From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:12:30 2018 Received: (at submit) by debbugs.gnu.org; 11 Dec 2018 01:12:30 +0000 Received: from localhost ([127.0.0.1]:42365 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWb8-0001FU-5q for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:12:30 -0500 Received: from eggs.gnu.org ([208.118.235.92]:55944) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWb6-0001FF-7i for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:12:28 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gWWaz-0007KQ-4j for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:12:23 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=0.8 required=5.0 tests=BAYES_50,FREEMAIL_FROM autolearn=disabled version=3.3.2 Received: from lists.gnu.org ([2001:4830:134:3::11]:45829) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1gWWax-0007JY-TS for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:12:21 -0500 Received: from eggs.gnu.org ([2001:4830:134:3::10]:37306) by lists.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1gWWaw-0004ae-QX for guix-patches@gnu.org; Mon, 10 Dec 2018 20:12:19 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gWWar-0007CE-9H for guix-patches@gnu.org; Mon, 10 Dec 2018 20:12:18 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:39937) by eggs.gnu.org with esmtps (TLS1.0:DHE_RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1gWWap-000796-8u for guix-patches@gnu.org; Mon, 10 Dec 2018 20:12:11 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 77C0A200CF for ; Mon, 10 Dec 2018 20:12:07 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:12:07 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:mime-version :content-transfer-encoding; s=fm1; bh=t1ih1dqmcSWkKutVBr/8J2oJw5 aCDHoFrXP+SSl6LBo=; b=Acx0SuCpG74tlOGNrQUxjf7Z4uBZ2o0XLkfHooQE42 dcMocKjQHTzqSDr1vT2pk/eQWeqNX3Zg0gv1Yi8832UPikIYNXCBJ3cZ0cpU2X0U FFLBmx+O6AMUCph9czenb1LgUYc52pzVq6O8IsT8w1HrmbhYSrONtS28kmM3GQIU 3SgZbN6Hz3OqpnloECf7R7Dct7CPDBP0WMUlpPJSkXvgfwAiwBd+PLwYTEIyxUfa KPbSMqP58/ISMt1o1ZyIWps8RPWje1gYFYO6BmkAXRQvWfRGcwf+0ftsezAY9lVS Q+YSszKEuOaQHUKzPWYcjgLOjdkzJjIs7UlZZ+ylMSrg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :message-id:mime-version:subject:to:x-me-proxy:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; bh=t1ih1dqmcSWkKutVB r/8J2oJw5aCDHoFrXP+SSl6LBo=; b=XWdkWKiIYHf6fssQttdZ1CYuYws0OM/eb QtAvzpAyfI6CqxPsDODG0+wJDfTAZu9yg64Fe79dVh+zMvfqab2LB5EzQE667F2P Z4IKo+yhG12Y8bayCAUkFPa4mEmu5WZunaowDRP4n+3wd5PF/Kq6OpOP4V7+KYHe LLgN1nspU+H2/KjRR2NPkUmaIsuzML9yc8MY8e9+RqAD440gY2k6G1T+Fq3Fscgl ge0FBV7O3v/h93ZiznKeJz0pWrrSivz4x5wrILcm8+gDJ9QKAtcyY2xA1nf49lVL Y0zeiSGF5vsWN5t2Xu1dUhBhzIz4BX/m6hflM+Nmtv22ApUTadftg== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffoggfgsedtkeertdertddtnecuhfhrohhmpeforg hrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeenucfk phepiedvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmhgsrg hkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id C9440E4430 for ; Mon, 10 Dec 2018 20:12:06 -0500 (EST) From: Marius Bakke To: guix-patches@gnu.org Subject: [PATCH staging 00/23] Glib/GTK+ updates Date: Tue, 11 Dec 2018 02:12:05 +0100 Message-Id: <20181211011205.15542-1-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] [fuzzy] X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.6.x X-Received-From: 2001:4830:134:3::11 X-Spam-Score: -4.3 (----) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -5.3 (-----) This late series adds around 1000 rebuilds to the current staging branch. They also bring many of the GNOME family libraries to the latest upstream versions. The good: * Latest Ghostscript, Poppler, Harfbuzz, GnuTLS, and other security-critical libraries. Some of these have changed build systems, or ABIs, so future patching is easier. * Most/all regressions are already fixed. The bad: * GCC7 is now in the closure of cURL (via nghttp2). The ugly: * 37 files changed, 1225 insertions(+), 996 deletions(-) * Total rebuild count for staging is around 4700 packages. WDYT? Marius Bakke (23): gnu: cups-filters: Update to 1.21.5. gnu: libjpeg-turbo: Update to 2.0.1. gnu: harfbuzz: Update to 2.2.0. gnu: poppler: Update to 0.72.0. gnu: D-Bus: Update to 1.12.12. gnu: glib: Remove obsolete variable. gnu: glib: Update to 2.56.3. gnu: pixman: Update to 0.36.0. gnu: cairo: Update to 1.16.0. gnu: libqmi: Update to 1.20.2. gnu: curl: Remove replacement for 7.62.0. gnu: ghostscript: Update to 9.26. gnu: icu4c: Update to 63.1. gnu: tzdata-for-tests: Update to 2018g. gnu: nghttp2: Update to 1.35.1. gnu: nettle: Update to 3.4.1. gnu: cyrus-sasl: Update to 2.1.27. gnu: jansson: Update to 2.12. gnu: GnuTLS: Update to 3.6.5. gnu: libuv: Update to 1.24.0. gnu: CMake: Update to 3.13.1. gnu: meson: Update to 0.49.0. gnu: glib-networking: Update to 2.59.1. gnu/local.mk | 12 +- gnu/packages/base.scm | 18 +- gnu/packages/build-tools.scm | 4 +- gnu/packages/cmake.scm | 4 +- gnu/packages/cups.scm | 4 +- gnu/packages/curl.scm | 18 +- gnu/packages/cyrus-sasl.scm | 9 +- gnu/packages/emacs.scm | 10 +- gnu/packages/freedesktop.scm | 4 +- gnu/packages/ghostscript.scm | 8 +- gnu/packages/glib.scm | 11 +- gnu/packages/gnome.scm | 73 +-- gnu/packages/gtk.scm | 10 +- gnu/packages/icu4c.scm | 4 +- gnu/packages/image.scm | 4 +- gnu/packages/inkscape.scm | 19 +- gnu/packages/libevent.scm | 4 +- gnu/packages/libreoffice.scm | 39 +- gnu/packages/nettle.scm | 4 +- .../patches/cairo-CVE-2016-9082.patch | 122 ----- .../patches/cairo-setjmp-wrapper.patch | 78 --- .../patches/cyrus-sasl-CVE-2013-4122.patch | 130 ----- .../patches/ghostscript-CVE-2018-16509.patch | 193 ------- .../patches/ghostscript-bug-699708.patch | 160 ------ .../glib-networking-ssl-cert-file.patch | 29 - .../patches/gnutls-skip-pkgconfig-test.patch | 24 - .../patches/inkscape-poppler-compat3.patch | 499 ++++++++++++++++++ .../patches/poppler-CVE-2018-19149.patch | 80 --- .../texlive-bin-luatex-poppler-compat.patch | 318 +++++++++++ .../texlive-bin-pdftex-poppler-compat.patch | 188 +++++++ .../texlive-bin-xetex-poppler-compat.patch | 31 ++ gnu/packages/pdf.scm | 13 +- gnu/packages/scribus.scm | 51 +- gnu/packages/tex.scm | 10 +- gnu/packages/tls.scm | 17 +- gnu/packages/web.scm | 15 +- gnu/packages/xdisorg.scm | 4 +- 37 files changed, 1225 insertions(+), 996 deletions(-) delete mode 100644 gnu/packages/patches/cairo-CVE-2016-9082.patch delete mode 100644 gnu/packages/patches/cairo-setjmp-wrapper.patch delete mode 100644 gnu/packages/patches/cyrus-sasl-CVE-2013-4122.patch delete mode 100644 gnu/packages/patches/ghostscript-CVE-2018-16509.patch delete mode 100644 gnu/packages/patches/ghostscript-bug-699708.patch delete mode 100644 gnu/packages/patches/glib-networking-ssl-cert-file.patch delete mode 100644 gnu/packages/patches/gnutls-skip-pkgconfig-test.patch create mode 100644 gnu/packages/patches/inkscape-poppler-compat3.patch delete mode 100644 gnu/packages/patches/poppler-CVE-2018-19149.patch create mode 100644 gnu/packages/patches/texlive-bin-luatex-poppler-compat.patch create mode 100644 gnu/packages/patches/texlive-bin-pdftex-poppler-compat.patch create mode 100644 gnu/packages/patches/texlive-bin-xetex-poppler-compat.patch -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:26 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:26 +0000 Received: from localhost ([127.0.0.1]:42375 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWcz-0001JY-Nr for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:26 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:58447) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWcy-0001JE-Ky for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:25 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id CE10521D23 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:18 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:18 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:mime-version :content-transfer-encoding; s=fm1; bh=NYGCWK8RhgGFpI5Ng7ct99nxUc gOq91LTWoYAWwtdpk=; b=n0BN3RxS5V4k7M6XtHhH86kX9JWLiVZ/bMDm4xlDtl wTBPcWLAgPNaGv3ZVr0ZQgUhNthpmvniV2/R5vF5pCuDQwuzI9TQggLj33R040D8 