From debbugs-submit-bounces@debbugs.gnu.org Wed May 01 05:20:29 2019 Received: (at submit) by debbugs.gnu.org; 1 May 2019 09:20:29 +0000 Received: from localhost ([127.0.0.1]:43369 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hLlPg-0002sU-N0 for submit@debbugs.gnu.org; Wed, 01 May 2019 05:20:28 -0400 Received: from eggs.gnu.org ([209.51.188.92]:60821) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hLlPf-0002sF-7s for submit@debbugs.gnu.org; Wed, 01 May 2019 05:20:27 -0400 Received: from lists.gnu.org ([209.51.188.17]:58970) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1hLlPa-0000gt-2J for submit@debbugs.gnu.org; Wed, 01 May 2019 05:20:22 -0400 Received: from eggs.gnu.org ([209.51.188.92]:46971) by lists.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1hLlPW-0007Gv-T2 for bug-guix@gnu.org; Wed, 01 May 2019 05:20:21 -0400 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1hLlPT-0000c1-SR for bug-guix@gnu.org; Wed, 01 May 2019 05:20:18 -0400 Received: from world.peace.net ([64.112.178.59]:52750) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1hLlPT-0000bs-PP for bug-guix@gnu.org; Wed, 01 May 2019 05:20:15 -0400 Received: from mhw by world.peace.net with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.89) (envelope-from ) id 1hLlPR-0005Zl-UN; Wed, 01 May 2019 05:20:14 -0400 From: Mark H Weaver To: bug-guix@gnu.org Subject: Mariadb test suite failures on x86_64-linux Date: Wed, 01 May 2019 05:18:31 -0400 Message-ID: <87tveemt19.fsf@netris.org> MIME-Version: 1.0 Content-Type: text/plain X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Received-From: 64.112.178.59 X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.6.x X-Spam-Score: -1.3 (-) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.3 (--) hydra.gnunet.org has failed to build mariadb on x86_64-linux twice in a row: https://hydra.gnu.org/build/3475081#tabs-buildsteps The same test failed both times: > Failure: Failed 1/5075 tests, 99.98% were successful. > > Failing test(s): tokudb_alter_table.hcad_all_add The same build also failed twice in a row on my Thinkpad X200, and with the same error each time, although it's a different error than happens on hydra.gnunet.org. On my X200, I get this instead: > Failure: Failed 1/1091 tests, 99.91% were successful. > > Failing test(s): tokudb_bugs.mdev4533 hydra.gnunet.org successfully built mariadb for i686-linux on its first attempt: https://hydra.gnu.org/build/3473640 Here's the coresponding armhf-linux build, which has not yet been attempted as I write this: https://hydra.gnu.org/build/3481309 Mark From debbugs-submit-bounces@debbugs.gnu.org Wed May 01 05:49:22 2019 Received: (at 35521) by debbugs.gnu.org; 1 May 2019 09:49:22 +0000 Received: from localhost ([127.0.0.1]:43395 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hLlre-0003Xs-Fe for submit@debbugs.gnu.org; Wed, 01 May 2019 05:49:22 -0400 Received: from world.peace.net ([64.112.178.59]:42732) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hLlrc-0003Xe-2X for 35521@debbugs.gnu.org; Wed, 01 May 2019 05:49:20 -0400 Received: from mhw by world.peace.net with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.89) (envelope-from ) id 1hLlrW-0005s6-Ci; Wed, 01 May 2019 05:49:14 -0400 From: Mark H Weaver To: 35521@debbugs.gnu.org Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux References: <87tveemt19.fsf@netris.org> Date: Wed, 01 May 2019 05:47:32 -0400 In-Reply-To: <87tveemt19.fsf@netris.org> (Mark H. Weaver's message of "Wed, 01 May 2019 05:18:31 -0400") Message-ID: <87h8aemrow.fsf@netris.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.2 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 35521 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Mark H Weaver writes: > The same build also failed twice in a row on my Thinkpad X200, and with > the same error each time, although it's a different error than happens > on hydra.gnunet.org. On my X200, I get this instead: > >> Failure: Failed 1/1091 tests, 99.91% were successful. >> >> Failing test(s): tokudb_bugs.mdev4533 and it just failed a third time on my X200, again with the same error. Mark From debbugs-submit-bounces@debbugs.gnu.org Thu May 09 22:24:46 2019 Received: (at 35521) by debbugs.gnu.org; 10 May 2019 02:24:46 +0000 Received: from localhost ([127.0.0.1]:36810 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hOvDJ-0000d2-Dp for submit@debbugs.gnu.org; Thu, 09 May 2019 22:24:46 -0400 Received: from mail-40135.protonmail.ch ([185.70.40.135]:62770) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hOuQF-0007p7-L0 for 35521@debbugs.gnu.org; Thu, 09 May 2019 21:34:05 -0400 Date: Fri, 10 May 2019 01:33:50 +0000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=protonmail.com; s=default; t=1557452036; bh=pJXvPJAAgg6pUJtQ+aJw2ErTN/ZPuxhYG8iMiTIKBi4=; h=Date:To:From:Reply-To:Subject:Feedback-ID:From; b=okZcGtbSfiR2/VF2mxYCWgkGgjk1U8PbUrVcfFUy3G4N3fMDNMEwtaFI/3YgDlibY T+fF9zOvrXwqdEIUKIBd3qtbKr9JRl62ZP/Zusoaq0gsWJXiIk/Ul2xx3xeM/aY5X4 wqFmYVuAV5+bBgf75nB5ba1AR3Bg4B+BJUgxbHMM= To: "35521@debbugs.gnu.org" <35521@debbugs.gnu.org> From: Platoxia Subject: /gnu/store/c46sn2yfllcfi86p8227wvvr1bxssgxj-mariadb-10.1.38.drv - Failing test(s): tokudb_alter_table.hcad_all_add Message-ID: Feedback-ID: 0yxiSOZXeHDIocGT1m5tiiGAKZShNCw3Tn-XKDFBM1XGz_yTuaJeA15CaQaqRLymiGlnvyN-RcTKgVFeQ0fJlg==:Ext:ProtonMail MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Spam-Status: No, score=-0.2 required=7.0 tests=ALL_TRUSTED,BOMB_FREEM, DKIM_SIGNED,DKIM_VALID,DKIM_VALID_AU,DKIM_VALID_EF,FREEMAIL_FROM autolearn=no autolearn_force=no version=3.4.2 X-Spam-Checker-Version: SpamAssassin 3.4.2 (2018-09-13) on mail.protonmail.ch X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 35521 X-Mailman-Approved-At: Thu, 09 May 2019 22:24:44 -0400 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Reply-To: Platoxia Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) This problem persists and is preventing sucessful completion of guix system= reconfigure for pre-1.0.0 systems (at least mine which is still at kernel = 4.20), not only for those using mariadb but also for anyone using any of th= e 544 packages that depend on it; as per the command guix graph --type=3Dre= verse-package mariadb | grep -c label). This could, potentially, be fixed by simply adding this test to the list of= disabled tests in the package definition: --- snip --- (add-after 'unpack 'adjust-tests (lambda _ (let ((disabled-tests '(;; These fail because root@hostname =3D=3D root@local= host in ;; the build environment, causing a user count mismat= ch. ;; See . "main.join_cache" "main.explain_non_select" "main.stat_tables_innodb" "roles.acl_statistics" ;; This file contains a time bomb which makes it fail= after ;; 2030-12-31. See for = details. "main.mysqldump" ;; XXX: Fails sporadically. "innodb_fts.crash_recovery" ;; FIXME: This test fails on i686: ;; -myisampack: Can't create/write to file (Errcode: = 17 "File exists") ;; +myisampack: Can't create/write to file (Errcode: = 17 "File exists) ;; When running "myisampack --join=3Dfoo/t3 foo/t1 fo= o/t2" ;; (all three tables must exist and be identical) ;; in a loop it produces the same error around 1/240 = times. ;; montywi on #maria suggested removing the real_end = check in ;; "strings/my_vsnprintf.c" on line 503, yet it still= does not ;; reach the ending quote occasionally. Disable it f= or now. "main.myisampack" ;; FIXME: This test fails on armhf-linux: "mroonga/storage.index_read_multiple_double")) ;; This file contains a list of known-flaky tests for th= is ;; release. Append our own items. (unstable-tests (open-file "mysql-test/unstable-tests" "= a"))) (for-each (lambda (test) (format unstable-tests "~a : ~a\n" test "Disabled in Guix")) disabled-tests) (close-port unstable-tests) --- snip --- I say "potentially" because after getting this failure I happened to notice= that approximately one and a half minutes after beginning the build of /gn= u/store/c46sn2yfllcfi86p8227wvvr1bxssgxj-mariadb-10.1.38.drv the kernel thr= ows this message: "traps: cmTC_35af5[27766] trap invalid opcode ip:55555555= 5174 sp:7fffffffcc90 error:0 in cmTC_35af5[555555555000+1000]". I have retested this several times and confirmed that this occurs each and = every time mariadb-10.1.38.drv tries to build and in approximately the same= amount of time after starting the build. I say approximately because the c= losest I could get to a timeframe on this kernel message in relation to the= mariadb build is by sending the stdout from guix system reconfigure throug= h logger so that it gets printed with a timestamp to the kernel messages te= rminal (alt-F12). Specifically, the message sequence is always as follows, without deviation = (other than the cmTC_#), with no related messages in between; as per the co= mmand cat /dev/vcs12: --- snip --- May 9 16:36:35 localhost root cmd: guix system reconfigure: building /gnu/= store/c46sn2yfllcfi86p8227wvvr1bxssgxj-mariadb-10.1.38.drv... May 9 16:38:08 localhost vmunix: [ 9169.050496] traps: cmTC_35af5[27766] t= rap invalid opcode ip:555555555174 sp:7fffffffcc90 error:0 in cmTC_35af5[55= 5555555000+1000] --- snip --- I really suggest trying to simply add the tokudb_alter_table.hcad_all_add t= est to the package definition before trying to solve the overall problem, t= hough. Maybe we can get this in for 1.0.1? I would be willing to do this myself and report the results here but I'm ba= ffled at how to achieve this simple task. Perhaps someone could walk me thr= ough it? From debbugs-submit-bounces@debbugs.gnu.org Wed Jul 10 02:19:25 2019 Received: (at 35521) by debbugs.gnu.org; 10 Jul 2019 06:19:25 +0000 Received: from localhost ([127.0.0.1]:34751 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hl5wj-0001Rw-Hq for submit@debbugs.gnu.org; Wed, 10 Jul 2019 02:19:25 -0400 Received: from mail-pf1-f195.google.com ([209.85.210.195]:32924) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hl5wf-0001Rf-L9 for 35521@debbugs.gnu.org; Wed, 10 Jul 2019 02:19:15 -0400 Received: by mail-pf1-f195.google.com with SMTP id g2so588805pfq.0 for <35521@debbugs.gnu.org>; Tue, 09 Jul 2019 23:19:13 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:to:cc:subject:references:date:in-reply-to:message-id :user-agent:mime-version; bh=9izEX1JIoJ7HQM7c3IcN4NOv8F82u/FN7ZgLtQo+lIU=; b=WdISenUEPq+o+nASpCeCzivSmeWk3MXlYJfXwCUyvICqSPij0shzhQLQslzBR2vOq2 Z++/LbB42Nnp/qSl2FZB2npeDzaf3xv9Zw1VBSAHqH0YvZhRRAQ0acnESyNLFeCnO0BD VAlXcY3xc3VVyQaddA3eKby+klVdYXd1xmTAsXynIivquE3thLW6iwcjP0B+R2SDZzbQ tvDGAWNxmnmY4BOlEQ8cCQVpbeOk9AXFQ6TN0qBu5IGuRipXS66HXtw2drOZZh0ehXu9 qnq9qNigqm3gIzd3T56SSZZvtbfT7xCAR12azV6I4ZAOYn7oLSHeFODbHP7kklBHFL0N