sudo herd invalidate nscd hosts'? > > HTH! > - Jelle Hi Jelle, thanks for your reply. I am a grateful courtesy guest sharer of internet access in a small office complex via cat5 to their switches, so it should not be a WiFi problem. I get DNS automatically along with ip from their server dhcp, but I have other options I could explore. I can't try the herd command right now, as I am in strictly "foreign" mode at the moment. --Ignorable note about that: (I am busy making a ~/.my_login_ctl.d that will contain the means to log in with and without guix profiles visible, and PATH etc set alternately. The idea is so I can just use touch to select features implemented as files to be sourced from ~/.my_login_ctl.d/my_login_ctl which I'll call from ~/.bash_profile. (~/.bashrc is also modified), and then log in and get guix and Shepherd/herd etc -- or not. I'm hoping this will help me debug differences between plain ArchLinux and the latter with guix binarily installed, with and w/o Shepherd/herd also. as I don't expect my problems of /usr vs /gnu to go away for a while :-) BTW, I don't want to define a whole different /home/me_for_alternate_mode, I want to switch from console to console with Alt-Fx and start a new mode at worst by touching a file or two and logging out and logging back in.) --Ignorable note about that:-- If the ip number to guix.gnu.org is fixed and public, maybe I could try putting it in /etc/hosts ? If there is no objection, I'd like to try that. TIA if posting the ip number, or explaining why not ;-) -- Regards, Bengt Richter From debbugs-submit-bounces@debbugs.gnu.org Sat Oct 05 08:58:36 2019 Received: (at 37347) by debbugs.gnu.org; 5 Oct 2019 12:58:36 +0000 Received: from localhost ([127.0.0.1]:43907 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iGjdr-0003Ms-Q2 for submit@debbugs.gnu.org; Sat, 05 Oct 2019 08:58:36 -0400 Received: from wout4-smtp.messagingengine.com ([64.147.123.20]:38815) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iGjdp-0003Me-T9 for 37347@debbugs.gnu.org; Sat, 05 Oct 2019 08:58:34 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.west.internal (Postfix) with ESMTP id 02757469; Sat, 5 Oct 2019 08:58:27 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Sat, 05 Oct 2019 08:58:28 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm1; bh=6wf+ZtmRWOSnv2cDF2Xt9OyPBb sEXw0CjKN+VC6qLn4=; b=s7Aq0HrdQEuRexiGkuUSFk1ESCUP8PgHedyZlCdnfJ 0HpLidczdFBO99ENzMuhMrasB4X6+YGVpQGAp7I8/rz+LpQgsH7lAt04NEe+FQzU uBsNWF+aohUUFpAmO+u5NVKqlNetNcNit2RMBqZLghG3zLsyPCk/bPFCS1MuqKsQ Uj0z/Gm5CY6wN4Or4jXTxmNENTdBN+JcGBebR6iSzM6nMQnwUlB8sKwl0BRu92OF 27CKmtOpE0N7Zj1JOeToLSRtS/QsTDYju2zOpchsKtQk8ufdz4QeAn8KIsCLZi/o NOJDxeCRT1jY0P+KVcEYwc8RkzVVALGtHhLHFxeNlrbA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=6wf+Zt mRWOSnv2cDF2Xt9OyPBbsEXw0CjKN+VC6qLn4=; b=Xl/NhPq33xRSOlJwfm2/Bv s3/kBUPoq8sYzvXMW7klvfLAnjp+lKo89C9ZKK2Rzwgil9/iAdnFNE1iCfZ+LOlf qQFS6O0I/F93+lbgkj+RKlTY5mhpEegY0RoxGmoZmZCoBqjFMV/JX9Du6XEXfO1n GxykoA0SBvo6m/ZdxBxreoyL/OzFNNrudNAgIbD1+loqDCX9N9IAonPwGqyi3Xwv 81K1jr0e3z4NXOLEL51yCnIdQX2wB7TYoWdm/wkWdyYZsNsl2KAVFmeDOzjlvOhH 1hFsCMpnFZqTSWa5AUAVskpHZh0E/hHpu8cE/0dos5w61QtSCAaWWBZxqrf2YHEQ == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedufedrheefgdehkecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenuc fjughrpefhvffujghffgffkfggtgesghdtreertdertdenucfhrhhomhepofgrrhhiuhhs uceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheqnecuffhomhgrih hnpehgihhthhhusgdrtghomhdpghhnuhdrohhrghenucfkphepiedvrdduiedrudelvddr udehtdenucfrrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrghilh drtghomhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (ti0006q161-0149.bb.online.no [62.16.192.150]) by mail.messagingengine.com (Postfix) with ESMTPA id 1AE68D6005A; Sat, 5 Oct 2019 08:58:26 -0400 (EDT) From: Marius Bakke To: Bengt Richter , Jelle Licht Subject: Re: bug#37347: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page In-Reply-To: <20191004222747.GA18281@PhantoNv4ArchGx.localdomain> References: <20190909024917.19b37a23@kompiuter> <20190911225318.49617ba0@interia.pl> <87tv9c5iyn.fsf@gnu.org> <20191003195746.GA96737@PhantoNv4ArchGx.localdomain> <20191004025708.GA122977@PhantoNv4ArchGx.localdomain> <87v9t5ouab.fsf@jlicht.xyz> <20191004222747.GA18281@PhantoNv4ArchGx.localdomain> User-Agent: Notmuch/0.29.1 (https://notmuchmail.org) Emacs/26.2 (x86_64-pc-linux-gnu) Date: Sat, 05 Oct 2019 14:58:25 +0200 Message-ID: <87o8yv73im.