6T5/4arqG4LlgTMSRxrIQAQ/pa2p7xpGIji3bDmTYAkItRqBB0r1tckGw0zHIrku fp0+8cdBd2KlNdwQ7qfeCiFl0+Zx/sAmWEZXCUBzhItDFFI0nJ2xERe/3MaYZMva hHpQDSMuhZkG21oj2nAJmuF+xOegp0g5zvPO3+q2oSYWxY935a+sRPExCyrmw6Tw qkZiYBDwTaN4LgRAAqWThFpAfDjWoOEg3yY4jSmQ7biA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :message-id:mime-version:subject:to:x-me-proxy:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; bh=NYGCWK8RhgGFpI5Ng 7ct99nxUcgOq91LTWoYAWwtdpk=; b=sE+p+UHYqqz1dEG92qMlFdZWCbrKAKaGp VyxrSbBhZaBu5qUpBVa8vtDY/FtXV0f0ZaIqXTUm7C+zkAOkD9lIDapHpRu/xlXP W5JvSu+UucK5gFSCdpsXRaE12n9+9FkzOCoRiFw6fqLCYQAEHqFfp2OwP2KZANzc GxsS5F4WZt7YTWddwwhbycEJFkBg1ZNVxzGr1SrT+l1c1U1UyL+Tvl5imVtso8dk wQKmrG2Ct525cfI/ymuHjCD6Iu+Bfoq/toc+jFd8OGqyYHEhBzC1e9uD9rcEy2EN RpkQTarls5aOEf2cOokGAO8gQev9CZU49qF5Ig8faVu2soGTQgZLA== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffoggfgsedtkeertdertddtnecuhfhrohhmpeforg hrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeenucfk phepiedvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmhgsrg hkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpedu X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 18E3DE4430 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:17 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 01/23] gnu: cups-filters: Update to 1.21.5. Date: Tue, 11 Dec 2018 02:13:54 +0100 Message-Id: <20181211011416.15902-1-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/cups.scm (cups-filters): Update to 1.21.5. --- gnu/packages/cups.scm | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/gnu/packages/cups.scm b/gnu/packages/cups.scm index acc58a840e..5eb66feed5 100644 --- a/gnu/packages/cups.scm +++ b/gnu/packages/cups.scm @@ -53,7 +53,7 @@ (define-public cups-filters (package (name "cups-filters") - (version "1.21.0") + (version "1.21.5") (source(origin (method url-fetch) (uri @@ -61,7 +61,7 @@ "cups-filters-" version ".tar.xz")) (sha256 (base32 - "0fs90xx9i4h8gbpligf5kkh21llv4kf5g3bgfbx4z272xkm7bsfi")) + "0azq9j7kqy18g6vgmvrbw8i4mcqdp3cbgh7q79x1b8p92w4si6rq")) (modules '((guix build utils))) (snippet ;; install backends, banners and filters to cups-filters output -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:28 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:28 +0000 Received: from localhost ([127.0.0.1]:42380 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWd2-0001Jy-Cu for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:28 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:45107) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWcz-0001JI-JU for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:25 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 5346F21E44 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:20 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:20 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=Gbozb2WxIr/Fr Gfp7V+X57G3Xs1mxO2pp+hjcAkhy58=; b=Cuh8L8eoKN4xJnpcVNuseMdQozvJI /7Yv3wvjfcOwYwWwgH/iKGS8rvWBfAhSnRSBzFK8SKGHSXE3HR2qyq+PEH681BIv zPiJY+M9mC9EA7ZVY3poMYgUKIphY5z5l/WEmse46a/7ViJWG/LNTbXNkINkcA/h K0Ua3R1uBKifedk4HZregT81FvBq0XiAoMrbqiETEcEYhhsGLIUwzDDL+AKXwBhe h/K9DdqEMG4f52w43AgXIJuq+EHNWv8qVuCLKeP+z7Ew4Jo7Ozkev8VNezFONiU4 PyOc2TzkSI4Z3Ed9ZE+EzSJmxQQnsUk2DvQuR4D2hCYbBYKXirL0b5U0Q== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=Gbozb2WxIr/FrGfp7V+X57G3Xs1mxO2pp+hjcAkhy58=; b=i00/YZIz KICGXO3Wasq/lCpMRHUm51MzYifdHQ/ogfxYWHacjDz0YRftAcRiT5L3U4A+ACF1 sJCTJHbrByp4fYEgg+dqxZMYW9UqlGsIUTAC0F/1L+8Cp41eOIUQH4IiV9OvK6lw FtHCgZcq3ecT0u8DK7lRFGwZv3Dd8EGmYzbGb3rbbcJEG4tNiZhmxHe4SuzkhAKd iRYhjj/yD3fjlw7Fgr4nctaPclSNz2SC2/QvPoJp95qJPdeNsgjhFpcREF+4PI8V 7zwhOnBhj9d7lIpnernJeI0Rh1K1uA4V0sJ6LkagVLaYJFRn2dsEpabhq40PlpRh maIu6mD47BLrBQ== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucfkphepiedvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmh gsrghkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id A24CDE4430 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:19 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 02/23] gnu: libjpeg-turbo: Update to 2.0.1. Date: Tue, 11 Dec 2018 02:13:55 +0100 Message-Id: <20181211011416.15902-2-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/image.scm (libjpeg-turbo): Update to 2.0.1. --- gnu/packages/image.scm | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/gnu/packages/image.scm b/gnu/packages/image.scm index 207faede91..92447c23e2 100644 --- a/gnu/packages/image.scm +++ b/gnu/packages/image.scm @@ -1297,14 +1297,14 @@ PNG, and performs PNG integrity checks and corrections.") (define-public libjpeg-turbo (package (name "libjpeg-turbo") - (version "2.0.0") + (version "2.0.1") (source (origin (method url-fetch) (uri (string-append "mirror://sourceforge/" name "/" version "/" name "-" version ".tar.gz")) (sha256 (base32 - "0s48zz6awd493hmb200abmsizh68fh1jmz98r41n4c8dbl87d23p")))) + "1zv6z093l3x3jzygvni7b819j7xhn6d63jhcdrckj7fz67n6ry75")))) (build-system cmake-build-system) (native-inputs `(("nasm" ,nasm))) -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:28 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:29 +0000 Received: from localhost ([127.0.0.1]:42382 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWd2-0001K0-Mo for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:28 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:47721) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWd0-0001JK-S6 for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:27 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id CDE8221785 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:21 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:21 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=3A/qG9SxRzShL UHkk2YU894HIk8QcZSOU1tRaPnwUW0=; b=nYTK15r3FhTI8/4fRNtrBsnYKSMBa QJt8l0o5UJ4w0IQE2f5xfEMD1o0c/Nbz09Nuisp6R0wsniFoSloRRFeo6G4xoz/u sWxCOxXwBon3r/tNo3fbr9MFYdY5aKLOdkx4JowagkSJu+wMKgxhs7KcTamtGHP7 my+r6RfZJ822ogMGkjl+96JtOuGsdEx+Ao14cHe9vnufrWobykOarLzgT07IWZ7a A9djdxtwu0ofk3W6UJP83xlUtopcU51Im4cBcIpYqApH1nkfwEi1r3RMq390If7p wjqYKE1VIiJTS5upSF+GmvQ8cAP/TI2R3X1gVl7rLmZC7GCVMDutxEfig== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=3A/qG9SxRzShLUHkk2YU894HIk8QcZSOU1tRaPnwUW0=; b=F8B0U3MA BooN5bAMo5A6ZbYgD03ks5dQgRfa5NP3L7w9gHpHt9Ysp6FRINK0b/3v8NdOOv1Q uSUstqWqYdXRYnrnsZ9D0tlk8g3u4GbB4+Tp0kTdPPUrBLmUwwbG/OE9NAnP97/n lSOqBgwF5CF32mwvLQhYwRl9nxBIb3CrU+5nyeZJEWICbONarno3IwxPGZPEQpOo edsHP9QLUhaxo2Hzz2FBwEODDi8QpD/SuthAMazB+37kg26s56gQDwjRn6jLGC76 cwZGvP6m+/KwN9Wzpr/rRsN2qGxCkMqAE6kqEYXJL5a8I+SytXWqc3D7KLinYTZw 7mb/INaicuxPDw== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucffohhmrghinhepfhhrvggvuggvshhkthhophdrohhrghenucfkphepiedvrdduiedrvd dviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhm rghilhdrtghomhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 3513AE4430 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:21 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 03/23] gnu: harfbuzz: Update to 2.2.0. Date: Tue, 11 Dec 2018 02:13:56 +0100 Message-Id: <20181211011416.15902-3-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/gtk.scm (harfbuzz): Update to 2.2.0. --- gnu/packages/gtk.scm | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/gnu/packages/gtk.scm b/gnu/packages/gtk.scm index 3b9a4145e5..7a8b6c1852 100644 --- a/gnu/packages/gtk.scm +++ b/gnu/packages/gtk.scm @@ -180,7 +180,7 @@ affine transformation (scale, rotation, shear, etc.).") (define-public harfbuzz (package (name "harfbuzz") - (version "1.8.8") + (version "2.2.0") (source (origin (method url-fetch) (uri (string-append "https://www.freedesktop.org/software/" @@ -188,7 +188,7 @@ affine transformation (scale, rotation, shear, etc.).") version ".tar.bz2")) (sha256 (base32 - "1ag3scnm1fcviqgx2p4858y433mr0ndqw6zccnccrqcr9mpcird8")))) + "047q63jr513azf3g1y7f5xn60b4jdjs9zsmrx04sfw5rasyzrk5p")))) (build-system gnu-build-system) (outputs '("out" "bin")) ; 160K, only hb-view depend on cairo -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:32 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:32 +0000 Received: from localhost ([127.0.0.1]:42390 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWd6-0001KP-0o for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:32 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:57617) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWd4-0001Ja-SL for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:31 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id AAB3921D23 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:25 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:25 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=zUPYtAbeYko51 ak+K+txPwOoas4w2iopF1Tmv0oQ4sg=; b=s1Y223ffMBVh9IGyfLNscU4t0So6A BpW+uH+9G5Chn0inn5isvpz1eaRO2octxc7V99yK5+NPVhlIfiY/JAcZAsQFqvPx rYmf8AQgOveqNX+JJ2FlsDA+TaBn8btHoMGqBKGjbvGA44vvL2nA1I6Dp9XS110y gERdb6t4hag9TUXT5ajs94sRk2ZcjevRx3B95J4dzqP/HSTMRyPnouK8d5tuSZcR zXF6SC2cpWArz8lIOZdKM9sqnmv36KGmefFg7crm2hbmJyxcU8tvk7L88O992ErE d/2QURitWBDv2ZIP74FfoIFUysYSyf548X2zHSlG/WY9QSfC5yOtDoTPQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=zUPYtAbeYko51ak+K+txPwOoas4w2iopF1Tmv0oQ4sg=; b=Uuc1IPGh MH4Rv4Ccfx67GFoGj1I7/mKX4gh8PKioMDYrSAZ9uWpw1jYNjoy4I3l+eS8/iSAd t0LsGAc6uW9WSvKygJGctU1gur866zNGr1jFrVHui2MWi8ZrbrX7VT/EwDubE22e J7L0RRA9uV3v8JAA7CDQ+3XmBaxwde6fj2BG/AZHc1M4AEwp30UVB47Ep/WqTBur EhhI4e0VoayNsk9wSkLcktDOmwiKtf9JH87vKjmgck5c3w3IU4prvcj0xhrUSsiM +uIKFb2ESFs6LxidmKfBrliuYAOV9uxkhVavAWFqGqvnSUOA9AsNC3Ihncod0Uu/ Fb2McBcRc/oLLA== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucfkphepiedvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmh gsrghkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpedu X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 0BCABE446A for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:25 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 05/23] gnu: D-Bus: Update to 1.12.12. Date: Tue, 11 Dec 2018 02:13:58 +0100 Message-Id: <20181211011416.15902-5-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/glib.scm (dbus): Update to 1.12.12. --- gnu/packages/glib.scm | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/gnu/packages/glib.scm b/gnu/packages/glib.scm index 61d8e84d54..39b0a5f9e6 100644 --- a/gnu/packages/glib.scm +++ b/gnu/packages/glib.scm @@ -79,7 +79,7 @@ (define dbus (package (name "dbus") - (version "1.12.10") + (version "1.12.12") (source (origin (method url-fetch) (uri (string-append @@ -87,7 +87,7 @@ version ".tar.gz")) (sha256 (base32 - "1xywijmgfad4m3cxp0b4l6kvypwc53ckmhwwzbrc6n32jwj3ssab")) + "1y7mxhkw2shd9mi9s62k81lz8npjkrafapr4fyfms7hs04kg4ilm")) (patches (search-patches "dbus-helper-search-path.patch")))) (build-system gnu-build-system) (arguments -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:34 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:34 +0000 Received: from localhost ([127.0.0.1]:42404 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWd8-0001Kp-BO for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:34 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:37787) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWd6-0001Js-Ds for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:32 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 48FC721F73 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:27 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:27 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=Hrpaw0MkbNcNJ Zn76CMxejbM9XSNy+mWNMkpcArFePE=; b=OmyM6z8WOHWT95aXqvcsSy+bHpxMp IxlecmI18SBE5BMlN+rA1hqV8G6QXhVqDQKYvhPujwcIfuUJlEvuYLU6gxZhH8sL jQiAiYIRQeMUPC2icxSZYNYOkUYaXip4+H+w5jCDdc5Legv9AE17+g93/fsTYYcQ La69guxdZ9+bbDOBv3jlTMdtPq1v/rLud0j8AQ2qEN2xQaIBpZFk7Pl+r9l0KXx8 ryPm1bz42tDcA4plPKWsvnv/VyXga8w/FhxJh/AI09Cn/btTwx0z6xt4Dtq8Br6c qQh2qbhnYlLsZXh71cxiiEmvPfdDq/T+ElmmO3vM6JqlQRTqKdY16yQ+Q== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=Hrpaw0MkbNcNJZn76CMxejbM9XSNy+mWNMkpcArFePE=; b=DrjJf6dI XSfWnE8VVvPUhXgzorJzXPr/vLVzCHF4lHVGBhtBn7QQ12fEfNAoW4i6fJOsNlZy nixzeJrZL2bkZXBw6oElnZaoabkRrPoTbMJ/3gNt88P427szmXZhr83bkn+qTXkG vzPqjaroDbJtbPXJIFhOy3dEUGy/CjixjW48j7ZaNTVxYd1w6uNjrk9wRLIPCZ0p QX83obON69ZO6sy4B0xjVat4qPqWzR4Y39+9ribsqTEqdfVEspmmFMOPCWitphSu 21eFTkrJlN/LMpZ98kRjRlx1HneueE7fQpJSLCp1atOphu88EZ5N+jGWwnwCZz4g JnziqPtPrmyd7g== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucfkphepiedvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmh gsrghkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpedv X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 98DF4E4430 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:26 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 06/23] gnu: glib: Remove obsolete variable. Date: Tue, 11 Dec 2018 02:13:59 +0100 Message-Id: <20181211011416.15902-6-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/glib.scm (glib)[arguments]: Don't set DETERMINISTIC_BUILD. --- gnu/packages/glib.scm | 3 --- 1 file changed, 3 deletions(-) diff --git a/gnu/packages/glib.scm b/gnu/packages/glib.scm index 39b0a5f9e6..016fae11f1 100644 --- a/gnu/packages/glib.scm +++ b/gnu/packages/glib.scm @@ -184,9 +184,6 @@ shared NFS home directories.") (modify-phases %standard-phases (add-before 'build 'pre-build (lambda* (#:key inputs outputs #:allow-other-keys) - ;; For building deterministic pyc files - (setenv "DETERMINISTIC_BUILD" "1") - ;; For tests/gdatetime.c. (setenv "TZDIR" (string-append (assoc-ref inputs "tzdata") -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:39 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:39 +0000 Received: from localhost ([127.0.0.1]:42406 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWd8-0001Kw-P8 for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:39 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:57617) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWd6-0001Ja-7I for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:33 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 2A49F21C9C for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:32 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:32 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=P/WtpQoiH3WgX dfDptBoV1YEDtEG/XwURYHl7we6ddc=; b=lV6oniokXRhh638xVByMJJckts1CC 6hwj8COc/O+rYudZDpcisSA7clJSk45jg/lBygelaacBayv+poOiBXUbx93o3r77 WzptHXCo8MHk2tqMDMrMhLyddKVuTGd27RF/igVkEQZXvpvmzUxSOeDWGlzWGErt yYl3/H8l7C9Moym6BEzokrjy15Het/IJbgqcaHqphvT/xdpxVp9B5KRJKmT8HtLk /7sPXeIkoteuGOpDbRTS40+5iuAdw4umNpDyHtKtpdpkY4UIqVnxJ33fEuSreNeK Ww0G8E18r54QH5aRuy6JSISoA8wao5tgzvOnwxAEM7m9y1YHtpwNblThw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=P/WtpQoiH3WgXdfDptBoV1YEDtEG/XwURYHl7we6ddc=; b=v3AxaP8z c1fSR5fqGollYI5WPW1+jeujun1JinwpAEPdBJFKd4pCYp2nJxW7jt/hPvmU0Pvb //GfzSTwKe4UuF9boEpzd3IYh9Ot/B1bgj1jm7VaRxbLoXGWBlY3blQrySZfBrKy Hs9cGRni3bCQxSMO8u0JlCZVpYVRqrPr/o4Iup+VrKqMeSTh8mhnFwXoPbeCZV+3 qNxw2N7b2aiccy/ViVqTDPLgLPSSmoWLGIbGHBtEcOgFwhV5Hoo1LWNGNJ1U3Omg N08skUIHEMcoTRzkqZcY9JyT6dG9JKxP7C5JUOHTpqZypDrE4HkV0APkgIo7CCAc OQ4timEtjU1qZw== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucffohhmrghinhepfhhrvggvuggvshhkthhophdrohhrghdptggrihhrohhgrhgrphhhih gtshdrohhrghenucfkphepiedvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghi lhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhushhtvghruf hiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 72D25E4430 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:31 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 09/23] gnu: cairo: Update to 1.16.0. Date: Tue, 11 Dec 2018 02:14:02 +0100 Message-Id: <20181211011416.15902-9-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/patches/cairo-CVE-2016-9082.patch, gnu/packages/patches/cairo-setjmp-wrapper.patch: Delete files. * gnu/local.mk (dist_patch_DATA): Remove them/ * gnu/packages/gtk.scm (cairo): Update to 1.16.0. [source](patches): Remove. --- gnu/local.mk | 2 - gnu/packages/gtk.scm | 6 +- .../patches/cairo-CVE-2016-9082.patch | 122 ------------------ .../patches/cairo-setjmp-wrapper.patch | 78 ----------- 4 files changed, 2 insertions(+), 206 deletions(-) delete mode 100644 gnu/packages/patches/cairo-CVE-2016-9082.patch delete mode 100644 gnu/packages/patches/cairo-setjmp-wrapper.patch