ULYg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:to:cc:subject:references:date:in-reply-to :message-id:user-agent:mime-version; bh=9izEX1JIoJ7HQM7c3IcN4NOv8F82u/FN7ZgLtQo+lIU=; b=LpUPbs60W71WtcK39bi5xxLBXUdzmAtPiJ878jd0XD9jBnzV8uCBa70b4yvnxNb+Nu Tg7dGtealBIVZu05/IhLllrNugIb9FEtMqhLiJn6cm4CGZRJ//rbIUgBsxaNIoFC+CPY /LjdXO206sUqvHwRntocICsh5m259cO00Y50y1h6m0tpI0YkS5LLPv8yzvW0oBzLAaHu epn3Aalktw/VNioyiY6IOkbTvk9KzQeL/pwHieDgjmOZ8d+HeBT0AP3Zf55hNPacOjfE yl4LEVaL5fZfaKk0eucAO4/4Cp8sfUQjVw7wTo5+kzhgflIPuSWDMoW8VNpPK1xBCzl1 w9xQ== X-Gm-Message-State: APjAAAU88WhKfxPsUr3S125nTBSFiH2GZjENkx3RMTcU7yWd+N/dzSd2 PumZkNUjNTavz3VDM5kso97gagsA X-Google-Smtp-Source: APXvYqzYsrcgk/Mkpg6tzH5E7RhEGnfvXz5OkyjZDh7afNT0rPe7bAXPFnBS4AO2g2cfpjSFildIAA== X-Received: by 2002:a63:5451:: with SMTP id e17mr19690816pgm.363.1562739546810; Tue, 09 Jul 2019 23:19:06 -0700 (PDT) Received: from garuda.local ([2601:601:9d80:25b2::d12]) by smtp.gmail.com with ESMTPSA id j1sm2109528pgl.12.2019.07.09.23.19.04 (version=TLS1_2 cipher=ECDHE-RSA-CHACHA20-POLY1305 bits=256/256); Tue, 09 Jul 2019 23:19:04 -0700 (PDT) From: Chris Marusich To: Mark H Weaver , Platoxia Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> Date: Tue, 09 Jul 2019 23:18:57 -0700 In-Reply-To: <87h8aemrow.fsf@netris.org> (Mark H. Weaver's message of "Wed, 01 May 2019 05:47:32 -0400, Fri, 10 May 2019 01:33:50 +0000") Message-ID: <87pnmil8dq.fsf_-_@gmail.com> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha256; protocol="application/pgp-signature" X-Spam-Score: 1.3 (+) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Hi, I've been encountering this failure off and on for a few weeks now, and I'd like to help fix it. In short, it seems like non-deterministic test failures, to me. I think we should gather data and repor [...] Content analysis details: (1.3 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: gnu.org] -0.0 RCVD_IN_DNSWL_NONE RBL: Sender listed at https://www.dnswl.org/, no trust [209.85.210.195 listed in list.dnswl.org] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider (cmmarusich[at]gmail.com) 0.0 SPF_HELO_NONE SPF: HELO does not publish an SPF Record 0.0 RCVD_IN_MSPIKE_H3 RBL: Good reputation (+3) [209.85.210.195 listed in wl.mailspike.net] 0.0 RCVD_IN_MSPIKE_WL Mailspike good senders 1.3 PDS_NO_HELO_DNS High profile HELO but no A record X-Debbugs-Envelope-To: 35521 Cc: 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.3 (/) --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable Hi, I've been encountering this failure off and on for a few weeks now, and I'd like to help fix it. In short, it seems like non-deterministic test failures, to me. I think we should gather data and report the issue upstream, and maybe disable the offending tests in the meantime. Mariadb failed for me earlier today with a different error than the ones observed in this bug report so far. My error was the following (when building mariadb 10.1.40 on an x86_64-linux system using Guix 9b2644c): Failure: Failed 1/1990 tests, 99.95% were successful. Failing test(s): tokudb_bugs.5733_innodb The log files in var/log may give you some hint of what went wrong. If you want to report this error, please read first the documentation at http://dev.mysql.com/doc/mysql/en/mysql-test-suite.html 558 tests were skipped, 169 by the test itself I kept the failed build directory, but there is no "var" directory to be found there. I guess they meant system logs; I am not sure where such logs would go when emitted from within a derivation. The MySQL website suggested running mysql-test-run.pl with the --force option, which I casually tried after invoking ". environment-variables" from the failed build directory; however, it promptly failed because it could not find 'my_safe_process' - maybe I didn't have everything set up just so to run the tests manually. Curiously, on a different x86_64-linux machine, using Guix commit 6c83c48 (which is only a few commits ahead of 9b2644c), I was able to build mariadb successfully, although I am not sure when I built it (running "guix build mariadb" currently results in quick success for me, so on this machine I probably built or substituted it some time ago). The derivation (without grafts) was identical to the one that failed to build on the other machine, which is strange because I would normally expect the same derivation to succeed on both machines. For the record, this was the derivation: $ guix build --no-grafts -d mariadb /gnu/store/9yw33r8r84qrsic7fiq0lqqkbzisv1cj-mariadb-10.1.40.drv Perhaps these tests fail non-deterministically? Or perhaps they fail in a way that is specific something not isolated from the build process by Guix, such as the kernel, the file system, or the hardware? I tried to check the status of mariadb in Cuirass. However, I only found the following information: https://ci.guix.gnu.org/search?query=3Dmariadb-10.1.40 For x86_64-linux, build 1304242 supposedly failed at 10 May 20:32 +0200 after about 3 hours of runtime: https://ci.guix.gnu.org/build/1304242/details I say "supposedly failed" because I'm not sure why it failed. The build log seems to indicate no problems: https://ci.guix.gnu.org/build/1304242/log/raw Has Cuirass tried to build mariadb since then? May 10th was a long time ago, and I am surprised there is not another build of it from master. Mark H Weaver writes: > Mark H Weaver writes: > >> The same build also failed twice in a row on my Thinkpad X200, and with >> the same error each time, although it's a different error than happens >> on hydra.gnunet.org. On my X200, I get this instead: >> >>> Failure: Failed 1/1091 tests, 99.91% were successful. >>>=20 >>> Failing test(s): tokudb_bugs.mdev4533 > > and it just failed a third time on my X200, again with the same error. It seems like the tests may be flaky. The test failure I saw was different from yours. And in my case, I actually was able to build (or substitute) mariadb once. So maybe what we need to do is gather enough data to report the problem upstream, to enlist their help? Platoxia writes: > This problem persists and is preventing sucessful completion of guix syst= em reconfigure for pre-1.0.0 systems (at least mine which is still at kerne= l 4.20), not only for those using mariadb but also for anyone using any of = the 544 packages that depend on it; as per the command guix graph --type=3D= reverse-package mariadb | grep -c label). > > This could, potentially, be fixed by simply adding this test to the list = of disabled tests in the package definition: > > --- snip --- > (add-after 'unpack 'adjust-tests > (lambda _ > (let ((disabled-tests > '(;; These fail because root@hostname =3D=3D root@loc= alhost in > ;; the build environment, causing a user count mism= atch. > ;; See . > "main.join_cache" > "main.explain_non_select" > "main.stat_tables_innodb" > "roles.acl_statistics" > > ;; This file contains a time bomb which makes it fa= il after > ;; 2030-12-31. See fo= r details. > "main.mysqldump" > > ;; XXX: Fails sporadically. > "innodb_fts.crash_recovery" > > ;; FIXME: This test fails on i686: > ;; -myisampack: Can't create/write to file (Errcode= : 17 "File exists") > ;; +myisampack: Can't create/write to file (Errcode= : 17 "File exists) > ;; When running "myisampack --join=3Dfoo/t3 foo/t1 = foo/t2" > ;; (all three tables must exist and be identical) > ;; in a loop it produces the same error around 1/24= 0 times. > ;; montywi on #maria suggested removing the real_en= d check in > ;; "strings/my_vsnprintf.c" on line 503, yet it sti= ll does not > ;; reach the ending quote occasionally. Disable it= for now. > "main.myisampack" > ;; FIXME: This test fails on armhf-linux: > "mroonga/storage.index_read_multiple_double")) > > ;; This file contains a list of known-flaky tests for = this > ;; release. Append our own items. > (unstable-tests (open-file "mysql-test/unstable-tests"= "a"))) > (for-each (lambda (test) > (format unstable-tests "~a : ~a\n" > test "Disabled in Guix")) > disabled-tests) > (close-port unstable-tests) > --- snip --- > > I say "potentially" because after getting this failure I happened to noti= ce that approximately one and a half minutes after beginning the build of /= gnu/store/c46sn2yfllcfi86p8227wvvr1bxssgxj-mariadb-10.1.38.drv the kernel t= hrows this message: "traps: cmTC_35af5[27766] trap invalid opcode ip:555555= 555174 sp:7fffffffcc90 error:0 in cmTC_35af5[555555555000+1000]". > > I have retested this several times and confirmed that this occurs each an= d every time mariadb-10.1.38.drv tries to build and in approximately the sa= me amount of time after starting the build. I say approximately because the= closest I could get to a timeframe on this kernel message in relation to t= he mariadb build is by sending the stdout from guix system reconfigure thro= ugh logger so that it gets printed with a timestamp to the kernel messages = terminal (alt-F12). > > Specifically, the message sequence is always as follows, without deviatio= n (other than the cmTC_#), with no related messages in between; as per the = command cat /dev/vcs12: > > --- snip --- > May 9 16:36:35 localhost root cmd: guix system reconfigure: building /gn= u/store/c46sn2yfllcfi86p8227wvvr1bxssgxj-mariadb-10.1.38.drv... > May 9 16:38:08 localhost vmunix: [ 9169.050496] traps: cmTC_35af5[27766]= trap invalid opcode ip:555555555174 sp:7fffffffcc90 error:0 in cmTC_35af5[= 555555555000+1000] > --- snip --- > > I really suggest trying to simply add the tokudb_alter_table.hcad_all_add= test to the package definition before trying to solve the overall problem,= though. Maybe we can get this in for 1.0.1? > > I would be willing to do this myself and report the results here but I'm = baffled at how to achieve this simple task. Perhaps someone could walk me t= hrough it? I'm not sure about the kernel error. I haven't seen an error like that myself. But perhaps this is yet another test which is failing non-deterministically? I think we need more data. It would be nice if we could build this repeatedly on Cuirass. When the build is 3 hours long, it is difficult to test it on my machine, and I often forget about it by the time it is done running. If I get more time, I will try to dig in more. In the meantime, any thoughts about this would be welcome. =2D-=20 Chris --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAEBCAAdFiEEy/WXVcvn5+/vGD+x3UCaFdgiRp0FAl0lg1EACgkQ3UCaFdgi Rp0DZg/+MeOEmURNkPsIrkLyrgjG/okg06VfOkPezht2CnXEwIy+cSjccKN/6l9H eRGUQLEXyqhMNueYGIiMXYGgVixknNIJ97/Twx8qVc+0mrY4h7t2lDif4QXF5ytV IRmOd3eRB/tN5eA3CoNAV/VSsEGvqXpvvfa3XJPvYjKso78WvZP4qGlwyhmPyeBc W77MInNSod7pdpcvy1BceB5vORrAsQmFixrnZb/mb239JyOLq448C7sqC501kt3Q 1SS0qVUc1yf1vdRqxyZek5XKSAJaS3Y+EfgZRkpHjzkoSaeLf0kbaz+9DfIqqszk y0PtrLSPt5rMqGxsWHni6YzdkNcP8v7As9ZDN60HCH0SdJLBeSQ6R3zrtOd1T2Qj