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 37347 Cc: Jesse Gibbons , 37347@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable Bengt Richter writes: > On +2019-10-04 09:15:56 +0200, Jelle Licht wrote: >> Bengt Richter writes: >>=20 >> > [snip] >> > ... >> > [19:40 ~/bs]$ ping guix.gnu.org >> > ping: guix.gnu.org: Name or service not known >> I actually have this sometimes as well. Are you on a less-than-stellar >> WiFi-connection perhaps? I noticed the default (nscd?) configuration on >> Guix systems caches 'negative' results for quite a while. >>=20 >> Could you try this command again after issuing: >> `sudo herd invalidate nscd hosts'? >>=20 >> HTH! >> - Jelle > > Hi Jelle, thanks for your reply. > > I am a grateful courtesy guest sharer of internet access in > a small office complex via cat5 to their switches, so it should > not be a WiFi problem. > > I get DNS automatically along with ip from their server dhcp, > but I have other options I could explore. > > I can't try the herd command right now, as I am in strictly "foreign" > mode at the moment. If you are using systemd, perhaps you are hitting ? Does it work if you create /etc/resolv.conf with a "nameserver x.x.x.x" entry? --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl2Yk3EACgkQoqBt8qM6 VPouZQgAiTmiAQ3sc/4Dxx0NXFZRYt45IwqoVzI+x6psSADrlAEcBuBgAO5qTIpL AdCFrzR2EbkXHuDhAuRRi+8KreSyfjn/60d+mrGr7WSmZNILhRW6KTQ9jM4zoKoT 7oluudNYnFJkLmsp8fxaKMFa9chv29Z5IulZczS9Aqq9I+yEVgTA97RRlGSy84kl 06d/u2QAwthwx7hfSUxCms5jXUuVlifpGsKqtZG4/PIeFTB4mgA8t70k8YBy2p9W uvAwkU4lkEzDKXN/JrCXsO/9QrhsI07oDDJWzi80H5iyil+DSj+mZtRrrkzsjcU3 d9NUhEVW12am9v44VLmjPV6cb8z7bw== =qHpd -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sun Oct 06 15:00:57 2019 Received: (at 37347) by debbugs.gnu.org; 6 Oct 2019 19:00:57 +0000 Received: from localhost ([127.0.0.1]:46876 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iHBm5-00028I-3s for submit@debbugs.gnu.org; Sun, 06 Oct 2019 15:00:57 -0400 Received: from smtpo.poczta.interia.pl ([217.74.65.208]:33036) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iHBm2-000283-Pr for 37347@debbugs.gnu.org; Sun, 06 Oct 2019 15:00:56 -0400 X-Interia-R: Interia X-Interia-R-IP: 89.64.25.186 X-Interia-R-Helo: Received: from kompiuter (89-64-25-186.dynamic.chello.pl [89.64.25.186]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (No client certificate requested) by poczta.interia.pl (INTERIA.PL) with ESMTPSA; Sun, 6 Oct 2019 21:00:46 +0200 (CEST) Date: Sun, 6 Oct 2019 21:00:36 +0200 From: Jan Wielkiewicz To: Ludovic =?UTF-8?B?Q291cnTDqHM=?= Subject: Re: bug#37347: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page Message-ID: <20191006210036.6ca2d868@kompiuter> In-Reply-To: <87tv9c5iyn.fsf@gnu.org> References: <20190909024917.19b37a23@kompiuter> <20190911225318.49617ba0@interia.pl> <87tv9c5iyn.fsf@gnu.org> X-Mailer: Claws Mail 3.14.1 (GTK+ 2.24.31; x86_64-pc-linux-gnu) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Interia-Antivirus: OK DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=interia.pl; s=biztos; t=1570388448; bh=xsal7xPuEIOrPxlXOA4fp+dKB3MC6eH/ippy82/bnAY=; h=X-Interia-R:X-Interia-R-IP:X-Interia-R-Helo:Date:From:To:Cc: Subject:Message-ID:In-Reply-To:References:X-Mailer:MIME-Version: Content-Type:Content-Transfer-Encoding:X-Interia-Antivirus; b=PEmqSaKy9yrUTAHeypNRmyZh+3h1kBodNz7QfWAC03ClD5Oi7SWWWRGQvf9jPpLs5 /q6yNPXFGiIFd0E1g4yttciUAYc5oNwwRDNYBAOVZPcT/g3zCZwtGIPXYSyFWp6uJc hHdTWlpn+dwbdwNfeDmzNS3pd8iDSCNxhT5hD9kc= X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 37347 Cc: Julien Lepiller , Jesse Gibbons , 37347@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Okay, never mind. Running "guix environment guix" instead of "guix environment guix --pure" lets preserve the environment variables needed for X.509 certificates to be available for git in the environment. If that's not the correct way of doing this please let me know, but now I'm able to run "guix refresh", so the issue can be closed. Thank you all for suggestions. Jan Wielkiewicz From debbugs-submit-bounces@debbugs.gnu.org Thu Oct 24 16:16:48 2019 Received: (at 37347-done) by debbugs.gnu.org; 24 Oct 2019 20:16:48 +0000 Received: from localhost ([127.0.0.1]:36981 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iNjXL-0002sk-Ts for submit@debbugs.gnu.org; Thu, 24 Oct 2019 16:16:48 -0400 Received: from mail-ed1-f42.google.com ([209.85.208.42]:34226) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1iNjXJ-0002sW-My for 37347-done@debbugs.gnu.org; Thu, 24 Oct 2019 16:16:46 -0400 Received: by mail-ed1-f42.google.com with SMTP id b72so68648edf.1 for <37347-done@debbugs.gnu.org>; Thu, 24 Oct 2019 13:16:45 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:from:date:message-id:subject:to; bh=ZvSQFg4fFtte3FHIrJfsaev5fkRemOdfVgsligIxd3U=; b=rpIZQzfLYjYIUnxIWUd8CKK7t5usrFtWKcPJOIM/wNUA/IDBNe7x8dN6f1xhMZXnQY nynYbp5jd8esyzTIX2PAvYkxz99hyd3QUDt+BqYNnr2GO3N0NyfRkl9r/LB3YtiRKeBu SgatmYoye9JEQCPgYODI0zJGOKgfoQYWqS7oV/OzOGb1bcqDjeHhrQ3lJM2X/TpaHqH4 /N/dx3JMwIACpRX5FDHGjZpnYUCfz4w169C4nd9pns+mBruAzYhejSBdQIPqZiDteU3u ANCzYROV7UPN2GsasjPKniLqbtoOuD/qMgc9Dty34xLOtiizShUOBO5j4pN5JZRgMtKC 6w2A== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=ZvSQFg4fFtte3FHIrJfsaev5fkRemOdfVgsligIxd3U=; b=rmt1drl6ZTR13OgSK44pohWhkDioBFp1GqE3VJc7wBHVqQzMPAAKF9mFHWgp7aXjLH He3vEpZvATLPdlURotkYN3m/5QNhXW6Ti4y04FEkyO8CUMgWZnbqvbq67hUqBfqEqVT0 hKO6ILMlT/sOCJWK/vGTn6JlYryTrUYCYY6x37feaFBeTWUn+FQSNu2UT6aaxJA7M/R0 Nuwmhk9CRAInurigbVGSPf9dQKLByKXTNwkgaVtTbk1s+xEZ/5ghwuBrugocSXVxnB3v xNOrgHZxAPYYg5i3+DoN2WwW4RLKNVnlcc0I9uJSLlGI2uTWw0HOlQsGVqrfOIQdFOlb YIBQ== X-Gm-Message-State: APjAAAW+D1ko5r1YcN+Dvgw6sGvTOkeb6GRJ++dwgglf3X0rOE8VA1GR qXJeOSWYUi7xNhvA5s0esCR85QX0dLl2lDmnsTSa X-Google-Smtp-Source: APXvYqx5oOu9x+ljDllThVXXbunz+BoAzFRwjcLB/TXA8+J8PwZo7ysPLj+x1BcB2v+0lVicQcYZUzWlgSJTiEfljmU= X-Received: by 2002:a50:af44:: with SMTP id g62mr19073edd.164.1571948199428; Thu, 24 Oct 2019 13:16:39 -0700 (PDT) MIME-Version: 1.0 From: =?UTF-8?Q?G=C3=A1bor_Boskovits?= Date: Thu, 24 Oct 2019 20:16:26 +0000 Message-ID: Subject: 'guix environment' fails after trying to follow the steps from "Running Guix Before It Is Installed" page To: 37347-done@debbugs.gnu.org Content-Type: multipart/alternative; boundary="0000000000000845760595adb692" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 37347-done X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --0000000000000845760595adb692 Content-Type: text/plain; charset="UTF-8" The submitter solved the problem, and requested to close. Closing. -- OpenPGP Key Fingerprint: 7988:3B9F:7D6A:4DBF:3719:0367:2506:A96C:CF63:0B21 --0000000000000845760595adb692 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
The submitter solved the problem, and requested to close. = Closing.

--
OpenPGP Key F= ingerprint: 7988:3B9F:7D6A:4DBF:3719:0367:2506:A96C:CF63:0B21
--0000000000000845760595adb692-- From unknown Wed Jun 18 23:05:31 2025 Received: (at fakecontrol) by fakecontrolmessage; To: internal_control@debbugs.gnu.org From: Debbugs Internal Request Subject: Internal Control Message-Id: bug archived. Date: Fri, 22 Nov 2019 12:24:07 +0000 User-Agent: Fakemail v42.6.9 # This is a fake control message. # # The action: # bug archived. thanks # This fakemail brought to you by your local debbugs # administrator