diff --git a/gnu/local.mk b/gnu/local.mk index 6541bcc8be..aaab4c72ec 100644 --- a/gnu/local.mk +++ b/gnu/local.mk @@ -608,8 +608,6 @@ dist_patch_DATA = \ %D%/packages/patches/boost-fix-icu-build.patch \ %D%/packages/patches/borg-respect-storage-quota.patch \ %D%/packages/patches/byobu-writable-status.patch \ - %D%/packages/patches/cairo-CVE-2016-9082.patch \ - %D%/packages/patches/cairo-setjmp-wrapper.patch \ %D%/packages/patches/calibre-no-updates-dialog.patch \ %D%/packages/patches/calibre-use-packaged-feedparser.patch \ %D%/packages/patches/casync-renameat2-declaration.patch \ diff --git a/gnu/packages/gtk.scm b/gnu/packages/gtk.scm index 7a8b6c1852..349d6029c4 100644 --- a/gnu/packages/gtk.scm +++ b/gnu/packages/gtk.scm @@ -113,16 +113,14 @@ tools have full access to view and control running applications.") (define-public cairo (package (name "cairo") - (version "1.14.12") + (version "1.16.0") (source (origin (method url-fetch) (uri (string-append "https://cairographics.org/releases/cairo-" version ".tar.xz")) (sha256 (base32 - "05mzyxkvsfc1annjw2dja8vka01ampp9pp93lg09j8hba06g144c")) - (patches (search-patches "cairo-CVE-2016-9082.patch" - "cairo-setjmp-wrapper.patch")))) + "0c930mk5xr2bshbdljv005j3j8zr47gqmkry3q6qgvqky6rjjysy")))) (build-system gnu-build-system) (propagated-inputs `(("fontconfig" ,fontconfig) diff --git a/gnu/packages/patches/cairo-CVE-2016-9082.patch b/gnu/packages/patches/cairo-CVE-2016-9082.patch deleted file mode 100644 index ad83404194..0000000000 --- a/gnu/packages/patches/cairo-CVE-2016-9082.patch +++ /dev/null @@ -1,122 +0,0 @@ -From: Adrian Johnson -Date: Thu, 20 Oct 2016 21:12:30 +1030 -Subject: [PATCH] image: prevent invalid ptr access for > 4GB images - -Image data is often accessed using: - - image->data + y * image->stride - -On 64-bit achitectures if the image data is > 4GB, this computation -will overflow since both y and stride are 32-bit types. - -bug report: https://bugs.freedesktop.org/show_bug.cgi?id=98165 -patch: https://bugs.freedesktop.org/attachment.cgi?id=127421 ---- - boilerplate/cairo-boilerplate.c | 4 +++- - src/cairo-image-compositor.c | 4 ++-- - src/cairo-image-surface-private.h | 2 +- - src/cairo-mesh-pattern-rasterizer.c | 2 +- - src/cairo-png.c | 2 +- - src/cairo-script-surface.c | 3 ++- - 6 files changed, 10 insertions(+), 7 deletions(-) - -diff --git a/boilerplate/cairo-boilerplate.c b/boilerplate/cairo-boilerplate.c -index 7fdbf79..4804dea 100644 ---- a/boilerplate/cairo-boilerplate.c -+++ b/boilerplate/cairo-boilerplate.c -@@ -42,6 +42,7 @@ - #undef CAIRO_VERSION_H - #include "../cairo-version.h" - -+#include - #include - #include - #include -@@ -976,7 +977,8 @@ cairo_surface_t * - cairo_boilerplate_image_surface_create_from_ppm_stream (FILE *file) - { - char format; -- int width, height, stride; -+ int width, height; -+ ptrdiff_t stride; - int x, y; - unsigned char *data; - cairo_surface_t *image = NULL; -diff --git a/src/cairo-image-compositor.c b/src/cairo-image-compositor.c -index 48072f8..3ca0006 100644 ---- a/src/cairo-image-compositor.c -+++ b/src/cairo-image-compositor.c -@@ -1575,7 +1575,7 @@ typedef struct _cairo_image_span_renderer { - pixman_image_t *src, *mask; - union { - struct fill { -- int stride; -+ ptrdiff_t stride; - uint8_t *data; - uint32_t pixel; - } fill; -@@ -1594,7 +1594,7 @@ typedef struct _cairo_image_span_renderer { - struct finish { - cairo_rectangle_int_t extents; - int src_x, src_y; -- int stride; -+ ptrdiff_t stride; - uint8_t *data; - } mask; - } u; -diff --git a/src/cairo-image-surface-private.h b/src/cairo-image-surface-private.h -index 8ca694c..7e78d61 100644 ---- a/src/cairo-image-surface-private.h -+++ b/src/cairo-image-surface-private.h -@@ -71,7 +71,7 @@ struct _cairo_image_surface { - - int width; - int height; -- int stride; -+ ptrdiff_t stride; - int depth; - - unsigned owns_data : 1; -diff --git a/src/cairo-mesh-pattern-rasterizer.c b/src/cairo-mesh-pattern-rasterizer.c -index 1b63ca8..e7f0db6 100644 ---- a/src/cairo-mesh-pattern-rasterizer.c -+++ b/src/cairo-mesh-pattern-rasterizer.c -@@ -470,7 +470,7 @@ draw_pixel (unsigned char *data, int width, int height, int stride, - tg += tg >> 16; - tb += tb >> 16; - -- *((uint32_t*) (data + y*stride + 4*x)) = ((ta << 16) & 0xff000000) | -+ *((uint32_t*) (data + y*(ptrdiff_t)stride + 4*x)) = ((ta << 16) & 0xff000000) | - ((tr >> 8) & 0xff0000) | ((tg >> 16) & 0xff00) | (tb >> 24); - } - } -diff --git a/src/cairo-png.c b/src/cairo-png.c -index 562b743..aa8c227 100644 ---- a/src/cairo-png.c -+++ b/src/cairo-png.c -@@ -673,7 +673,7 @@ read_png (struct png_read_closure_t *png_closure) - } - - for (i = 0; i < png_height; i++) -- row_pointers[i] = &data[i * stride]; -+ row_pointers[i] = &data[i * (ptrdiff_t)stride]; - - png_read_image (png, row_pointers); - png_read_end (png, info); -diff --git a/src/cairo-script-surface.c b/src/cairo-script-surface.c -index ea0117d..91e4baa 100644 ---- a/src/cairo-script-surface.c -+++ b/src/cairo-script-surface.c -@@ -1202,7 +1202,8 @@ static cairo_status_t - _write_image_surface (cairo_output_stream_t *output, - const cairo_image_surface_t *image) - { -- int stride, row, width; -+ int row, width; -+ ptrdiff_t stride; - uint8_t row_stack[CAIRO_STACK_BUFFER_SIZE]; - uint8_t *rowdata; - uint8_t *data; --- -2.1.4 - diff --git a/gnu/packages/patches/cairo-setjmp-wrapper.patch b/gnu/packages/patches/cairo-setjmp-wrapper.patch deleted file mode 100644 index bffac6e041..0000000000 --- a/gnu/packages/patches/cairo-setjmp-wrapper.patch +++ /dev/null @@ -1,78 +0,0 @@ -Revert faulty commit to avoid undefined behaviour: -https://bugs.freedesktop.org/show_bug.cgi?id=104325 - -Taken from this upstream commit: -https://cgit.freedesktop.org/cairo/commit/?h=1.14&id=2acc4382c54bd8239361ceed14423412a343d311 - -diff --git a/src/cairo-bentley-ottmann-rectangular.c b/src/cairo-bentley-ottmann-rectangular.c -index cb2e30c..5541bdc 100644 ---- a/src/cairo-bentley-ottmann-rectangular.c -+++ b/src/cairo-bentley-ottmann-rectangular.c -@@ -593,12 +593,6 @@ sweep_line_insert (sweep_line_t *sweep, rectangle_t *rectangle) - pqueue_push (sweep, rectangle); - } - --static int --sweep_line_setjmp (sweep_line_t *sweep_line) --{ -- return setjmp (sweep_line->unwind); --} -- - static cairo_status_t - _cairo_bentley_ottmann_tessellate_rectangular (rectangle_t **rectangles, - int num_rectangles, -@@ -615,7 +609,7 @@ _cairo_bentley_ottmann_tessellate_rectangular (rectangle_t **rectangles, - rectangles, num_rectangles, - fill_rule, - do_traps, container); -- if ((status = sweep_line_setjmp (&sweep_line))) -+ if ((status = setjmp (sweep_line.unwind))) - return status; - - rectangle = rectangle_pop_start (&sweep_line); -diff --git a/src/cairo-png.c b/src/cairo-png.c -index e64b14a..068617d 100644 ---- a/src/cairo-png.c -+++ b/src/cairo-png.c -@@ -158,14 +158,6 @@ png_simple_warning_callback (png_structp png, - */ - } - --static int --png_setjmp (png_struct *png) --{ --#ifdef PNG_SETJMP_SUPPORTED -- return setjmp (png_jmpbuf (png)); --#endif -- return 0; --} - - /* Starting with libpng-1.2.30, we must explicitly specify an output_flush_fn. - * Otherwise, we will segfault if we are writing to a stream. */ -@@ -237,8 +229,10 @@ write_png (cairo_surface_t *surface, - goto BAIL4; - } - -- if (png_setjmp (png)) -+#ifdef PNG_SETJMP_SUPPORTED -+ if (setjmp (png_jmpbuf (png))) - goto BAIL4; -+#endif - - png_set_write_fn (png, closure, write_func, png_simple_output_flush_fn); - -@@ -577,11 +571,12 @@ read_png (struct png_read_closure_t *png_closure) - png_set_read_fn (png, png_closure, stream_read_func); - - status = CAIRO_STATUS_SUCCESS; -- -- if (png_setjmp (png)) { -+#ifdef PNG_SETJMP_SUPPORTED -+ if (setjmp (png_jmpbuf (png))) { - surface = _cairo_surface_create_in_error (status); - goto BAIL; - } -+#endif - - png_read_info (png, info); - -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:40 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:40 +0000 Received: from localhost ([127.0.0.1]:42414 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdD-0001LS-Px for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:40 