CTArMfzyKFQPHe62WdrLYLo4a8NFGKQobbPLJKP5ipnmmGCu1mbhvmi258NkQjul 0IXlx6STUzfywwDp1rCXz/nrM0g+FRESxAr2ejOWuhgluxE7xRAaE1qzP5wLC/yX RpndTqkkVu8Qiy3RJMVkvsQvfD8xksNALeSToYX6qoBfaF0brwCTgfcf1g+ktLTa MlK5FnvS4YBg9dtOHOYzzQwiw7gzuEh604eBzC+Mn7Q5B+FBg4p4Q14Ec0s4kO5y HVeQWTLLgUQmMsmbBUd+7sxKyYk8LEqJ9Gkx20Z8MS1x3WV/fCI= =9zjG -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Wed Jul 10 13:30:59 2019 Received: (at 35521) by debbugs.gnu.org; 10 Jul 2019 17:30:59 +0000 Received: from localhost ([127.0.0.1]:36564 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hlGQk-0001er-Od for submit@debbugs.gnu.org; Wed, 10 Jul 2019 13:30:59 -0400 Received: from out5-smtp.messagingengine.com ([66.111.4.29]:42251) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hlGQi-0001ed-8l for 35521@debbugs.gnu.org; Wed, 10 Jul 2019 13:30:57 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 05C81220CF; Wed, 10 Jul 2019 13:30:51 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Wed, 10 Jul 2019 13:30:51 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm3; bh=4e78uELUkmca9mEeV+IogEYzgN JL/zxQoBlwPIZ18do=; b=gI3auIY7iBMA1pG2r4CZ8wVg1JupBEME37KSM8LFQ9 EI6zsPOeZTLJtI6fOiDizPZDdah71m0O7ClLRhpTk0VYed2TRSGCENnDVfcv1gJU 1SeeOOvIqAw4Z1hJVQBJFRVTUI7ZacWLsrlFUvBizbtonCpp/6d3zIFCSAkdKufF 6QlzaspJaZINNrl6T0Epu1ngdn2LZPs8DOk8SQPdFfP3RsosXo5dEe2reRAjDK8h +RNUTUexHBMBXrANVC4FMQoVMoE7zexScSVUt762CZTc5NTlwWuBLuDriuqJXNLj TIwexXc+b/p3BYwW1+GySOQT8mmvgWOvQbysu+UUxEZg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=4e78uE LUkmca9mEeV+IogEYzgNJL/zxQoBlwPIZ18do=; b=hzeibCQipaX3CSGMITP7cJ UdBbp//PzOZEYjQ0D5cMZUtR1DdgTcxUk0gaS8C80TkLXpBAIUz8y396A3vxjWLa wEmJw+X5kgV7gL0eQx+L5o9CUZbzsJEmcAykDrbnCdppKierqmt18CCIc3fp4rXw IojmU8IP2yjFxzkNqzaO8Rsiy+elXySQdTOCBy3hB5fEL5SlnX96PXzjbc52Z7pK R2mgtyuO9Mvy8Ov4ssgR03LlnFrbXK9hI00i3mnF2+jJeop6oX82B6z36IuQlmpR 7E+lCe5nHxGSFH3fa92xLdeMdEvn6bcq+O9WVTiMkQCYuruUzVMjY6URw6mlHlug == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddrgeeigdduudeiucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmne cujfgurhephffvufgjfhgffffkgggtsehgtderredtredtnecuhfhrohhmpeforghrihhu shcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeenucfkphepie dvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgv sehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id EEACA8005B; Wed, 10 Jul 2019 13:30:49 -0400 (EDT) From: Marius Bakke To: Chris Marusich , Mark H Weaver , Platoxia Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-Reply-To: <87pnmil8dq.fsf_-_@gmail.com> References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> User-Agent: Notmuch/0.29.1 (https://notmuchmail.org) Emacs/26.2 (x86_64-pc-linux-gnu) Date: Wed, 10 Jul 2019 19:30:36 +0200 Message-ID: <87wogpn6f7.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 35521 Cc: 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain Chris Marusich writes: > Hi, > > I've been encountering this failure off and on for a few weeks now, and > I'd like to help fix it. In short, it seems like non-deterministic test > failures, to me. I think we should gather data and report the issue > upstream, and maybe disable the offending tests in the meantime. I agree. I notice many of these failing tests are for the TokuDB backend, which I doubt anyone is using in Guix anyway. Here is a patch that disables all tests mentioned in this report. I would like to push it to core-updates. Are there others? --=-=-= Content-Type: text/x-patch Content-Disposition: inline; filename=mariadb.diff Content-Transfer-Encoding: quoted-printable diff --git a/gnu/packages/databases.scm b/gnu/packages/databases.scm index 578670e3c1..778c70eed0 100644 =2D-- a/gnu/packages/databases.scm +++ b/gnu/packages/databases.scm @@ -704,8 +704,12 @@ Language.") ;; 2030-12-31. See for= details. "main.mysqldump" =20 =2D ;; XXX: Fails sporadically. + ;; XXX: These tests may fail on some hardware config= urations, + ;; see et al. "innodb_fts.crash_recovery" + "tokudb_alter_table.hcad_all_add" + "tokudb_bugs.mdev4533" + "tokudb_bugs.5733_innodb" =20 ;; FIXME: This test fails on i686: ;; -myisampack: Can't create/write to file (Errcode:= 17 "File exists") --=-=-= Content-Type: text/plain WDYT? Note that the latest MariaDB is 10.4.x, and these tests may well be fixed in later versions. --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl0mILwACgkQoqBt8qM6 VPrruQgAzi4CtsfhJjbaGHZgq/1NtY5uzZVxzJS9yGIKeJ3/LOwI+XXOyh567e6e tJPO5B4I9ItZHeryWtREDIjHDeqwL64yhmnHMcWanoCGHrIptVtJMauxcCJkrqcF dr7wX3tJXbQD5HzydJKkmWS8dlOIPYhSTGP5ohZhMsB2qWdl3LwcHjNcqZohadBz awwoJzzDGqnCOjgj92efdFIR1FxgwdNEXavjoa2j7E1fV2t4hWzE3VhXAMu0OHAr 9zUjxm443ltY0D86v+e13rD55wv1tSuKmO6RzLecHn9+besRzMYVC54XtSSdcIjK JOlLlBW03XoksXd9AveBSTe726iH3w== =1IaP -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Wed Jul 10 17:35:09 2019 Received: (at 35521) by debbugs.gnu.org; 10 Jul 2019 21:35:09 +0000 Received: from localhost ([127.0.0.1]:36733 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hlKF2-0002es-Q2 for submit@debbugs.gnu.org; Wed, 10 Jul 2019 17:35:09 -0400 Received: from world.peace.net ([64.112.178.59]:43628) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hlKF1-0002eQ-EB for 35521@debbugs.gnu.org; Wed, 10 Jul 2019 17:35:07 -0400 Received: from mhw by world.peace.net with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.89) (envelope-from ) id 1hlKEu-0007Qp-Dj; Wed, 10 Jul 2019 17:35:00 -0400 From: Mark H Weaver To: Marius Bakke Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-Reply-To: <87wogpn6f7.fsf@devup.no> References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> Date: Wed, 10 Jul 2019 17:32:49 -0400 Message-ID: <87ef2xlgmb.fsf@netris.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 35521 Cc: Platoxia , Chris Marusich , 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hi, Marius Bakke writes: > Chris Marusich writes: > >> Hi, >> >> I've been encountering this failure off and on for a few weeks now, and >> I'd like to help fix it. In short, it seems like non-deterministic test >> failures, to me. I think we should gather data and report the issue >> upstream, and maybe disable the offending tests in the meantime. > > I agree. I notice many of these failing tests are for the TokuDB > backend, which I doubt anyone is using in Guix anyway. > > Here is a patch that disables all tests mentioned in this report. I > would like to push it to core-updates. Are there others? I'm concerned by how frequently and casually we simply disable failing tests. What is the utility of running test suites at all, if this is how we respond? It makes me wonder how many programs are subtly broken on my Guix system because of this widespread practice. Mark From debbugs-submit-bounces@debbugs.gnu.org Thu Jul 11 16:19:20 2019 Received: (at 35521) by debbugs.gnu.org; 11 Jul 2019 20:19:20 +0000 Received: from localhost ([127.0.0.1]:38652 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hlfXE-0006dO-6T for submit@debbugs.gnu.org; Thu, 11 Jul 2019 16:19:20 -0400 Received: from eggs.gnu.org ([209.51.188.92]:45996) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hlfXB-0006d8-Vy for 35521@debbugs.gnu.org; Thu, 11 Jul 2019 16:19:18 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]:43357) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1hlfX6-00084J-68; Thu, 11 Jul 2019 16:19:12 -0400 Received: from [2a01:e0a:1d:7270:af76:b9b:ca24:c465] (port=51282 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1hlfX4-00018l-L2; Thu, 11 Jul 2019 16:19:12 -0400 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Mark H Weaver Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 23 Messidor an 227 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Thu, 11 Jul 2019 22:18:44 +0200 In-Reply-To: <87ef2xlgmb.fsf@netris.org> (Mark H. Weaver's message of "Wed, 10 Jul 2019 17:32:49 -0400") Message-ID: <87ftncqq8r.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.2 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 35521 Cc: Marius Bakke , Platoxia , 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Hi Mark, Mark H Weaver skribis: > Marius Bakke writes: > >> Chris Marusich writes: >> >>> Hi, >>> >>> I've been encountering this failure off and on for a few weeks now, and >>> I'd like to help fix it. In short, it seems like non-deterministic test >>> failures, to me. I think we should gather data and report the issue >>> upstream, and maybe disable the offending tests in the meantime. >> >> I agree. I notice many of these failing tests are for the TokuDB >> backend, which I doubt anyone is using in Guix anyway. >> >> Here is a patch that disables all tests mentioned in this report. I >> would like to push it to core-updates. Are there others? > > I'm concerned by how frequently and casually we simply disable failing > tests. What is the utility of running test suites at all, if this is > how we respond? I don=E2=80=99t think anyone is happy with that. The alternative seems to = be: keeping an older version that perhaps didn=E2=80=99t have these problems bu= t may have known bugs and security issues, or keeping a package that fails to build for a possibly long time. I think disabling specific tests is the least bad of these options. In this case, we know that the offending tests relate to a specific backend, and one can at least assume that potential issues are in that area. So I do think that this is an appropriate response. Of course, in any such case, we should report the issue upstream, even if we all too well know that non-deterministic test failures are hard to address=E2=80=A6 Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Thu Jul 11 18:01:40 2019 Received: (at 35521) by debbugs.gnu.org; 11 Jul 2019 22:01:40 +0000 Received: from localhost ([127.0.0.1]:38966 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hlh8F-0004jI-NP for submit@debbugs.gnu.org; Thu, 11 Jul 2019 18:01:40 -0400 Received: from out3-smtp.messagingengine.com ([66.111.4.27]:57397) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hlh8D-0004da-GV for 35521@debbugs.gnu.org; Thu, 11 Jul 2019 18:01:38 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 126A7200CF; Thu, 11 Jul 2019 18:01:32 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Thu, 11 Jul 2019 18:01:32 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm3; bh=cI5PHPTv86kwYy77PY1haAcBBP TjvyHCog8yv3gzXao=; b=FOul32bbq4Nr1GndQoYQef4s38pqB/D+4VDOfNtmPj ZHb5ujiiwBlcFmteLmzWrKuAGVJ0nKfAyuoKkSozWTl/sfegR/ujGrsEiIm4zmfE 3VL2VGDBsIgBf9uiddAFFxXCt9ZgEPdS8WB7dPn3HwDQWh+tDtVVTv246cBO+9Ok 2HF4Wi9ukikAh0JZ8nGEA6N3Lb8f1YhYoc11cUhg9o6LDxJQqNe+zqonv3MdSIA5 A6/hL1Dz+J9yH5jx5xzbOZdIA0oWEhEv1U0czhblawQxB/RQJMpW4sTrmzE68sfI achK+gvOMJSb5bAptAilT39EI4no9uj2XSwxc8Fbtztw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=cI5PHP Tv86kwYy77PY1haAcBBPTjvyHCog8yv3gzXao=; b=AbQ9iTIIvLApDZjW26WyCi wwaeWndelHt1bbKPkLkG5Dg3d8h1nBzTkhw0XaY5+oXc/LnczXwwTCDVZL8jFwbT BotVXz2PWzcPTqQC8eFVYntVbzcAUJXTGB0X8IIg+Rw5AHnStmCIkR734DimnfCi sRuo5crLQ0KNTMO1DcuPMhWjJwyjhDVA76UFCir2jZVH0nimH0hNYcDfptt0TUzA J/Fy7CJihMe23zIND5o4jMQEE9fvPUStzwi/s1NyE26M2jFLKYU43UT/i3g8wKZW yV77xwg8zxy3LiPhpLxb8ddK0nrjp/nzvJkK4Uyk2Ubp3ESo145u5OXaHwMCwJIw == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddrgeelgddthecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenuc fjughrpefhvffujghffgffkfggtgesghdtreertdertdenucfhrhhomhepofgrrhhiuhhs uceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheqnecuffhomhgrih hnpehgihhthhhusgdrtghomhenucfkphepiedvrdduiedrvddviedrudegtdenucfrrghr rghmpehmrghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrghilhdrtghomhenucevlh hushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 1655880060; Thu, 11 Jul 2019 18:01:30 -0400 (EDT) From: Marius Bakke To: Mark H Weaver Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-Reply-To: <87ef2xlgmb.fsf@netris.org> References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> User-Agent: Notmuch/0.29.1 (https://notmuchmail.org) Emacs/26.2 (x86_64-pc-linux-gnu) Date: Fri, 12 Jul 2019 00:01:28 +0200 Message-ID: <87ims8mds7.