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:37787) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWd7-0001Js-Q5 for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:34 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id B8A0E21C9C for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:33 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:33 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=s7x3IfkABuv8M +EGflpBGAYIy++otiUDfHU8S/fO5Gg=; b=IwmcN0dJ6B7EOyd+wKeGzSWMHuXlL s1DPdzwXe/cr9cbaG6VRouvt6dh7A2Il2qdFbHAxesTHve86FfKKUe1OtWJC9uV8 OKKas0p/OFua6ui3uaDzhbt1og6GxTOcxl2i+NyBYILmpc/YW09dCFcWzXJp2qsV sw481AVYNYNtMZBenKUkanJMgU31WW3IKXm7Q0hafhDKHiZWAPpQtOMY4DkMma+m rj/+/BJHjan25bIVhpfjR5ra7UEnTRrS/2WSqX3Rrem7UksHckg2oeMllzzAFPw6 3U1eM6B8/mCKgA4r1HUk4LzkPqk17Xx8HMYzkKPc6FYe7VcO7wZr0AzZw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=s7x3IfkABuv8M+EGflpBGAYIy++otiUDfHU8S/fO5Gg=; b=xi1QlZSe 3S5iLBD1ZaHwTgOHirUK6+pt+WSFI49lMO4rukWjuIVqfJlUp3JoNL0eHfB/fG30 NvkEtmIBGcNGPM8tSLnnmUA0biIzBcHtUkO7kpaOOrMyViaKeM0R/sTnT/H46MDN XI6ltmUIjafstoxyAYzfx82Up/BeiIJ7vTrEQTX+7Fb5FEMWv2oV1VLzhGl9u5ty SHGQIg43APX5L/y+g9iQu3AxVrXxebQsyA+TmyDGN/qsv6/3Ygj7Q3Nz2xWUBbfg A/dFhwU0UiT0WlpLVFfILyORGN+xdpYbF/zc8cbP2e9bMYJm8uk9rUs5loSMiU7E vaWWI05/i4DvUA== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucfkphepiedvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmh gsrghkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpeeh X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 13E3CE4430 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:32 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 10/23] gnu: libqmi: Update to 1.20.2. Date: Tue, 11 Dec 2018 02:14:03 +0100 Message-Id: <20181211011416.15902-10-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/freedesktop.scm (libqmi): Update to 1.20.2. --- gnu/packages/freedesktop.scm | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/gnu/packages/freedesktop.scm b/gnu/packages/freedesktop.scm index f8e97acf51..536895cba8 100644 --- a/gnu/packages/freedesktop.scm +++ b/gnu/packages/freedesktop.scm @@ -763,7 +763,7 @@ which speak the Mobile Interface Broadband Model (MBIM) protocol.") (define-public libqmi (package (name "libqmi") - (version "1.20.0") + (version "1.20.2") (source (origin (method url-fetch) (uri (string-append @@ -771,7 +771,7 @@ which speak the Mobile Interface Broadband Model (MBIM) protocol.") name "-" version ".tar.xz")) (sha256 (base32 - "1d3fca477sdwbv4bsq1cl98qc8sixrzp0gqjcmjj8mlwfk9qqhi1")))) + "0i6aw8jyxv84d5x8lj2g9lb8xxf1dyad8n3q0kw164pyig55jd67")))) (build-system gnu-build-system) (inputs `(("libgudev" ,libgudev))) -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:40 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:40 +0000 Received: from localhost ([127.0.0.1]:42416 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdE-0001LZ-2c for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:40 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:36737) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWd7-0001K6-Vm for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:34 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id CC54421311 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:28 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:28 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=dYzLFuEYL1QX0 6axD3wTphM4AEZlCiZHwThvGwrD+Lc=; b=BaqNoruuGDqXBC0A3DK2IFFEYl601 q26tfmNW5Zq2eq62OexumY66vvl6lVbgIxgbsioF3ESD0NvvX4XMsU8aLDx+bqrF LwmwufXknJSBGOGj85wQ1rwREJAMwsqdFAPmFQSdE6+qY5JnxRujV2M9NcPAgOzM iqTJSnys43H13yUR7NiMtqYOHZSWI9Wu+YB88+4XdUJXZXehzuxAVGQ7wkYOs3jW /BToDFLrQaWl4Q6zoINwKNaX8Q4hXNHoDHTX8+JYmXOrNGmOSV6ZMyV46xHXElaq QJLqs8lHhvVQGs7ILj+IMzGfBxMafMayVaIxfJZ2sQsFb0uGPf7+5r2DQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=dYzLFuEYL1QX06axD3wTphM4AEZlCiZHwThvGwrD+Lc=; b=uWrinPAg MkBKr8WawXTvHkhJJ97QtVhCGPgQNom8OGfYD/ZJDAIiAjq6A+MnyHoIpEshlWpe kODSKCZgO5jXXFO/sRARt0z+hakmmPqV5PeUroHHz8EJyVeOAyE0pf3mgvqpXHoh hMmnBk6cy5dkCh4aEak+kwoVMbMP24u6fDMMyiPJWHIBfNjDfU5nTBckMorDTQP8 1BBcZTTWO3iPCXh1Tl8MQsMPu2Kv2Zo8kWtwzXAW+28d7MY75i5Ke8AyMiEKJXSO 65TP2z7955EFuc/+GlwPuOTmK0sqm/9qKKarVm5ztitIomuVzA3d0o+VFb1EZlGN OlMl8XjJA0wfwQ== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucfkphepiedvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmh gsrghkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpedv X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 3BEFEE4430 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:28 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 07/23] gnu: glib: Update to 2.56.3. Date: Tue, 11 Dec 2018 02:14:00 +0100 Message-Id: <20181211011416.15902-7-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/glib.scm (glib): Update to 2.56.3. --- gnu/packages/glib.scm | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/gnu/packages/glib.scm b/gnu/packages/glib.scm index 016fae11f1..dee349395d 100644 --- a/gnu/packages/glib.scm +++ b/gnu/packages/glib.scm @@ -149,7 +149,7 @@ shared NFS home directories.") (define glib (package (name "glib") - (version "2.56.2") + (version "2.56.3") (source (origin (method url-fetch) (uri (string-append "mirror://gnome/sources/" @@ -157,7 +157,7 @@ shared NFS home directories.") name "-" version ".tar.xz")) (sha256 (base32 - "12d738n1wpvrn39zvy9xazg5h6vzyiwsw8z1qibcj09mh4bbsjnn")) + "1cjcqz77m62zrx7224vl3f2cxwqf28r5xpqb2jy7av0vr2scb959")) (patches (search-patches "glib-tests-timer.patch")))) (build-system gnu-build-system) (outputs '("out" ; everything -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:40 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:40 +0000 Received: from localhost ([127.0.0.1]:42418 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdE-0001Li-BO for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:40 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:37787) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWd9-0001Js-FV for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:35 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 5649221785 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:35 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:35 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=z2OGPOTNc3vtO 40N6iIKZSW6IMhAsjXncdm5m8okvl0=; b=MDPiy3JyCN/MLNKUVeFxZ7GKHhh0k o6X/hFykpoFFOhnIKW14/LPyHZbNOsR3ppS0cdXNG1Sa0E0hvtnPiZ7TXq7ZynYd ivuFtDSSGSwUF0ElQLxMuvvRijJBjj9gNsRfSidNIaM/DhOmHsL2qPozGggOToft wSbxcxH7WL+EFq30FhpYeyNKrG0g4HANX6jfQIOoKJl/E4kIWa3hY5l/AWCQsVwf 1gqFw1iu9JoBGWpTJWCweRZ8D2UJQJCbx45V4/FCl6XIYmwUV2KBmOutTs9I94SB c798kl4R91hJZdq5gCWT1t3bhD91fphqT7eUWcc1CKl41TMJn7Z0F1fpg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=z2OGPOTNc3vtO40N6iIKZSW6IMhAsjXncdm5m8okvl0=; b=xkVuzj6F fV4ttwpTkY9o4WLhXBLY3N+4yjJTYj9kihJy5A28m92OyNodNguvcZ4x72O1gGkx AN7UnIKkWL1LaNG7i7jUi4Sy/HfFanak/E9Ip1H26PLQeXdOoVI+dRW0OxbdQAM4 odkzt+h4fNQwEkFbVeAr2ksKPDU2EkP0klg6C1mV/2nBIiu9Qu5zyiC3AfUIcb+V wOr1JRIiydhVl3ELIBx4oReo24ogW09VEi+kcDke35PbcBdrGaXBlyvJDc2wvstO /Oej4hL8+La43pDtIZ7IoGs0KmC+4BaW4z+Tq0LgMMzM8/R81GFNZ0igXmGC/WGU fHTNTbusOLir+A== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucffohhmrghinhephhgrgiigrdhsvgenucfkphepiedvrdduiedrvddviedrudegtdenuc frrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrghilhdrtghomhen ucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id A5CB5E4430 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:34 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 11/23] gnu: curl: Remove replacement for 7.62.0. Date: Tue, 11 Dec 2018 02:14:04 +0100 Message-Id: <20181211011416.15902-11-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/curl.scm (curl): Update to 7.62.0. [replacement]: Remove field. (curl-7.62.0): Remove variable. --- gnu/packages/curl.scm | 18 ++---------------- 1 file changed, 2 insertions(+), 16 deletions(-) diff --git a/gnu/packages/curl.scm b/gnu/packages/curl.scm index 61313af7d2..9430ece467 100644 --- a/gnu/packages/curl.scm +++ b/gnu/packages/curl.scm @@ -50,15 +50,14 @@ (define-public curl (package (name "curl") - (version "7.61.1") - (replacement curl-7.62.0) + (version "7.62.0") (source (origin (method url-fetch) (uri (string-append "https://curl.haxx.se/download/curl-" version ".tar.xz")) (sha256 (base32 - "148qv1f32290r9pwg07mccawihz4srznkzsdwdl2xllvlgb16n9x")))) + "1hbm29r3pirhn4gkcnd94ylc4jzgn3v3v7qbay9awxg7bwx69dfs")))) (build-system gnu-build-system) (outputs '("out" "doc")) ;1.2 MiB of man3 pages @@ -142,19 +141,6 @@ tunneling, and so on.") "See COPYING in the distribution.")) (home-page "https://curl.haxx.se/"))) -(define-public curl-7.62.0 - (package - (inherit curl) - (version "7.62.0") - (source - (origin - (method url-fetch) - (uri (string-append "https://curl.haxx.se/download/curl-" - version ".tar.xz")) - (sha256 - (base32 - "1hbm29r3pirhn4gkcnd94ylc4jzgn3v3v7qbay9awxg7bwx69dfs")))))) - (define-public kurly (package (name "kurly") -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:40 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:41 +0000 Received: from localhost ([127.0.0.1]:42420 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdE-0001Lr-Lm for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:40 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:35629) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWd9-0001KF-IP for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:36 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 8123621EFE for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:30 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:30 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=QYCW15RQDtRr7 3i+RyTLknxM4y+oIIiRMWAZePOkwiA=; b=empXvoCEtyXeTmarPj/+L/nUZ62Va vIehGAPW4fOiV/cF5zzm3wpbgJAKW44kSxVxYgU+xBooaNRL8bY8x4+hG4itsqiv bRkxGiyyVwnxmAQjrNp4NV/9jEGuiRX22tcg1w+dKr1AlqBWDiazUzG7PY2j2TUt 0xR5ASM7Z3oCXSOdzNwsFReB15hLjtH9MWImUPJklAP6uuL+jxoFBnPX5gNkodxn u1q0p6y0gaMS9Wa9mR4QOUpaHOHbqaM7mLq2sPGYKgxguuYdzMlc3QxCrq+zUfJl +Ye5i7GS4JghSsHkcYdWa4JO5EyF668sWz7ZOGvXPmNW9gx3G6+45Tg7w== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=QYCW15RQDtRr73i+RyTLknxM4y+oIIiRMWAZePOkwiA=; b=rLN3JwQ4 LHOUf6DeTCsk2th1hamfSNFD/yAoTukh+GR33+D/82DFsWZYfoz09ByH/EQwXSvw hkOpAlUe2n09qC85i0eCNN2mlTiympk6cZ0JTpqPird1Qqr2ZtyHImByYyWcBbqk bRaHw/y63v4v82D1LE2oxEwJSfm9sT0fle12/n8sr9un/mVNVt8CuXi6vKxyUEL2 yhTonk7vP7mDYQoq43FRN/7U/3W+Srfyeouuo0UhIFx2+hnEoLmKdoP2w1ZX4qsT V5GaD85DyiXOdm3o4j1DLSFFZZN65M34OCFiQVbZ3o1FLuHobCZv8khCcUuefLkO BdyvyuNum5osxg== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucfkphepiedvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmh gsrghkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpedv X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id D3958E4430 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:29 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 08/23] gnu: pixman: Update to 0.36.0. Date: Tue, 11 Dec 2018 02:14:01 +0100 Message-Id: <20181211011416.15902-8-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/xdisorg.scm (pixman): Update to 0.36.0. --- gnu/packages/xdisorg.scm | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/gnu/packages/xdisorg.scm b/gnu/packages/xdisorg.scm index fdbe19c059..de4cac9e94 100644 --- a/gnu/packages/xdisorg.scm +++ b/gnu/packages/xdisorg.scm @@ -292,7 +292,7 @@ following the mouse.") (define-public pixman (package (name "pixman") - (version "0.34.0") + (version "0.36.0") (source (origin (method url-fetch) (uri (string-append @@ -300,7 +300,7 @@ following the mouse.") version ".tar.gz")) (sha256 (base32 - "13m842m9ffac3m9r0b4lvwjhwzg3w4353djkjpf00s0wnm4v5di1")) + "1blzrx50ssdv0pn56hcv2v0zw0vrjwj1sx22pkgjls1p9n6rr88w")) (patches (search-patches "pixman-CVE-2016-5296.patch")))) (build-system gnu-build-system) (inputs -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:50 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:50 +0000 Received: from localhost ([127.0.0.1]:42422 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdE-0001Lw-V5 for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:50 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:36351) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWd3-0001JP-7H for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:36 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 0ED2C21C6B for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:24 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:24 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=mVIVVc41cf0MC 3e/plMWE8tpc1p2Aez6gID0NJQoy/Y=; b=mHax7jMCtpd68iKk9hJXi7VXdnNg4 Kc3xK39Szmuvo0hD3c9PTj+pH/ctrzzhdkx8GVWByP4H/WVuNQanqxCZ+57RXUJO nVRXKtQI+HCml8vT+UsJqbz4uy9rNAKzgWBUl/1oKcw0c5ub/HZLG57e7CvHwmkq P/lSUlTQSMyaF6mPvtF4W3dAjrijrtDnRmiFLTv2VioOcKUsPYWhr/K70GPBh1Y9 LDwgGgWnheSf7jY8zOCyXsfDQOBB4pN1w7W9l74KgGBtGFB3ZmYwQggT+DfTIxYT WNo/xJBG18duGKekrJOOfOpD9JvG0iY2XmfssroeVO6vemaflj0dkLrPA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=mVIVVc41cf0MC3e/plMWE8tpc1p2Aez6gID0NJQoy/Y=; b=UbS8uLoI ftBdRnthoGHI+Hfs0v3nHSINlK4AWLxDY94GCR/lCR5hBfFirSiMO3y1qEL8llFs 7Ic7nPhL91d+NXB199PZ19s0+da471aaK0p8+HnGty041YE3vdu7DNXvLUFS3v0C SonRs/wKHl5qF5i7HoHwjWOx86HzcuF9hdxXVYphUZJB5yg/tJGG+a6ZUDs8EP+R m1NyMDBhLYJyMmSnluOR79GfMZ61CddhL7bQkRakQFLZz70my6hKNOHHx/RsP8D1 2nIknJcanrDYzH2fecCcr88o9dpYuoHFKirTvnl0hk5qlQxtRcnSsdyy35zcpTCF D0Q8Msl6zR0sVQ== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucffohhmrghinhepfhhrvggvuggvshhkthhophdrohhrghdpmhhithhrvgdrohhrghdplh hinhhugihfrhhomhhstghrrghttghhrdhorhhgpdhgihhtlhgrsgdrtghomhdpghhithhh uhgsrdgtohhmpdgrrhgthhhlihhnuhigrdhorhhgpdhtuhhgrdhorhhgnecukfhppeeivd drudeirddvvdeirddugedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehmsggrkhhkvges fhgrshhtmhgrihhlrdgtohhmnecuvehluhhsthgvrhfuihiivgeptd X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id D2DACE446A for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:22 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 04/23] gnu: poppler: Update to 0.72.0. Date: Tue, 11 Dec 2018 02:13:57 +0100 Message-Id: <20181211011416.15902-4-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) * gnu/packages/patches/poppler-CVE-2018-19149.patch: Delete file. * gnu/packages/patches/inkscape-poppler-compat3.patch, gnu/packages/patches/texlive-bin-luatex-poppler-compat.patch, gnu/packages/patches/texlive-bin-pdftex-poppler-compat.patch, gnu/packages/patches/texlive-bin-xetex-poppler-compat.patch: New files. * gnu/local.mk (dist_patch_DATA): Adjust accordingly. * gnu/packages/pdf.scm (poppler): Update to 0.72.0. [replacement]: Remove field. (poppler/fixed): Remove variable. * gnu/packages/inkscape.scm (inkscape)[source](patches): Add 'inkscape-poppler-compat{3..5}.patch'. * gnu/packages/tex.scm (texlive-bin)[source](patches): Update 'texlive-poppler-compat.patch'. Add 'texlive-bin-{lua,pdf,xe}tex-poppler-compat.patch'. * gnu/packages/emacs.scm (emacs-pdf-tools)[source](modules, snippet): New fields. * gnu/packages/scribus.scm (scribus)[source](patches): Add upstream patch origins. [source](modules, snippet): New fields. * gnu/packages/libreoffice.scm (libreoffice)[source](patches): Add three upstream origins. [source](snippet, modules): New field. --- gnu/local.mk | 5 +- gnu/packages/emacs.scm | 10 +- gnu/packages/inkscape.scm | 19 +- gnu/packages/libreoffice.scm | 39 +- .../patches/inkscape-poppler-compat3.patch | 499 ++++++++++++++++++ .../patches/poppler-CVE-2018-19149.patch | 80 --- .../texlive-bin-luatex-poppler-compat.patch | 318 +++++++++++ .../texlive-bin-pdftex-poppler-compat.patch | 188 +++++++ .../texlive-bin-xetex-poppler-compat.patch | 31 ++ gnu/packages/pdf.scm | 13 +- gnu/packages/scribus.scm | 51 +- gnu/packages/tex.scm | 10 +- 12 files changed, 1163 insertions(+), 100 deletions(-) create mode 100644 gnu/packages/patches/inkscape-poppler-compat3.patch delete mode 100644 gnu/packages/patches/poppler-CVE-2018-19149.patch create mode 100644 gnu/packages/patches/texlive-bin-luatex-poppler-compat.patch create mode 100644 gnu/packages/patches/texlive-bin-pdftex-poppler-compat.patch create mode 100644 gnu/packages/patches/texlive-bin-xetex-poppler-compat.patch diff --git a/gnu/local.mk b/gnu/local.mk index 