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 35521 Cc: Platoxia , Chris Marusich , 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain Mark H Weaver writes: > Hi, > > Marius Bakke writes: > >> Chris Marusich writes: >> >>> Hi, >>> >>> I've been encountering this failure off and on for a few weeks now, and >>> I'd like to help fix it. In short, it seems like non-deterministic test >>> failures, to me. I think we should gather data and report the issue >>> upstream, and maybe disable the offending tests in the meantime. >> >> I agree. I notice many of these failing tests are for the TokuDB >> backend, which I doubt anyone is using in Guix anyway. >> >> Here is a patch that disables all tests mentioned in this report. I >> would like to push it to core-updates. Are there others? > > I'm concerned by how frequently and casually we simply disable failing > tests. What is the utility of running test suites at all, if this is > how we respond? I had no idea this issue was so widespread until I noticed Berlins builders hit it more often than not. I have not been able to reproduce these failures on my machines. So it was kind of a panic reaction, being the person responsible for running these tests and all. Looking further into the changes between 10.1.37 and 10.1.38, I notice the 'tokudb.*' tests were enabled: https://github.com/MariaDB/server/commit/4c490d6df63695dc97b2c808e59954e6877d3a51 Watching the build on Berlin in real time, I also see that the test output grind nearly to a halt while running those. 'tokudb.hotindex-insert-2' took 2700439 milliseconds, or 45 minutes, if I'm reading the test output correctly. The default test case timeout is 40 minutes (as specified in the Guix package), but I'm using 80 for this build (60 was insufficient). I suspect the problem is that the 'tokudb.*' tests put a lot of strain on the file system, which causes these other tests to fail. It's interesting that disabling parallel build was insufficient though. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl0nsbgACgkQoqBt8qM6 VPp1tgf/UL12EYe5i3V5vTSCL/x3LG51j3EvApLjIUhzcxqbv1p7j9eQlzx+A6vS Cy8uqBg8tK15IFIwq+bnzF3AYFUUxNRqzq2M/5LRbNDAavckrgkC1ZrkBJtYd0TQ ivRV32Jjt0frbqcTols98Ajy5mlQ+M69z7XSW/HdtvYEkJDVmaj5YZAA3Uqu0nq3 Cmj0uzRwooQl0S7e0ne+9QIHWSjIqKyE8YqVwA9HZwmZc42p/WPCL2ex6FTgH/iM Oc3IHS696tzSc/ctZgmzAC9/EpBD81NXeYc3Z4Njy32WLo4hFuaG3yg7rB4Z8GW9 iccI3AqFSDzG8oAcLs3Mrr8QKQlUZg== =TgJX -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Fri Jul 12 04:02:59 2019 Received: (at 35521) by debbugs.gnu.org; 12 Jul 2019 08:02:59 +0000 Received: from localhost ([127.0.0.1]:39232 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hlqWB-0004n2-A9 for submit@debbugs.gnu.org; Fri, 12 Jul 2019 04:02:59 -0400 Received: from ns13.heimat.it ([46.4.214.66]:39904) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hlqW8-0004mn-Q7 for 35521@debbugs.gnu.org; Fri, 12 Jul 2019 04:02:57 -0400 Received: from localhost (ip6-localhost [127.0.0.1]) by ns13.heimat.it (Postfix) with ESMTP id B3E4C3021D5; Fri, 12 Jul 2019 08:02:50 +0000 (UTC) X-Virus-Scanned: Debian amavisd-new at ns13.heimat.it Received: from ns13.heimat.it ([127.0.0.1]) by localhost (ns13.heimat.it [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id o9TMxLVodUA2; Fri, 12 Jul 2019 08:02:31 +0000 (UTC) Received: from bourrache.mug.xelera.it (unknown [93.56.161.211]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by ns13.heimat.it (Postfix) with ESMTPSA id 40D03300F9B; Fri, 12 Jul 2019 08:02:31 +0000 (UTC) Received: from roquette.mug.biscuolo.net (roquette.mug.biscuolo.net [10.38.2.14]) by bourrache.mug.xelera.it (Postfix) with SMTP id A1CC1300A06; Fri, 12 Jul 2019 10:02:30 +0200 (CEST) Received: (nullmailer pid 27236 invoked by uid 1000); Fri, 12 Jul 2019 08:02:30 -0000 From: Giovanni Biscuolo To: Ludovic =?utf-8?Q?Court=C3=A8s?= , Mark H Weaver Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-Reply-To: <87ftncqq8r.fsf@gnu.org> Organization: Xelera.eu References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> <87ftncqq8r.fsf@gnu.org> Date: Fri, 12 Jul 2019 10:02:29 +0200 Message-ID: <87blxzu1d6.fsf@roquette.mug.biscuolo.net> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 35521 Cc: 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Hi all, for what it counts I=20 Ludovic Court=C3=A8s writes: > Mark H Weaver skribis: [...] >> I'm concerned by how frequently and casually we simply disable failing >> tests. I disagree here: disabling in Guix tests is _never_ done casually AFAIS (as far as I see) but always ponderated and discussed, like in this case ;-) [...] > I think disabling specific tests is the least bad of these options. Also: automated software testing is better than nothing but... who test tests? *Sometime* it happens that tests introduces "collateral test bugs" that have nothing to do with actual software issues, including secutiry ones. So IMHO neither upstream nor us should "blindly obey" to tests and disable proved unreliable ones :-D More on this specific issue in my next repy... :-) [...] Happy hacking! Gio' =2D-=20 Giovanni Biscuolo Xelera IT Infrastructures --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAEBCgAdFiEERcxjuFJYydVfNLI5030Op87MORIFAl0oPpUACgkQ030Op87M ORJZ6A//eSJcDaXg0EVnRkncY6mlGaA383z3PgGM7Pj4ZTb2YYtZp3djpv0rLIHs Lm9MnmVPDJfwo02Q083KODYiTMHZHrDo2ItXRGp7dQ4a1g2aTFQEh+V4mtXNY/B6 EMEZQx8W7+2bnPC78QHTpMV2MCHQ/iDUeBKP4Zd/rDSmvHYZj9n2ehwVT2zoxjLY 8B8gpVJCxkFYSJ31MEjB9D11LeWohAzwW+hUP98tWz7UPFWuP1Qm6F1kubPuVkvd wj1NkEXgviIriy9Tlgur6MXWjIzIkreo1EYK2Nou17fWUHcdi2txF+zVVf38a9OP l1PaGQTYYNj3C3PEEyAMbXN5qnoynXPcQ+rapjc7yCQiYsSwIptnOh4pVcHgom7w rte25SnDbL159dwSfQrcgtX6ykaK+0PMo/Ujejuo0f5gPRnuIJemd1u4ipDUkU2g 2yLnVRBJe7dpt4d3HnFviPYL60PnXTFSbCarhHgX8sSEXNgBAvaaMjlJ0REqxuCy QdBrbvBnFwbDwqkpu3/TBpj0RG00FHFCpvRRlip4oc+8AYMAGkI745WCtrDgx5WT JiqtONuObRJ835cCBCUL1qi18DDRPb3wCDP2K/ZgWoW0+GAZGOGWI6NIsiROgytU Hz0BYLs1G4xckcroBJX2RGtLWwv2204CS6PgwQKGL+vab840myk= =ZVVm -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Fri Jul 12 04:24:46 2019 Received: (at 35521) by debbugs.gnu.org; 12 Jul 2019 08:24:46 +0000 Received: from localhost ([127.0.0.1]:39251 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hlqrF-0005HP-Td for submit@debbugs.gnu.org; Fri, 12 Jul 2019 04:24:46 -0400 Received: from ns13.heimat.it ([46.4.214.66]:40058) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hlqrD-0005HA-Dv for 35521@debbugs.gnu.org; Fri, 12 Jul 2019 04:24:44 -0400 Received: from localhost (ip6-localhost [127.0.0.1]) by ns13.heimat.it (Postfix) with ESMTP id 862653021CD; Fri, 12 Jul 2019 08:24:36 +0000 (UTC) X-Virus-Scanned: Debian amavisd-new at ns13.heimat.it Received: from ns13.heimat.it ([127.0.0.1]) by localhost (ns13.heimat.it [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id dSYjSEFmMEaQ; Fri, 12 Jul 2019 08:24:16 +0000 (UTC) Received: from bourrache.mug.xelera.it (unknown [93.56.161.211]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by ns13.heimat.it (Postfix) with ESMTPSA id B045B300F9B; Fri, 12 Jul 2019 08:24:16 +0000 (UTC) Received: from roquette.mug.biscuolo.net (roquette.mug.biscuolo.net [10.38.2.14]) by bourrache.mug.xelera.it (Postfix) with SMTP id 084AD300A06; Fri, 12 Jul 2019 10:24:16 +0200 (CEST) Received: (nullmailer pid 27650 invoked by uid 1000); Fri, 12 Jul 2019 08:24:15 -0000 From: Giovanni Biscuolo To: Marius Bakke Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-Reply-To: <87ims8mds7.fsf@devup.no> Organization: Xelera.eu References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> <87ims8mds7.fsf@devup.no> Date: Fri, 12 Jul 2019 10:24:04 +0200 Message-ID: <878st3u0d7.fsf@roquette.mug.biscuolo.net> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 35521 Cc: Platoxia , 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable Hi Marius, Marius Bakke writes: [...] > Looking further into the changes between 10.1.37 and 10.1.38, I notice > the 'tokudb.*' tests were enabled: > > https://github.com/MariaDB/server/commit/4c490d6df63695dc97b2c808e59954e6= 877d3a51 The very first thing I noticed lookng at that commit is it's subject: "Updated list of unstable tests for 10.1.38 release" The first comments of that file states: =2D-8<---------------cut here---------------start------------->8--- # List the test cases which, unlike tests from disabled.def files, # can still be run on the current tree meaningfully, but are known # or suspected to fail sporadically on different reasons. # # Most common reasons are either test failures observed in buildbot, # or recent modifications to the tests which make their stability # unknown. # # Tests included due to recent modifications are later removed from the # list, if during a certain period they do not fail (and are not # modified again). Tests included due to intermittent failures are # removed when corresponding bug reports are closed. # # Separate the test case name and the comment with ':'. # # . : MDEV-xxxxx - # # '*' wildcard in testcase names is supported. # # To use the list, run MTR with --skip-test-list=3Dunstable-tests option. =2D-8<---------------cut here---------------end--------------->8--- So *all* those rests _are_ considered unstable upstream. IMHO they should be *selectively* skipped when they causes build problems in Guix, including non-deterministic frequent ones like in this case. > Watching the build on Berlin in real time, I also see that the test > output grind nearly to a halt while running those. > 'tokudb.hotindex-insert-2' took 2700439 milliseconds, or 45 minutes, if > I'm reading the test output correctly. The same is happening upstream: https://jira.mariadb.org/browse/MDEV-15198 https://jira.mariadb.org/browse/MDEV-16040 (duplicate of the above) https://jira.mariadb.org/browse/MDEV-15271 That bugs (and all others related to unstable tests) are currently unresolved. HTH! Gio' =2D-=20 Giovanni Biscuolo Xelera IT Infrastructures --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAEBCgAdFiEERcxjuFJYydVfNLI5030Op87MORIFAl0oQ6QACgkQ030Op87M ORIhNg/+NqbYZ5uOvNzZgZd2fzYlS0rsmeFRI+MjZzQhuPxFMHdjr4C+hHyTnsPE DIm6pLPWmWtlYJLr7vtOaYNuxF+cgzhbgwOzuON9uUbYORsZ+DFu264IKg5oqP5T HD+9Q+m0HU9MkEx35+q308LwpNpuUIVvserjv6OeRTa9jX/nviLgtrj5q1Cmnrsk oq+tnjsSYFZ9kGy8SSIeOdsnXE+ChQj6Mp6nN0P4h7ULhf8kym2oPr7ojgV26KuB Ysjdgk3q5d697GdhlcG4N17A7A2vFeabUIs+SnXTVKPZt9unXC1mwUAvMwDZsWGL Jdi51KywIiFohyZ4UQhaqw3zUuS8lO/H41suOZJPibx0qBqp3I55yZoH5grNUHMv FpeRQuZ4l9MtiEZHxQUf0b+j/JO4JplCnfIChPQXlyqVGGpg+1hS8Dkk7PPiR8/l whhLK3QgEUlVz0Krh9MenoXh+SNnjOuFTRJnhfzYaDW/Mh9ERbUnwMkiP9en7SKi bT+x46m7nHpHUvWfvlzFgZZyFjWlUxKyHKSG3NUtAw55J+bhqeyBUF2mm6mNA7MF OzaIPVDdxHrtKR+KZXYazYEw8qlUkInzwmJLjtuXoauoRKCuN/NI5kvht9vQIBcM mkw+EzvMdIQSH1BJ2rjP3SKbj2hd42nZuc/k6Mv9JRVWuwKUNxo= =qw3E -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Fri Jul 12 10:59:00 2019 Received: (at 35521) by debbugs.gnu.org; 12 Jul 2019 14:59:01 +0000 Received: from localhost ([127.0.0.1]:40520 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hlx0m-0002II-HR for submit@debbugs.gnu.org; Fri, 12 Jul 2019 10:59:00 -0400 Received: from out3-smtp.messagingengine.com ([66.111.4.27]:38949) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hlx0j-0002I3-EX for 35521@debbugs.gnu.org; Fri, 12 Jul 2019 10:58:58 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id B2F5A21FE9; Fri, 12 Jul 2019 10:58:51 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Fri, 12 Jul 2019 10:58:51 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm3; bh=SPAVuoYMuswYYCLCsiFRf9fRua w5jE+Rr6AKfPTcD78=; b=gX7A7qPTXq2ovZzbNpSYzCcGh6WRV7wW3IkJJaCvfa WtqPTDERSdAXVon+qCIzcb34HC+V2IWc9FegwQ1DgQ41g6i2ksi4siBWQoRWuvMc cQHji9+DPaJON5fCOrbsEHgkGMKp1zkzBpY6c4GYI61m9NGVDoOHDa95IEApspZU QbI+tcctnzUQJHguve0fbG3tLuaSjLW3aCn5i4FKnDH5xivNlV5ifRzxkYn1aZnT W3wKbkqrFAHnhmH3nbkAogOmsg8/+2PCo4DI5AwK8E+UT8ZosafaoRSbfn32CWxP V5guWtAO9kAbK0BsASpi94UkHIUrkfr6zOFLOFB8VbmA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=SPAVuo YMuswYYCLCsiFRf9fRuaw5jE+Rr6AKfPTcD78=; b=19RMpCKJsmAl3Q3etsMg/r 9ZX0etY29VmC3ps4hdY9Qj6ycW+fb48RPYMUKIFDD8ZS4aT+W63PM2wvs+jl3tVB X6Bzxkjj/R4txaK2eqhRcP1DB30i1CMyaRM8CTICPcfJsbUJslKF6x/Jcq1pus0W DxcoFXnGakIAWLLLMjsLGlyA5SNRsHdcX/fKnN5aaDHxfboLG8upwLRxttSDzY6a gNLYkAJpfhPbvLE8bz1Iskq1RCVrrkSGPNtZY+JVsJe1oos20Cr5mgu91Jn4DZ2/ BZJepJnS4hz24EKlGxJgP3Wvxzbu5d3Mp+azvCEOKJ74al6/Z5gk4F/ER9C4POAA == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddrhedtgdekudcutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenuc fjughrpefhvffujghffgffkfggtgesghdtreertdertdenucfhrhhomhepofgrrhhiuhhs uceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheqnecuffhomhgrih hnpehgihhthhhusgdrtghomhenucfkphepiedvrdduiedrvddviedrudegtdenucfrrghr rghmpehmrghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrghilhdrtghomhenucevlh hushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id E742A380074; Fri, 12 Jul 2019 10:58:50 -0400 (EDT) From: Marius Bakke To: Mark H Weaver Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-Reply-To: <87ims8mds7.fsf@devup.no> References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> <87ims8mds7.fsf@devup.no> User-Agent: Notmuch/0.29.1 (https://notmuchmail.org) Emacs/26.2 (x86_64-pc-linux-gnu) Date: Fri, 12 Jul 2019 16:58:48 +0200 Message-ID: <878st3mh93.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 35521 Cc: Platoxia , Chris Marusich , 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain Marius Bakke writes: > Mark H Weaver writes: > >> Hi, >> >> Marius Bakke writes: >> >>> Chris Marusich writes: >>> >>>> Hi, >>>> >>>> I've been encountering this failure off and on for a few weeks now, and >>>> I'd like to help fix it. In short, it seems like non-deterministic test >>>> failures, to me. I think we should gather data and report the issue >>>> upstream, and maybe disable the offending tests in the meantime. >>> >>> I agree. I notice many of these failing tests are for the TokuDB >>> backend, which I doubt anyone is using in Guix anyway. >>> >>> Here is a patch that disables all tests mentioned in this report. I >>> would like to push it to core-updates. Are there others? >> >> I'm concerned by how frequently and casually we simply disable failing >> tests. What is the utility of running test suites at all, if this is >> how we respond? > > I had no idea this issue was so widespread until I noticed Berlins > builders hit it more often than not. I have not been able to reproduce > these failures on my machines. So it was kind of a panic reaction, > being the person responsible for running these tests and all. > > Looking further into the changes between 10.1.37 and 10.1.38, I notice > the 'tokudb.*' tests were enabled: > > https://github.com/MariaDB/server/commit/4c490d6df63695dc97b2c808e59954e6877d3a51 > > Watching the build on Berlin in real time, I also see that the test > output grind nearly to a halt while running those. > 'tokudb.hotindex-insert-2' took 2700439 milliseconds, or 45 minutes, if > I'm reading the test output correctly. > > The default test case timeout is 40 minutes (as specified in the Guix > package), but I'm using 80 for this build (60 was insufficient). > > I suspect the problem is that the 'tokudb.*' tests put a lot of strain > on the file system, which causes these other tests to fail. It's > interesting that disabling parallel build was insufficient though. Update: Berlin built mariadb twice on core-updates with this patch: --=-=-= Content-Type: text/x-patch Content-Disposition: inline; filename=db.diff diff --git a/gnu/packages/databases.scm b/gnu/packages/databases.scm index 6bfeaad9a2..64bc0938b6 100644 --- a/gnu/packages/databases.scm +++ b/gnu/packages/databases.scm @@ -753,7 +753,7 @@ Language.") (with-directory-excursion "mysql-test" (invoke "./mtr" "--verbose" "--retry=3" - "--testcase-timeout=40" + "--testcase-timeout=80" "--suite-timeout=600" "--parallel" (number->string (parallel-job-count)) "--skip-test-list=unstable-tests")) --=-=-= Content-Type: text/plain Mark, Chris: Can you try this change with MariaDB 10.1.40 and see if it works for you? --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl0ooCgACgkQoqBt8qM6 VPq/FggAtPX7+OrcwlSI12IbUfUqhEZnQrocXIy9okA1Bl5NiV+Hy8k2rfg5/Q1K Rqix5TSkPCGLPtQYkW/IIyZiPaJZQuKWpUlphbFlZDQ1vGs2Q4WlbS0gOLJnEV3T EkRaj2rweRsTKel5OPMSKaV3VGTc+TchyRFvhjGfhSrBdokrBD2Z6cSWtf4rhss3 rge+11QhSBX3ZIqSghSSTd9GZ1D4XCIEdvUfxK0qoWH1bLhSmTQh/PNV8+wtl1os Xmrb8zXNXu1WP2FyaCnPeDS2vOEYBDogT0kDszadxWC0lNXzwxuRfbc4dJVhcI/Q SWQXWbvO88PyTjRep6zJ5iu6DjG1fw== =RYR1 -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sat Jul 13 13:30:27 2019 Received: (at 35521) by debbugs.gnu.org; 13 Jul 2019 17:30:27 +0000 Received: from localhost ([127.0.0.1]:43302 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmLqs-0005Xw-Ig for submit@debbugs.gnu.org; Sat, 13 Jul 2019 13:30:27 -0400 Received: from world.peace.net ([64.112.178.59]:48696) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmLqq-0005Xi-9p for 35521@debbugs.gnu.org; Sat, 13 Jul 2019 13:30:25 -0400 Received: from mhw by world.peace.net with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.89) (envelope-from ) id 1hmLqk-0004rB-5s; Sat, 13 Jul 2019 13:30:18 -0400 From: Mark H Weaver To: Marius Bakke Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-Reply-To: <878st3mh93.fsf@devup.no> References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> <87ims8mds7.fsf@devup.no> <878st3mh93.fsf@devup.no> Date: Sat, 13 Jul 2019 13:29:32 -0400 Message-ID: <87d0id4zcz.fsf@netris.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 35521 Cc: Giovanni Biscuolo , Platoxia , Chris Marusich , 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hi Marius, > Update: Berlin built mariadb twice on core-updates with this patch: > > --8<---------------cut here---------------start------------->8--- > diff --git a/gnu/packages/databases.scm b/gnu/packages/databases.scm > index 6bfeaad9a2..64bc0938b6 100644 > --- a/gnu/packages/databases.scm > +++ b/gnu/packages/databases.scm > @@ -753,7 +753,7 @@ Language.") > (with-directory-excursion "mysql-test" > (invoke "./mtr" "--verbose" > "--retry=3" > - "--testcase-timeout=40" > + "--testcase-timeout=80" > "--suite-timeout=600" > "--parallel" (number->string (parallel-job-count)) > "--skip-test-list=unstable-tests")) > --8<---------------cut here---------------end--------------->8--- > > Mark, Chris: Can you try this change with MariaDB 10.1.40 and see if it > works for you? I tried it, but it made no difference on my Thinkpad X200, which still fails the same way as before with 10.1.38: Failing test(s): tokudb_bugs.mdev4533 Anyway, based on Giovanni's observations, https://debbugs.gnu.org/cgi/bugreport.cgi?bug=35521#32 I'm now inclined to agree that these are likely to be flaky tests, so I withdraw my objections to disabling them, in this specific case. Having said that, I disagree with Giovanni's dismissal of my concerns in general, here: https://debbugs.gnu.org/cgi/bugreport.cgi?bug=35521#29 I will respond to that dismissal in a later message. Thanks, Mark From debbugs-submit-bounces@debbugs.gnu.org Sat Jul 13 14:39:41 2019 Received: (at 35521) by debbugs.gnu.org; 13 Jul 2019 18:39:41 +0000 Received: from localhost ([127.0.0.1]:43378 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmMvt-0007KA-6b for submit@debbugs.gnu.org; Sat, 13 Jul 2019 14:39:41 -0400 Received: from world.peace.net ([64.112.178.59]:48800) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmMvr-0007Jv-HN for 35521@debbugs.gnu.org; Sat, 13 Jul 2019 14:39:39 -0400 Received: from mhw by world.peace.net with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.89) (envelope-from ) id 1hmMvl-0005CI-Er; Sat, 13 Jul 2019 14:39:33 -0400 From: Mark H Weaver To: Marius Bakke Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-Reply-To: <878st3mh93.fsf@devup.no> References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> <87ims8mds7.fsf@devup.no> <878st3mh93.fsf@devup.no> Date: Sat, 13 Jul 2019 14:38:55 -0400 Message-ID: <877e8l4w5c.fsf@netris.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 35521 Cc: Giovanni Biscuolo , Platoxia , Chris Marusich , 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Earlier, I wrote: >> Mark, Chris: Can you try this change with MariaDB 10.1.40 and see if it >> works for you? > > I tried it, but it made no difference on my Thinkpad X200, which still > fails the same way as before with 10.1.38: > > Failing test(s): tokudb_bugs.mdev4533 I should clarify that I tested 10.1.40 this time, and it failed in the same way that 10.1.38 failed for me before. Mark From debbugs-submit-bounces@debbugs.gnu.org Sat Jul 13 18:42:49 2019 Received: (at 35521) by debbugs.gnu.org; 13 Jul 2019 22:42:49 +0000 Received: from localhost ([127.0.0.1]:43558 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmQjA-0000my-Iw for submit@debbugs.gnu.org; Sat, 13 Jul 2019 18:42:48 -0400 Received: from out5-smtp.messagingengine.com ([66.111.4.29]:50503) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmQj8-0000mj-Fx for 35521@debbugs.gnu.org; Sat, 13 Jul 2019 18:42:47 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 2991B20D56; Sat, 13 Jul 2019 18:42:41 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Sat, 13 Jul 2019 18:42:41 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm3; bh=Wglu5GnY8cUU5MsVE52Mqf7DIg eeC+af+qaKm3pfGnQ=; b=nxGGS2DxymXFc5FexyGSOz2lTzc3wphhvjQ53sZlLK AJKct0zGg9N1f4eiOA3ptZU+HHHWAHeYu9drKb47KJJx1wXMpU62UcWX71Ekr8LE BEISJgAruyzai0VM6NcjW9Mme181jdJ2eQkPltML8kf6qGZoVctkzY1XNDISIrHB 1b750M0dhOBBt9CUiaTEJFeEtURAVuWRIXCDL9aXWoXPiKN/0hQrCSPaUX9GXdFI WS35pO352cEPWPcEdF24Kyxv/ND5D9KrMr6PsIj/tRNC1fq2yAmOX98kVGlM0vKK ARn2wIfKf2GMGsZQEiapwS0/YXLD8gqbp3BgJj8ULuvg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=Wglu5G nY8cUU5MsVE52Mqf7DIgeeC+af+qaKm3pfGnQ=; b=Qxht94g1IhXx9oFTRy7jBJ 9TDeEOBqZc8pTh8UcNJkOOFVd97/ZsmzkIgwyroZZPrqjWDcOKnc9zxVouOSZkZJ UTP5Eiohe9kMLLoHxszYycEzPVZ4J/9VtceZEKRDmQu3RRU/7D9yaw45cZV5HaP1 BQQi1dSFh1bDjeqStuzDFWUxJck+0aqykKpoS7UYpZPVxLwiMCpHlLY4LLMmDCAk AJdQLrpYMSho0j/rjdDELjUAgG7A/y8ieGJ+rXDvCd6aEnk/d0Gzn4xNyk+4WGaV e6nTVU7FU+TvGbrnwpj29gXjhXKUE12rjqvXQtuBlW5+bMVS9qHpwS7B/jtXt3Ag == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddrheefgdegudcutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenuc fjughrpefhvffujghffgffkfggtgesghdtreertdertdenucfhrhhomhepofgrrhhiuhhs uceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheqnecukfhppeeivd drudeirddvvdeirddugedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehmsggrkhhkvges fhgrshhtmhgrihhlrdgtohhmnecuvehluhhsthgvrhfuihiivgeptd X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id B2A888005B; Sat, 13 Jul 2019 18:42:39 -0400 (EDT) From: Marius Bakke To: Mark H Weaver Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-Reply-To: <87d0id4zcz.fsf@netris.org> References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> <87ims8mds7.fsf@devup.no> <878st3mh93.fsf@devup.no> <87d0id4zcz.fsf@netris.org> User-Agent: Notmuch/0.29.1 (https://notmuchmail.org) Emacs/26.2 (x86_64-pc-linux-gnu) Date: Sun, 14 Jul 2019 00:42:37 +0200 Message-ID: <87r26tlfoi.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 35521 Cc: Giovanni Biscuolo , Platoxia , Chris Marusich , 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain Mark H Weaver writes: > Hi Marius, > >> Update: Berlin built mariadb twice on core-updates with this patch: >> >> --8<---------------cut here---------------start------------->8--- >> diff --git a/gnu/packages/databases.scm b/gnu/packages/databases.scm >> index 6bfeaad9a2..64bc0938b6 100644 >> --- a/gnu/packages/databases.scm >> +++ b/gnu/packages/databases.scm >> @@ -753,7 +753,7 @@ Language.") >> (with-directory-excursion "mysql-test" >> (invoke "./mtr" "--verbose" >> "--retry=3" >> - "--testcase-timeout=40" >> + "--testcase-timeout=80" >> "--suite-timeout=600" >> "--parallel" (number->string (parallel-job-count)) >> "--skip-test-list=unstable-tests")) >> --8<---------------cut here---------------end--------------->8--- >> >> Mark, Chris: Can you try this change with MariaDB 10.1.40 and see if it >> works for you? > > I tried it, but it made no difference on my Thinkpad X200, which still > fails the same way as before with 10.1.38: > > Failing test(s): tokudb_bugs.mdev4533 I was about to push this patch to core-updates: --=-=-= Content-Type: text/x-patch Content-Disposition: inline; filename=mariadb.patch Content-Transfer-Encoding: quoted-printable diff --git a/gnu/packages/databases.scm b/gnu/packages/databases.scm index 6bfeaad9a2..5d256b1af2 100644 =2D-- a/gnu/packages/databases.scm +++ b/gnu/packages/databases.scm @@ -706,9 +706,6 @@ Language.") ;; 2030-12-31. See for= details. "main.mysqldump" =20 =2D ;; XXX: Fails sporadically. =2D "innodb_fts.crash_recovery" =2D ;; FIXME: This test fails on i686: ;; -myisampack: Can't create/write to file (Errcode:= 17 "File exists") ;; +myisampack: Can't create/write to file (Errcode:= 17 "File exists) @@ -753,7 +750,10 @@ Language.") (with-directory-excursion "mysql-test" (invoke "./mtr" "--verbose" "--retry=3D3" =2D "--testcase-timeout=3D40" + ;; On x86_64 we need a long timeout because of = the + ;; TokuDB engine, whose individual test cases o= ften + ;; require more than 1 hour to complete on busy= hosts. + "--testcase-timeout=3D90" "--suite-timeout=3D600" "--parallel" (number->string (parallel-job-coun= t)) "--skip-test-list=3Dunstable-tests")) --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable Lo and behold, tokudb_bugs.mdev4533 failed when I tried it on Berlin. A couple of lines above "Failing test(s):" is the test output: =2D-8<---------------cut here---------------start------------->8--- CURRENT_TEST: tokudb_bugs.mdev4533=20=20=20=20=20=20=20=20=20=20=20=20=20= =20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20= =20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20= =20=20 safe_process[29262]: parent_pid: 23338=20=20=20=20=20=20=20=20=20=20=20=20= =20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20= =20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20 safe_process[29262]: Started child 29263, terminated: 0=20=20=20=20=20=20= =20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20=20= =20=20=20=20=20=20=20=20=20=20=20=20=20 mysqltest: At line 6: query 'CREATE TABLE t1 (a INT(11), b CHAR(8)) ENGINE= =3DTokuDB' failed: 1005: Ca n't create table `test`.`t1` (errno: 28 "No space left on device") The result from queries just before the failure was: DROP TABLE IF EXISTS t1;=20 CREATE TABLE t1 (a INT(11), b CHAR(8)) ENGINE=3DTokuDB; safe_process[29262]: Got signal 17, child_pid: 29263 safe_process[29262]: Killing child: 29263 safe_process[29262]: Child exit: 1 =2D-8<---------------cut here---------------end--------------->8--- Could it be that you don't have enough disk space for this test? Do you have the log file available still? Here is the test in question: https://github.com/MariaDB/server/blob/10.1/storage/tokudb/mysql-test/tokud= b_bugs/t/mdev4533.test As a side note, MariaDB is ~30 MiB bigger on x86_64 because of TokuDB. It would be great to move it to a separate output. --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl0qXl0ACgkQoqBt8qM6 VPoAgwgAyAmWPdhPlrD0NdjDrMZ41v/pa2Tq/ZIr9AP0aZRm7wtnB4PFiC/Gtr8m 2rR7jyQBwhpHQVEcD44VZomRoAKFp9C/rPKQccyyLHJT5MMSk8zxrk0Syi2Q9vRg Xpf9ctrgOApK0Rr5xQm+twpu8OQSqJcFx6/pdqh2tMjHGqbLDcUmqXBFLeH7mzCS jDQbxO4Ft3oFol6o8GT4FnfIYioizopgc9hD+gKeBrEkaXmpcM6eNDU36hFwinTL GhXljfzETvb+ue0TG2a4k2XpBzf8eL5u6CAbLkp6BwG9nDpjNQpf9u/0l1v+B7+s BR2GfMRWYbJI4wm6/T2tM2+D8qo5OA== =iAZj -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sat Jul 13 22:35:57 2019 Received: (at 35521) by debbugs.gnu.org; 14 Jul 2019 02:35:57 +0000 Received: from localhost ([127.0.0.1]:43685 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmUMn-0005pj-3m for submit@debbugs.gnu.org; Sat, 13 Jul 2019 22:35:57 -0400 Received: from world.peace.net ([64.112.178.59]:49366) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmUMk-0005pW-IY for 35521@debbugs.gnu.org; Sat, 13 Jul 2019 22:35:55 -0400 Received: from mhw by world.peace.net with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.89) (envelope-from ) id 1hmUMe-00081M-HX; Sat, 13 Jul 2019 22:35:48 -0400 From: Mark H Weaver To: Marius Bakke Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-Reply-To: <87r26tlfoi.fsf@devup.no> References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> <87ims8mds7.fsf@devup.no> <878st3mh93.fsf@devup.no> <87d0id4zcz.fsf@netris.org> <87r26tlfoi.fsf@devup.no> Date: Sat, 13 Jul 2019 22:35:10 -0400 Message-ID: <87ef2ts5r5.fsf@netris.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 35521 Cc: Giovanni Biscuolo , Platoxia , Chris Marusich , 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hi Marius, > Could it be that you don't have enough disk space for this test? Do you > have the log file available still? Yes, I have not only the log file, but also the failed build directory. My log file contains the same error in the 'tokudb_bugs.mdev4533' test: mysqltest: At line 6: query 'CREATE TABLE t1 (a INT(11), b CHAR(8)) ENGINE=TokuDB' failed: 1005: Can't create table `test`.`t1` (errno: 28 "No space left on device") After the build attempt, the failed build directory is ~3.4 GB, and I still have ~7.4 GB. That seems to imply that I had over 10 GB free before starting the build, which sounds about right. I don't have a separate /tmp partition. I will make another build attempt, and this time I will watch the disk utilization over time while the test suite is in progress. I should mention that I'm using Btrfs. Thanks, Mark From debbugs-submit-bounces@debbugs.gnu.org Sun Jul 14 00:43:38 2019 Received: (at 35521) by debbugs.gnu.org; 14 Jul 2019 04:43:38 +0000 Received: from localhost ([127.0.0.1]:43709 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmWMM-0002SK-Ko for submit@debbugs.gnu.org; Sun, 14 Jul 2019 00:43:38 -0400 Received: from world.peace.net ([64.112.178.59]:49536) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmWML-0002S5-6V for 35521@debbugs.gnu.org; Sun, 14 Jul 2019 00:43:37 -0400 Received: from mhw by world.peace.net with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.89) (envelope-from ) id 1hmWMF-0000Iu-5W; Sun, 14 Jul 2019 00:43:31 -0400 From: Mark H Weaver To: Marius Bakke Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-Reply-To: <87r26tlfoi.fsf@devup.no> References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> <87ims8mds7.fsf@devup.no> <878st3mh93.fsf@devup.no> <87d0id4zcz.fsf@netris.org> <87r26tlfoi.fsf@devup.no> Date: Sun, 14 Jul 2019 00:42:54 -0400 Message-ID: <87blxxrzu9.fsf@netris.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 35521 Cc: Giovanni Biscuolo , Platoxia , Chris Marusich , 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hello again, > Could it be that you don't have enough disk space for this test? Do you > have the log file available still? I made another build attempt on my X200, this time logging the output of "df --si" every 10 seconds. The free space started at ~11 GB free and never went below 7 GB, but the 'tokudb_bugs.mdev4533' test failed as before: "No space left on device" while trying to create the 'test' table. Mark From debbugs-submit-bounces@debbugs.gnu.org Sun Jul 14 07:10:56 2019 Received: (at submit) by debbugs.gnu.org; 14 Jul 2019 11:10:56 +0000 Received: from localhost ([127.0.0.1]:43905 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmcPA-0003Tm-47 for submit@debbugs.gnu.org; Sun, 14 Jul 2019 07:10:56 -0400 Received: from lists.gnu.org ([209.51.188.17]:46717) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmcP8-0003Tf-IO for submit@debbugs.gnu.org; Sun, 14 Jul 2019 07:10:54 -0400 Received: from eggs.gnu.org ([2001:470:142:3::10]:59839) by lists.gnu.org with esmtp (Exim 4.86_2) (envelope-from ) id 1hmcP7-00058y-My for bug-guix@gnu.org; Sun, 14 Jul 2019 07:10:54 -0400 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=0.8 required=5.0 tests=BAYES_50,FREEMAIL_FROM, RCVD_IN_DNSWL_NONE,URIBL_BLOCKED autolearn=disabled version=3.3.2 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1hmcP6-0005Lt-P2 for bug-guix@gnu.org; Sun, 14 Jul 2019 07:10:53 -0400 Received: from mout.web.de ([212.227.15.4]:35693) by eggs.gnu.org with esmtps (TLS1.0:DHE_RSA_AES_128_CBC_SHA1:16) (Exim 4.71) (envelope-from ) id 1hmcP6-0005Hv-C3 for bug-guix@gnu.org; Sun, 14 Jul 2019 07:10:52 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=web.de; s=dbaedf251592; t=1563102627; bh=MiCVqOviItBSSgzzE8ocwNiraKBzGYVtEkQ1ED0jzfY=; h=X-UI-Sender-Class:References:From:To:Cc:Subject:In-reply-to:Date; b=OJfNPPBC6dwmagkwU5UKKPCw9PR9ghsVpL0JkwPRbW6RD5JB0twjj/n96etF1uo/g sc0ueWCVj54dCIMUNsf4FIBzgp9UKsznFYuwGMwDUeosL+14IhyVVNOc8Qxbb8Wegd IPnfKtR7+/0tZCp4+tEntn2ThiKJpdlxrkSQeZpc= X-UI-Sender-Class: c548c8c5-30a9-4db5-a2e7-cb6cb037b8f9 Received: from fluss ([84.149.83.171]) by smtp.web.de (mrweb004 [213.165.67.108]) with ESMTPSA (Nemesis) id 0M8oFY-1hcjxn0TVs-00CAlQ; Sun, 14 Jul 2019 13:10:27 +0200 References: <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> <87ims8mds7.fsf@devup.no> <878st3mh93.fsf@devup.no> <87d0id4zcz.fsf@netris.org> <87r26tlfoi.fsf@devup.no> <87ef2ts5r5.fsf@netris.org> User-agent: mu4e 1.2.0; emacs 26.1 From: Arne Babenhauserheide To: bug-guix@gnu.org Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-reply-to: <87ef2ts5r5.fsf@netris.org> Date: Sun, 14 Jul 2019 13:10:14 +0200 Message-ID: <87sgr8x46h.fsf@web.de> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha256; protocol="application/pgp-signature" X-Provags-ID: V03:K1:r2otFFMHgyMewa45363MA6p4mM/NIC6kupqD7ge122164FdTAZW 2eQXtLrAYCGgbAy6kExmSwGF+W897HK1pu+s9wBIiLOfwllHt3GlpA/ZnchFpMJAtpE6iwV qjNRN6Up5EcyvRaNTsbg8VUe73BuLfyDuZljxUGdw1O2FU7KBubecoY/lX8yB1jatnAbI6N DTRGhWWX6guNhLQAdEAug== X-UI-Out-Filterresults: notjunk:1;V03:K0:GUeRwGzDRug=:J8ypZWDxFHz9sxvX/3wFL4 lXYQXOTGCsSLl+koEHQxSN01tGWrmFPp0MlzJh/QkZr/6uWjvsW793BfNPpx/v/ekO2np1g+1 Wfu8pT8+EXcpPy/AIAl4qsvamgOPuT4H9kpkV1g3L0i3zJnIK1qpduVX/OCGzgKJSMZYHb1jl TvVh/YsGW51I3S2IGuegmm2j3nfFOXykz8yBFKXfba9g1BK5cnEPdPFBdiOjcDKeIYUzYXFwS KwkXp8AfzXUqMSa8dFDvfV75zKMN0yzH597N0i4q5BtcW8aPrCv4SQzFdADGq85lwkMMJWZXr JvDhvkgIIFMCkUmpn4I/OYiw3xqKm8x4w7jBUhFzcMjeTkx6Z9bF8F+v3MHam4LsTqxAXuoFD FN6cfG/+piW5b/g7nX9MQ6+ZMWjL343ifSmHojPho6WolY936Dx8LXtfOcEpP+SorUroo2pk+ rjhA3NfWsto5OHecsF2DBa5a5WoaQxXYtLYq+bAKNLc1jpP4iC2MKPGRqekoGRs5X7GdRdAkw 9ecGTm7++QXUZjNoMdYkTUQdxsIYrEiWrtazKktIIwUI4A83s3W6lZcILHvF+nmReOC6Dgd6H CLS/U9NkcrjNWQvRdGHh/RO8xHEctCFz/YRY3Fd72SsBFg0eLYDXsbWBgLYzRTZm9gGmeoqgU CVQY= X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Received-From: 212.227.15.4 X-Spam-Score: -1.4 (-) X-Debbugs-Envelope-To: submit Cc: Marius Bakke , Platoxia , 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.4 (--) --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Hi Mark, Mark H Weaver writes: > My log file contains the same error in the 'tokudb_bugs.mdev4533' test: > > mysqltest: At line 6: query 'CREATE TABLE t1 (a INT(11), b CHAR(8)) ENG= INE=3DTokuDB' failed: 1005: Can't create table `test`.`t1` (errno: 28 "No s= pace left on device") > > After the build attempt, the failed build directory is ~3.4 GB, and I > still have ~7.4 GB. That seems to imply that I had over 10 GB free > before starting the build, which sounds about right. I don't have a > separate /tmp partition. =E2=80=A6 > I should mention that I'm using Btrfs. I use ext4, but I saw no space left on device errors when running guix lint. Since I had 700GiB free, that does not sound like real missing disk space, but rather that something else is wrong. Best wishes, Arne =2D- Unpolitisch sein hei=C3=9Ft politisch sein ohne es zu merken --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAEBCAAdFiEE801qEjXQSQPNItXAE++NRSQDw+sFAl0rDZkACgkQE++NRSQD w+uWOBAAtWI6FzsRSII26fEwQBtUYkgqExrC/fKDzYkkg7eqSNXQ3O/6jRxXBn6d g3QtrykV7DU3f6OwkaFiSUjMclyebc36Cp77Yshm+424fIis3g96MgKIf7snB5Gd vSOXGhqVE4V372LHTa7F3Aj9ENGm/rlXZoIhEQhwJtKfMcJfhrez9ot2JbO17BoX kokjVzAYgZ1vjlTeul86AAo/PZYpWyUMaOdrmcaVtL0tz4WhppTwyN5YNFwfAZtn HnTj43u9IjiwEzjk/XqepA2zg2IruQ2xdVdwbKCrp/PVqhMBrcSbBryoLuEYbqOC U23fZd0ULvS3F9UbzMNdoDezueyNvxPCEyaMRv+83JEKQ5VaYALR6FBZITU98Ehp v8OXst2h+PlUH2MuVpZG6P6AtMPPsygYJuMoMvSB5Ij2HYB9z0/s05wItdyuyH10 I4s6FKWgmhDSXzTiOoeGhEAiIBdt2rxJtuuFvkt2GTOSXjsY9gV44vLje/aEtXo9 zhuKwXGObPiRRXYxYzhiKbRSW2s3yypH8IwI37UrsgH/kP43DtHKBiHyF3RCuatX +YzKwp3cZkLK3dd0El6bDbTr3CWLP1hbnXJGkoRIJvX9ZI3M/P3t2K2FXE/oR+g/ HYkEjke176hBmanrL9SJpILcgv6NEaNv4YxqR7ftLBGZQ9c078uIswQBAQgAHRYh BN0ovebZh1yrzkqLHdzPDbMLwQVIBQJdKw2eAAoJENzPDbMLwQVIwEYD/iRwVL38 RbOFF5Fqj/VMLL+O2s7U5zKW4fRSFeOuG405kDPRmqHU8RGHVPriOF04v7FFey+H +Z0HMO03Qimn7JBOnItLgAlePrZihmBRBFXz6OK97SApGZVfUlg9Rt76V2OPk9So /yvJyiz1MVTXNDhUbHEPy7zN+LRHAzEt0ISH =j+/h -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sun Jul 14 11:58:55 2019 Received: (at 35521) by debbugs.gnu.org; 14 Jul 2019 15:58:55 +0000 Received: from localhost ([127.0.0.1]:45686 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmgtq-0000jH-Vq for submit@debbugs.gnu.org; Sun, 14 Jul 2019 11:58:55 -0400 Received: from mail-ed1-f49.google.com ([209.85.208.49]:43597) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmgtp-0000j3-Ly for 35521@debbugs.gnu.org; Sun, 14 Jul 2019 11:58:54 -0400 Received: by mail-ed1-f49.google.com with SMTP id e3so13169278edr.10 for <35521@debbugs.gnu.org>; Sun, 14 Jul 2019 08:58:53 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=S2pSLwpI4KX3mO90YLYrIV+zGYzPTA2v4isB1I+i6k8=; b=AAtlwfdEAzr61eNbo8+jtUtMMVOGCvf+rV08hIGkw3/6I8PaFCSd8GcIpNRFaF20LZ 8O9bMF4mHr2VAcOUCniT6OMEuTQtIx1zzpyu2/g/SzfX87pdGdD9WV6XILpBoZDrX44r uYoX5YTStGxHcPeuTMV2LQwgBH0S5GbDtgXEKbqaHOUk/VPjpF4GmgjZMvDJq7ldeN3M ie31nzNvL1HQuP1krkNaKIS5iQ4swxVxG77tbeTA/cnOIeyW5TuYQh1a7d1vJznPAe/6 0+suNDVSh2W+LI6z5LrMkeEfj5g0lp6OknYMVnrg+JdS1V8RQSVFHXv4AoPGwg1fki4g aIDA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=S2pSLwpI4KX3mO90YLYrIV+zGYzPTA2v4isB1I+i6k8=; b=TZQdI3WlWSq+ioh3tsjMUD2d7qVGMQ7NbYGys66JhYPD0c4FBWPEhvOeUzydxo22ii 31VPQt77Yz0/UhSfil4GEMkuvFCjCzXfyGWeOXf2T0WOgaSfZt+lUsbJ4b4L3c+h3/Ex 8LUWffI3Ly26ymv4ImP+PrOsZtNbRKYSECEWs9FDOifSjAIp/FF+jnbf5BIVjgfTbmVV UKUVLKHjL7awk3BmfAUs3YIls4LOAxPdJ7otjDG5stqfzvK2rZtlZyQ/MZwK8L/GW8yW 07GECKB47G0L4fDpYf+FKYU+8/8BKq9t+rnz9fuS/3Li3g6gKNl4PFKdsy0uXoEclpNo H8eg== X-Gm-Message-State: APjAAAWeXFttw2BKOyM8tDmUTAt59PFFNZ3zStTxaG2/6OZkeFVIOlYg 8Qzd2ajmtNQbCc0ElHyLyDzmBQYXpASW2Klszg== X-Google-Smtp-Source: APXvYqygz+nLyWS+BMosUYoEOnVrlAzvwY5r9byHa+FCHtHMXmWUwyF4UfGNc8/cvY1mosDEUHDWo+a19jr+4341xho= X-Received: by 2002:a17:906:304d:: with SMTP id d13mr16134747ejd.99.1563119927810; Sun, 14 Jul 2019 08:58:47 -0700 (PDT) MIME-Version: 1.0 References: <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> <87ims8mds7.fsf@devup.no> <878st3mh93.fsf@devup.no> <87d0id4zcz.fsf@netris.org> <87r26tlfoi.fsf@devup.no> <87ef2ts5r5.fsf@netris.org> <87sgr8x46h.fsf@web.de> In-Reply-To: <87sgr8x46h.fsf@web.de> From: =?UTF-8?Q?G=C3=A1bor_Boskovits?= Date: Sun, 14 Jul 2019 17:58:33 +0200 Message-ID: Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux To: Arne Babenhauserheide Content-Type: multipart/alternative; boundary="00000000000009df4c058da63846" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 35521 Cc: platoxia@protonmail.com, 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --00000000000009df4c058da63846 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Hello, Arne Babenhauserheide ezt =C3=ADrta (id=C5=91pont: 2019. = j=C3=BAl. 14., Vas 13:11): > Hi Mark, > > Mark H Weaver writes: > > My log file contains the same error in the 'tokudb_bugs.mdev4533' test: > > > > mysqltest: At line 6: query 'CREATE TABLE t1 (a INT(11), b CHAR(8)) > ENGINE=3DTokuDB' failed: 1005: Can't create table `test`.`t1` (errno: 28 = "No > space left on device") > Could you test using df -i if the file system is not running out of inodes? That is another reason when the no space left on device error is reported. > > > After the build attempt, the failed build directory is ~3.4 GB, and I > > still have ~7.4 GB. That seems to imply that I had over 10 GB free > > before starting the build, which sounds about right. I don't have a > > separate /tmp partition. > =E2=80=A6 > > I should mention that I'm using Btrfs. > > I use ext4, but I saw no space left on device errors when running guix > lint. Since I had 700GiB free, that does not sound like real missing > disk space, but rather that something else is wrong. > > Best wishes, > Arne > -- > Unpolitisch sein > hei=C3=9Ft politisch sein > ohne es zu merken > Best regards, g_bor > --00000000000009df4c058da63846 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable

Hello,

Arne Babenh= auserheide <arne_bab@web.de> e= zt =C3=ADrta (id=C5=91pont: 2019. j=C3=BAl. 14., Vas 13:11):
Hi Mark,

Mark H Weaver <mhw@netris.org> writes:
> My log file contains the same error in the 'tokudb_bugs.mdev4533&#= 39; test:
>
>=C2=A0 =C2=A0mysqltest: At line 6: query 'CREATE TABLE t1 (a INT(11= ), b CHAR(8)) ENGINE=3DTokuDB' failed: 1005: Can't create table `te= st`.`t1` (errno: 28 "No space left on device")

Could you test usin= g df -i if the file system is not running out of inodes? That is another re= ason when the no space left on device error is reported.

>
> After the build attempt, the failed build directory is ~3.4 GB, and I<= br> > still have ~7.4 GB.=C2=A0 That seems to imply that I had over 10 GB fr= ee
> before starting the build, which sounds about right.=C2=A0 I don't= have a
> separate /tmp partition.
=E2=80=A6
> I should mention that I'm using Btrfs.

I use ext4, but I saw no space left on device errors when running guix
lint. Since I had 700GiB free, that does not sound like real missing
disk space, but rather that something else is wrong.

Best wishes,
Arne
--
Unpolitisch sein
hei=C3=9Ft politisch sein
ohne es zu merken
Best regard= s,
g_bor
--00000000000009df4c058da63846-- From debbugs-submit-bounces@debbugs.gnu.org Sun Jul 14 13:17:14 2019 Received: (at 35521) by debbugs.gnu.org; 14 Jul 2019 17:17:14 +0000 Received: from localhost ([127.0.0.1]:45794 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmi7e-0001BI-47 for submit@debbugs.gnu.org; Sun, 14 Jul 2019 13:17:14 -0400 Received: from wout3-smtp.messagingengine.com ([64.147.123.19]:58797) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmi7b-0001B3-3X for 35521@debbugs.gnu.org; Sun, 14 Jul 2019 13:17:12 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.west.internal (Postfix) with ESMTP id D10DB464; Sun, 14 Jul 2019 13:17:04 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Sun, 14 Jul 2019 13:17:05 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm3; bh=TcZMHL7iGY1pZClNMZr+ZmQGSa LIwu8oQIp2nBzjZGU=; b=bidiFNB1ua0/EopyBU74tE9zX2hXQWWV3ZJ33MVhh5 advhfdRkavxe8w2s49XPDKNDSMr9jOrURcfkIq3bs3Mzsp0vgiCdpCuWRfO5r1lf PnnLMqKrYXO5+jAIV5H2OisnanHkYdGzMPdhtcVI4djikMWTTguUNd+u/YazAviu eJP0sTTu+kw1lOCgLXELNYG9p+x7Pc/qm3lV88pYf+m/Er/MLW0j9j6q0IupMvm3 +GWWFLCZ9MjPTgAXgUGJT/b3z/vBADxHStlvda9Sv4bIiXJDX5KhzvD2sFZeIDzD LItrtT6FiH+KbfGbtukFfbreFb4W0vrZ3ByfvuvzMQKQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=TcZMHL 7iGY1pZClNMZr+ZmQGSaLIwu8oQIp2nBzjZGU=; b=banuAjchwajOmbwINlxu3l eFrVpamPxONlmPWIUw5UqSTyIoKuiDhs7ErLIi0eJ/zKwv9GPKbRFrNe2RoX5Fef t6TsfJ2fhqD//F2K2k+p1CuCFjmIiZCSxBk+b95Idf0xJkhrb2XcMfHKSAM5Kg2b JmpCZY179v00R7XMl6foL1i9H7A3n4yzuDYQvkAAk38sT2Ypyib/B2bAxWTfrUr1 cVmf5JolK/NjsPifyydofbdSLFEEnxUpIM3/NivmCAnVH5TAkm7QosAvi37XtLDg t+NdWnfkNGmygUwnA8CQGkmaxtcWbU8UrtuGG3uTO0ZxYspBF74jqAxtLKAeqHFg == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddrheehgdduudefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmne cujfgurhephffvufgjfhgffffkgggtsehgtderredtredtnecuhfhrohhmpeforghrihhu shcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeenucfkphepie dvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgv sehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 59FA18005B; Sun, 14 Jul 2019 13:17:03 -0400 (EDT) From: Marius Bakke To: Mark H Weaver Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-Reply-To: <87blxxrzu9.fsf@netris.org> References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> <87ims8mds7.fsf@devup.no> <878st3mh93.fsf@devup.no> <87d0id4zcz.fsf@netris.org> <87r26tlfoi.fsf@devup.no> <87blxxrzu9.fsf@netris.org> User-Agent: Notmuch/0.29.1 (https://notmuchmail.org) Emacs/26.2 (x86_64-pc-linux-gnu) Date: Sun, 14 Jul 2019 19:17:01 +0200 Message-ID: <87d0ic7cz6.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 35521 Cc: Giovanni Biscuolo , Platoxia , Chris Marusich , 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain Mark H Weaver writes: > Hello again, > >> Could it be that you don't have enough disk space for this test? Do you >> have the log file available still? > > I made another build attempt on my X200, this time logging the output of > "df --si" every 10 seconds. The free space started at ~11 GB free and > never went below 7 GB, but the 'tokudb_bugs.mdev4533' test failed as > before: "No space left on device" while trying to create the 'test' > table. Thanks for testing. Out of curiousity I tried to enable TokuDB on my server: MariaDB [(none)]> INSTALL PLUGIN tokudb SONAME 'ha_tokudb'; ERROR 2006 (HY000): MySQL server has gone away Ouch. Unfortunately the Guix service does not seem to enable any kind of logging, so I haven't dug further. Loading other plugins seems to work though. I am currently trying this patch on Berlin: --=-=-= Content-Type: text/x-patch Content-Disposition: inline; filename=tokudb.diff Content-Transfer-Encoding: quoted-printable diff --git a/gnu/packages/databases.scm b/gnu/packages/databases.scm index 6bfeaad9a2..c17031bb2c 100644 =2D-- a/gnu/packages/databases.scm +++ b/gnu/packages/databases.scm @@ -659,6 +659,10 @@ Language.") ;; For now, disable the features that that use libarchive (xtraba= ckup). "-DWITH_LIBARCHIVE=3DOFF" =20 + ;; FIXME: Disable the TokuDB engine, because its test suite frequ= ently + ;; fails, and loading it crashes the server: . + "-DTOKUDB_OK=3DOFF" + ;; Ensure the system libraries are used. "-DWITH_JEMALLOC=3Dyes" "-DWITH_PCRE=3Dsystem" @@ -706,9 +710,6 @@ Language.") ;; 2030-12-31. See for= details. "main.mysqldump" =20 =2D ;; XXX: Fails sporadically. =2D "innodb_fts.crash_recovery" =2D ;; FIXME: This test fails on i686: ;; -myisampack: Can't create/write to file (Errcode:= 17 "File exists") ;; +myisampack: Can't create/write to file (Errcode:= 17 "File exists) @@ -786,7 +787,6 @@ Language.") ("libxml2" ,libxml2) ("ncurses" ,ncurses) ("pcre" ,pcre) =2D ("snappy" ,snappy) ("xz" ,xz) ("zlib" ,zlib))) (propagated-inputs --=-=-= Content-Type: text/plain WDYT? There has been some activity around TokuDB in later versions of MariaDB, maybe we can enable it again with 10.4. For now, I think we should just disable it. --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl0rY40ACgkQoqBt8qM6 VPp6yQgAyfNo15rnVRXpzjKPwFLHL8PoDfIl6zEV3KkjI0m5Z3PpKot+lQR1h+gl 0angHzQZ22XBwd3GxMK9mkh575eWagJlxEYygbHHWwiXDfKpLXlMe4qJFnQD4bxY o0iG5iaFYG7Bsv2Zs4IO4pp35jJflzsITM+w/MfiNNrLy1OV8kOMwXi8JkDAtyQv C3DqeuTbm2zOoSAw9CZZQH01vwBPe0PSFLKd0oU1Lor9ybzF7SxzQwjBcFAGsqQv wNEUD3wSvMiTcX0goTtvqzBAZMf9kRq7MsXpckiFSRZi8k+6C8okQzxu7TL9Zpvp vEhF+8Jz9iqve1oj6Gb7h92gaFyHxA== =09ft -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sun Jul 14 14:35:18 2019 Received: (at 35521) by debbugs.gnu.org; 14 Jul 2019 18:35:18 +0000 Received: from localhost ([127.0.0.1]:45963 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmjLC-0003fI-FR for submit@debbugs.gnu.org; Sun, 14 Jul 2019 14:35:18 -0400 Received: from world.peace.net ([64.112.178.59]:50294) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmjL9-0003ew-NG for 35521@debbugs.gnu.org; Sun, 14 Jul 2019 14:35:16 -0400 Received: from mhw by world.peace.net with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.89) (envelope-from ) id 1hmjL3-00061S-LY; Sun, 14 Jul 2019 14:35:09 -0400 From: Mark H Weaver To: Marius Bakke Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-Reply-To: <87d0ic7cz6.fsf@devup.no> References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> <87ims8mds7.fsf@devup.no> <878st3mh93.fsf@devup.no> <87d0id4zcz.fsf@netris.org> <87r26tlfoi.fsf@devup.no> <87blxxrzu9.fsf@netris.org> <87d0ic7cz6.fsf@devup.no> Date: Sun, 14 Jul 2019 14:34:24 -0400 Message-ID: <87a7dgzcr3.fsf@netris.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 35521 Cc: Giovanni Biscuolo , Platoxia , Chris Marusich , 35521@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hi Marius, Marius wrote: > There has been some activity around TokuDB in later versions of MariaDB, > maybe we can enable it again with 10.4. For now, I think we should just > disable it. Disabling TokuDB for now sounds like a fine option. Thanks very much for looking into it. Mark From debbugs-submit-bounces@debbugs.gnu.org Sun Jul 14 17:15:54 2019 Received: (at 35521-done) by debbugs.gnu.org; 14 Jul 2019 21:15:54 +0000 Received: from localhost ([127.0.0.1]:46096 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmlqc-0008NC-EK for submit@debbugs.gnu.org; Sun, 14 Jul 2019 17:15:54 -0400 Received: from wout5-smtp.messagingengine.com ([64.147.123.21]:39231) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1hmlqa-0008N0-A9 for 35521-done@debbugs.gnu.org; Sun, 14 Jul 2019 17:15:53 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.west.internal (Postfix) with ESMTP id 3729C423; Sun, 14 Jul 2019 17:15:46 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Sun, 14 Jul 2019 17:15:46 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm3; bh=JVXXE7WNSqtTG2RqnqBGCeWaJF a4QBH/OGWjKzM9r5U=; b=rJIOVQjX5WokxlyVNqq/v21z8tSGNFN1htKL1w0J4d ANvT2qwaOl75ji8J4iVXSAdTOxDmIFVjdafxav+NMa9j5xO0tl1lJbMi2hytBLLU Bgm9sJLY7KbqumFcDotk74HBYJtu7d267tR2PJZeV53dMQkRb2GTJBho2pa4pFEG 0sJf9tPmtSRrWwf8N7qDzOHlJtGWraIkUomk2v67D7BJkIYlD+egBfwGcUsVYhwc uKaYgcnp19V/x66MqYBjhLhgq6yMn82xQuczInZvpQYWVzOa9GtnSUiLSrbGQsR8 /LW5r2BzKJ36AdIeAhNiDY2i6KwkmsuUQshKvFC4tRtw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=JVXXE7 WNSqtTG2RqnqBGCeWaJFa4QBH/OGWjKzM9r5U=; b=wlr+EPdPP+MnDIN+iVHfck iCQG6Cll1fi8QPqjEyzu+SBpILxtYa4HqDvPJw0kQrBeksiyiDM6j+/hAai2YHKf isMTRrqm7Op88xKYd7UsvYWzJe/dFKUW8uei2268DmvXyWfBWxFE34bND1i5Yyu0 ypnya6dN7nPtA4XMe2iF2SU7k5pN0+0+P9WlqXsvt5P2C/hHcllr3I3s4pEcyXY1 ok/+KApmNsUvbAROOvs/hQeMsf8iPKeAPKifAs8yyUU5osfWXIYXF11dRM9yCTFx ZAQXut8zE4e4xInWaXAHb1N2ZUprdCMZw4lERgKPtc5+qUNbZ7rfBLh9003sEh6Q == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddrheehgdduiedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmne cujfgurhephffvufgjfhgffffkgggtsehgtderredtredtnecuhfhrohhmpeforghrihhu shcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeenucfkphepie dvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgv sehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id F2CB980059; Sun, 14 Jul 2019 17:15:44 -0400 (EDT) From: Marius Bakke To: Mark H Weaver Subject: Re: bug#35521: Mariadb test suite failures on x86_64-linux In-Reply-To: <87a7dgzcr3.fsf@netris.org> References: <87tveemt19.fsf@netris.org> <87tveemt19.fsf@netris.org> <87h8aemrow.fsf@netris.org> <87pnmil8dq.fsf_-_@gmail.com> <87wogpn6f7.fsf@devup.no> <87ef2xlgmb.fsf@netris.org> <87ims8mds7.fsf@devup.no> <878st3mh93.fsf@devup.no> <87d0id4zcz.fsf@netris.org> <87r26tlfoi.fsf@devup.no> <87blxxrzu9.fsf@netris.org> <87d0ic7cz6.fsf@devup.no> <87a7dgzcr3.fsf@netris.org> User-Agent: Notmuch/0.29.1 (https://notmuchmail.org) Emacs/26.2 (x86_64-pc-linux-gnu) Date: Sun, 14 Jul 2019 23:15:43 +0200 Message-ID: <875zo471xc.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 35521-done Cc: Giovanni Biscuolo , Platoxia , Chris Marusich , 35521-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain Mark H Weaver writes: > Hi Marius, > > Marius wrote: >> There has been some activity around TokuDB in later versions of MariaDB, >> maybe we can enable it again with 10.4. For now, I think we should just >> disable it. > > Disabling TokuDB for now sounds like a fine option. > Thanks very much for looking into it. Done in bba7a77ed9ad826bcdc6d9b8a183d66a23229501. Thanks for reporting the issue. Thinking forward, to trim the mariadb package, maybe it's possible to build all plugins as separate derivations, and let the user choose a union when setting up the service. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl0rm38ACgkQoqBt8qM6 VPrkxAf9F6aDUmH/ZYOu8LS5PA/uOM/j2ZUjYSesi41Jgn5i2SjqVHAKMoCAn2uK H59nRj8SIt0wOdYKcX4CZyM3iP7afIrWK0bMDPH4rQeMeUloC4qhvan3PyIGb6+S gIiV/Ksq58pK0xX7NGPoFIt0OuY4fFtqiIiiM5O1GDOOTpf8fWY5+WBugHIK+0WR Uj9fGFLnBfBMJPtCwvCN1HtVDWg2S11e6JVvxwDrAyaIstoa3FlZTNnMBR6xZbau huKKg/y2GQGfqUHCSWep42kj2QO/yuTBu5ZoOu5eSOp9+BLeojhWLN9S5NtakQ+7 dXNmY9BnrZ7dIytebZKsJkVcqmd6JQ== =aOnv -----END PGP SIGNATURE----- --=-=-=-- From unknown Thu Aug 14 22:19:36 2025 Received: (at fakecontrol) by fakecontrolmessage; To: internal_control@debbugs.gnu.org From: Debbugs Internal Request Subject: Internal Control Message-Id: bug archived. Date: Mon, 12 Aug 2019 11:24:05 +0000 User-Agent: Fakemail v42.6.9 # This is a fake control message. # # The action: # bug archived. thanks # This fakemail brought to you by your local debbugs # administrator