3f19b3fe79..6541bcc8be 100644 --- a/gnu/local.mk +++ b/gnu/local.mk @@ -832,6 +832,7 @@ dist_patch_DATA = \ %D%/packages/patches/icedtea-7-hotspot-gcc-segfault-workaround.patch \ %D%/packages/patches/id3lib-CVE-2007-4460.patch \ %D%/packages/patches/ilmbase-fix-tests.patch \ + %D%/packages/patches/inkscape-poppler-compat3.patch \ %D%/packages/patches/intltool-perl-compatibility.patch \ %D%/packages/patches/irrlicht-use-system-libs.patch \ %D%/packages/patches/isl-0.11.1-aarch64-support.patch \ @@ -1061,7 +1062,6 @@ dist_patch_DATA = \ %D%/packages/patches/plink-endian-detection.patch \ %D%/packages/patches/plotutils-libpng-jmpbuf.patch \ %D%/packages/patches/podofo-cmake-3.12.patch \ - %D%/packages/patches/poppler-CVE-2018-19149.patch \ %D%/packages/patches/portaudio-audacity-compat.patch \ %D%/packages/patches/portmidi-modular-build.patch \ %D%/packages/patches/postgresql-disable-resolve_symlinks.patch \ @@ -1186,6 +1186,9 @@ dist_patch_DATA = \ %D%/packages/patches/teeworlds-use-latest-wavpack.patch \ %D%/packages/patches/texinfo-perl-compat.patch \ %D%/packages/patches/texinfo-5-perl-compat.patch \ + %D%/packages/patches/texlive-bin-luatex-poppler-compat.patch \ + %D%/packages/patches/texlive-bin-pdftex-poppler-compat.patch \ + %D%/packages/patches/texlive-bin-xetex-poppler-compat.patch \ %D%/packages/patches/telegram-purple-adjust-test.patch \ %D%/packages/patches/texi2html-document-encoding.patch \ %D%/packages/patches/texi2html-i18n.patch \ diff --git a/gnu/packages/emacs.scm b/gnu/packages/emacs.scm index d8a9ffeaed..24446bfc9e 100644 --- a/gnu/packages/emacs.scm +++ b/gnu/packages/emacs.scm @@ -1634,7 +1634,15 @@ filters, new key bindings and faces. It can be enabled by (sha256 (base32 "1i4647vax5na73basc5dz4lh9kprir00fh8ps4i0l1y3ippnjs2s")) - (patches (search-patches "emacs-pdf-tools-poppler.patch")))) + (patches (search-patches "emacs-pdf-tools-poppler.patch")) + (modules '((guix build utils))) + (snippet + '(begin + ;; In addition to the above patch, we need this additional + ;; provision for compatibility with Poppler 0.72: + (substitute* "server/poppler-hack.cc" + (("getCString") "c_str")) + #t)))) (build-system gnu-build-system) (arguments `(#:tests? #f ; there are no tests diff --git a/gnu/packages/inkscape.scm b/gnu/packages/inkscape.scm index 1673cc602e..eae8ac962b 100644 --- a/gnu/packages/inkscape.scm +++ b/gnu/packages/inkscape.scm @@ -71,7 +71,24 @@ (file-name "inkscape-poppler-compat2.patch") (sha256 (base32 - "14k9yrfjz4nx3bz9dk91q74mc0i7rvl2qzkwhcy1br71yqjvngn5"))))))) + "14k9yrfjz4nx3bz9dk91q74mc0i7rvl2qzkwhcy1br71yqjvngn5"))) + (search-patch "inkscape-poppler-compat3.patch") + (origin + (method url-fetch) + (uri (string-append "https://gitlab.com/inkscape/inkscape/commit/" + "d047859d90cef3784e2d13e40887a70d8d517897.diff")) + (file-name "inkscape-poppler-compat4.patch") + (sha256 + (base32 + "0xdfg3q4g4m15z7wna4brjn5j4kr15qiqc2f25vcw2nnr6x54qcp"))) + (origin + (method url-fetch) + (uri (string-append "https://gitlab.com/inkscape/inkscape/commit/" + "b3d59cc8106da3bf6020a6c47eeb3b8a7bbae1a9.diff")) + (file-name "inkscape-poppler-compat5.patch") + (sha256 + (base32 + "0haviy66q9szizmvb82msfj80bb3wgi1fnq3ml8fyfp8l90a1217"))))))) (build-system cmake-build-system) (inputs `(("aspell" ,aspell) diff --git a/gnu/packages/libreoffice.scm b/gnu/packages/libreoffice.scm index 45e2f63767..eadf7697ae 100644 --- a/gnu/packages/libreoffice.scm +++ b/gnu/packages/libreoffice.scm @@ -984,9 +984,44 @@ converting QuarkXPress file format. It supports versions 3.1 to 4.1.") (file-name "libreoffice-mdds.patch") (sha256 (base32 - "0apbmammmp4pk473xiv5vk50r4c5gjvqzf9jkficksvz58q6114f")))) + "0apbmammmp4pk473xiv5vk50r4c5gjvqzf9jkficksvz58q6114f"))) + (origin + (method url-fetch) + (uri (string-append "https://github.com/LibreOffice/core/commit/" + "1688a395d05125b83eac6cd5c43f0e3f2f66c491" + ".patch")) + (file-name "libreoffice-poppler-compat.patch") + (sha256 + (base32 + "0ia5avmj772mrgs6m4qqf01hs8hzpy3nafidj7w7gqx2zz2s5ih9"))) + (origin + (method url-fetch) + (uri (string-append "https://github.com/LibreOffice/core/commit/" + "5e8bdd9203dd642111c62a6668ee665a20d4ba19" + ".patch")) + (file-name "libreoffice-poppler-gbool.patch") + (sha256 + (base32 + "19kc74h5vnk48l2vny8zmm2lkxpwc7g8n9d3wwpg99748dvbmikd"))) + (origin + (method url-fetch) + (uri (string-append "https://github.com/LibreOffice/core/commit/" + "8ff41a26caf51544699863c89598d37d93dc1b21" + ".patch")) + (file-name "libreoffice-poppler-0.71.patch") + (sha256 + (base32 + "1dsd0gynjf7d6412dd2sx70xa2s8kld7ibyjdkwg5w9hhi2zxw2f")))) (search-patches "libreoffice-icu.patch" - "libreoffice-glm.patch"))))) + "libreoffice-glm.patch"))) + (modules '((guix build utils))) + (snippet + '(begin + (for-each (lambda (file) + ;; Adjust to renamed function in Poppler 0.72. + (substitute* file (("getCString") "c_str"))) + (find-files "sdext/source/pdfimport/xpdfwrapper")) + #t)))) (build-system glib-or-gtk-build-system) (native-inputs `(("bison" ,bison) diff --git a/gnu/packages/patches/inkscape-poppler-compat3.patch b/gnu/packages/patches/inkscape-poppler-compat3.patch new file mode 100644 index 0000000000..eaaf7d93f1 --- /dev/null +++ b/gnu/packages/patches/inkscape-poppler-compat3.patch @@ -0,0 +1,499 @@ +Fix compatibility with Poppler >= 0.69. + +This is a combination of these upstream commits: +https://gitlab.com/inkscape/inkscape/commit/722e121361d0f784083d10e897155b7d4e44e515 +https://gitlab.com/inkscape/inkscape/commit/402c0274420fe39fd2f3393bc7d8d8879d436358 + +...with slight adjustments for the 0.92.3 release tarball. + +diff --git a/CMakeScripts/DefineDependsandFlags.cmake b/CMakeScripts/DefineDependsandFlags.cmake +--- a/CMakeScripts/DefineDependsandFlags.cmake ++++ b/CMakeScripts/DefineDependsandFlags.cmake +@@ -116,18 +116,6 @@ if(ENABLE_POPPLER) + set(HAVE_POPPLER_GLIB ON) + endif() + endif() +- if(POPPLER_VERSION VERSION_GREATER "0.26.0" OR +- POPPLER_VERSION VERSION_EQUAL "0.26.0") +- set(POPPLER_EVEN_NEWER_COLOR_SPACE_API ON) +- endif() +- if(POPPLER_VERSION VERSION_GREATER "0.29.0" OR +- POPPLER_VERSION VERSION_EQUAL "0.29.0") +- set(POPPLER_EVEN_NEWER_NEW_COLOR_SPACE_API ON) +- endif() +- if(POPPLER_VERSION VERSION_GREATER "0.58.0" OR +- POPPLER_VERSION VERSION_EQUAL "0.58.0") +- set(POPPLER_NEW_OBJECT_API ON) +- endif() + else() + set(ENABLE_POPPLER_CAIRO OFF) + endif() +diff --git a/src/extension/internal/pdfinput/pdf-input.cpp b/src/extension/internal/pdfinput/pdf-input.cpp +--- a/src/extension/internal/pdfinput/pdf-input.cpp ++++ b/src/extension/internal/pdfinput/pdf-input.cpp +@@ -793,7 +793,7 @@ PdfInput::open(::Inkscape::Extension::Input * /*mod*/, const gchar * uri) { + dlg->getImportSettings(prefs); + + // Apply crop settings +- PDFRectangle *clipToBox = NULL; ++ _POPPLER_CONST PDFRectangle *clipToBox = NULL; + double crop_setting; + sp_repr_get_double(prefs, "cropTo", &crop_setting); + +diff --git a/src/extension/internal/pdfinput/pdf-input.h b/src/extension/internal/pdfinput/pdf-input.h +--- a/src/extension/internal/pdfinput/pdf-input.h ++++ b/src/extension/internal/pdfinput/pdf-input.h +@@ -15,6 +15,7 @@ + #endif + + #ifdef HAVE_POPPLER ++#include "poppler-transition-api.h" + + #include + +diff --git a/src/extension/internal/pdfinput/pdf-parser.cpp b/src/extension/internal/pdfinput/pdf-parser.cpp +--- a/src/extension/internal/pdfinput/pdf-parser.cpp ++++ b/src/extension/internal/pdfinput/pdf-parser.cpp +@@ -36,6 +36,7 @@ extern "C" { + #include "pdf-parser.h" + #include "util/units.h" + ++#include "glib/poppler-features.h" + #include "goo/gmem.h" + #include "goo/GooString.h" + #include "GlobalParams.h" +@@ -294,8 +295,8 @@ PdfParser::PdfParser(XRef *xrefA, + int /*pageNum*/, + int rotate, + Dict *resDict, +- PDFRectangle *box, +- PDFRectangle *cropBox) : ++ _POPPLER_CONST PDFRectangle *box, ++ _POPPLER_CONST PDFRectangle *cropBox) : + xref(xrefA), + builder(builderA), + subPage(gFalse), +@@ -317,7 +318,7 @@ PdfParser::PdfParser(XRef *xrefA, + builder->setDocumentSize(Inkscape::Util::Quantity::convert(state->getPageWidth(), "pt", "px"), + Inkscape::Util::Quantity::convert(state->getPageHeight(), "pt", "px")); + +- double *ctm = state->getCTM(); ++ const double *ctm = state->getCTM(); + double scaledCTM[6]; + for (int i = 0; i < 6; ++i) { + baseMatrix[i] = ctm[i]; +@@ -352,7 +353,7 @@ PdfParser::PdfParser(XRef *xrefA, + PdfParser::PdfParser(XRef *xrefA, + Inkscape::Extension::Internal::SvgBuilder *builderA, + Dict *resDict, +- PDFRectangle *box) : ++ _POPPLER_CONST PDFRectangle *box) : + xref(xrefA), + builder(builderA), + subPage(gTrue), +@@ -571,7 +572,7 @@ const char *PdfParser::getPreviousOperator(unsigned int look_back) { + + void PdfParser::execOp(Object *cmd, Object args[], int numArgs) { + PdfOperator *op; +- char *name; ++ const char *name; + Object *argPtr; + int i; + +@@ -619,7 +620,7 @@ void PdfParser::execOp(Object *cmd, Object args[], int numArgs) { + (this->*op->func)(argPtr, numArgs); + } + +-PdfOperator* PdfParser::findOp(char *name) { ++PdfOperator* PdfParser::findOp(const char *name) { + int a = -1; + int b = numOps; + int cmp = -1; +@@ -1751,7 +1752,7 @@ void PdfParser::doShadingPatternFillFallback(GfxShadingPattern *sPat, + GBool stroke, GBool eoFill) { + GfxShading *shading; + GfxPath *savedPath; +- double *ctm, *btm, *ptm; ++ const double *ctm, *btm, *ptm; + double m[6], ictm[6], m1[6]; + double xMin, yMin, xMax, yMax; + double det; +@@ -1993,7 +1994,7 @@ void PdfParser::doFunctionShFill1(GfxFunctionShading *shading, + GfxColor color0M, color1M, colorM0, colorM1, colorMM; + GfxColor colors2[4]; + double functionColorDelta = colorDeltas[pdfFunctionShading-1]; +- double *matrix; ++ const double *matrix; + double xM, yM; + int nComps, i, j; + +@@ -2173,7 +2174,7 @@ void PdfParser::doPatchMeshShFill(GfxPatchMeshShading *shading) { + } + } + +-void PdfParser::fillPatch(GfxPatch *patch, int nComps, int depth) { ++void PdfParser::fillPatch(_POPPLER_CONST GfxPatch *patch, int nComps, int depth) { + GfxPatch patch00 = blankPatch(); + GfxPatch patch01 = blankPatch(); + GfxPatch patch10 = blankPatch(); +@@ -2581,7 +2582,11 @@ void PdfParser::opShowSpaceText(Object args[], int /*numArgs*/) + } + } + ++#if POPPLER_CHECK_VERSION(0,64,0) + void PdfParser::doShowText(const GooString *s) { ++#else ++void PdfParser::doShowText(GooString *s) { ++#endif + GfxFont *font; + int wMode; + double riseX, riseY; +@@ -2590,11 +2595,15 @@ void PdfParser::doShowText(const GooString *s) { + double x, y, dx, dy, tdx, tdy; + double originX, originY, tOriginX, tOriginY; + double oldCTM[6], newCTM[6]; +- double *mat; ++ const double *mat; + Object charProc; + Dict *resDict; + Parser *oldParser; ++#if POPPLER_CHECK_VERSION(0,64,0) ++ const char *p; ++#else + char *p; ++#endif + int len, n, uLen; + + font = state->getFont(); +@@ -2630,7 +2639,7 @@ void PdfParser::doShowText(const GooString *s) { + double lineX = state->getLineX(); + double lineY = state->getLineY(); + oldParser = parser; +- p = g_strdup(s->getCString()); ++ p = s->getCString(); + len = s->getLength(); + while (len > 0) { + n = font->getNextChar(p, len, &code, +@@ -2685,7 +2694,7 @@ void PdfParser::doShowText(const GooString *s) { + + } else { + state->textTransformDelta(0, state->getRise(), &riseX, &riseY); +- p = g_strdup(s->getCString()); ++ p = s->getCString(); + len = s->getLength(); + while (len > 0) { + n = font->getNextChar(p, len, &code, +@@ -2731,7 +2740,11 @@ void PdfParser::opXObject(Object args[], int /*numArgs*/) + { + Object obj1, obj2, obj3, refObj; + +- char *name = g_strdup(args[0].getName()); ++#if POPPLER_CHECK_VERSION(0,64,0) ++ const char *name = args[0].getName(); ++#else ++ char *name = args[0].getName(); ++#endif + #if defined(POPPLER_NEW_OBJECT_API) + if ((obj1 = res->lookupXObject(name)).isNull()) { + #else +@@ -3656,7 +3669,6 @@ void PdfParser::opBeginImage(Object /*args*/[], int /*numArgs*/) + Stream *PdfParser::buildImageStream() { + Object dict; + Object obj; +- char *key; + Stream *str; + + // build dictionary +@@ -3674,26 +3686,17 @@ Stream *PdfParser::buildImageStream() { + obj.free(); + #endif + } else { +- key = copyString(obj.getName()); +-#if defined(POPPLER_NEW_OBJECT_API) +- obj = parser->getObj(); +-#else +- obj.free(); +- parser->getObj(&obj); +-#endif +- if (obj.isEOF() || obj.isError()) { +- gfree(key); ++ Object obj2; ++ _POPPLER_CALL(obj2, parser->getObj); ++ if (obj2.isEOF() || obj2.isError()) { ++ _POPPLER_FREE(obj); + break; + } +-#if defined(POPPLER_NEW_OBJECT_API) +- dict.dictAdd(key, std::move(obj)); +- } +- obj = parser->getObj(); +-#else +- dict.dictAdd(key, &obj); ++ _POPPLER_DICTADD(dict, obj.getName(), obj2); ++ _POPPLER_FREE(obj); ++ _POPPLER_FREE(obj2); + } +- parser->getObj(&obj); +-#endif ++ _POPPLER_CALL(obj, parser->getObj); + } + if (obj.isEOF()) { + error(errSyntaxError, getPos(), "End of file in inline image"); +diff --git a/src/extension/internal/pdfinput/pdf-parser.h b/src/extension/internal/pdfinput/pdf-parser.h +--- a/src/extension/internal/pdfinput/pdf-parser.h ++++ b/src/extension/internal/pdfinput/pdf-parser.h +@@ -9,6 +9,7 @@ + #define PDF_PARSER_H + + #ifdef HAVE_POPPLER ++#include "poppler-transition-api.h" + + #ifdef USE_GCC_PRAGMAS + #pragma interface +@@ -25,6 +26,7 @@ namespace Inkscape { + // TODO clean up and remove using: + using Inkscape::Extension::Internal::SvgBuilder; + ++#include "glib/poppler-features.h" + #include "goo/gtypes.h" + #include "Object.h" + +@@ -127,11 +129,14 @@ public: + + // Constructor for regular output. + PdfParser(XRef *xrefA, SvgBuilder *builderA, int pageNum, int rotate, +- Dict *resDict, PDFRectangle *box, PDFRectangle *cropBox); ++ Dict *resDict, ++ _POPPLER_CONST PDFRectangle *box, ++ _POPPLER_CONST PDFRectangle *cropBox); + + // Constructor for a sub-page object. + PdfParser(XRef *xrefA, Inkscape::Extension::Internal::SvgBuilder *builderA, +- Dict *resDict, PDFRectangle *box); ++ Dict *resDict, ++ _POPPLER_CONST PDFRectangle *box); + + virtual ~PdfParser(); + +@@ -185,7 +190,7 @@ private: + + void go(GBool topLevel); + void execOp(Object *cmd, Object args[], int numArgs); +- PdfOperator *findOp(char *name); ++ PdfOperator *findOp(const char *name); + GBool checkArg(Object *arg, TchkType type); + int getPos(); + +@@ -256,7 +261,7 @@ private: + double x2, double y2, GfxColor *color2, + int nComps, int depth); + void doPatchMeshShFill(GfxPatchMeshShading *shading); +- void fillPatch(GfxPatch *patch, int nComps, int depth); ++ void fillPatch(_POPPLER_CONST GfxPatch *patch, int nComps, int depth); + void doEndPath(); + + // path clipping operators +@@ -287,7 +292,12 @@ private: + void opMoveShowText(Object args[], int numArgs); + void opMoveSetShowText(Object args[], int numArgs); + void opShowSpaceText(Object args[], int numArgs); ++#if POPPLER_CHECK_VERSION(0,64,0) + void doShowText(const GooString *s); ++#else ++ void doShowText(GooString *s); ++#endif ++ + + // XObject operators + void opXObject(Object args[], int numArgs); +diff --git a/src/extension/internal/pdfinput/poppler-transition-api.h b/src/extension/internal/pdfinput/poppler-transition-api.h +new file mode 100644 +--- /dev/null ++++ b/src/extension/internal/pdfinput/poppler-transition-api.h +@@ -0,0 +1,39 @@ ++#ifndef SEEN_POPPLER_TRANSITION_API_H ++#define SEEN_POPPLER_TRANSITION_API_H ++ ++#include ++ ++#if POPPLER_CHECK_VERSION(0,70,0) ++#define _POPPLER_CONST const ++#else ++#define _POPPLER_CONST ++#endif ++ ++#if POPPLER_CHECK_VERSION(0,69,0) ++#define _POPPLER_DICTADD(dict, key, obj) (dict).dictAdd(key, std::move(obj)) ++#elif POPPLER_CHECK_VERSION(0,58,0) ++#define _POPPLER_DICTADD(dict, key, obj) (dict).dictAdd(copyString(key), std::move(obj)) ++#else ++#define _POPPLER_DICTADD(dict, key, obj) (dict).dictAdd(copyString(key), &obj) ++#endif ++ ++#if POPPLER_CHECK_VERSION(0,58,0) ++#define POPPLER_NEW_OBJECT_API ++#define _POPPLER_FREE(obj) ++#define _POPPLER_CALL(ret, func) (ret = func()) ++#define _POPPLER_CALL_ARGS(ret, func, ...) (ret = func(__VA_ARGS__)) ++#else ++#define _POPPLER_FREE(obj) (obj).free() ++#define _POPPLER_CALL(ret, func) (*func(&ret)) ++#define _POPPLER_CALL_ARGS(ret, func, ...) (*func(__VA_ARGS__, &ret)) ++#endif ++ ++#if POPPLER_CHECK_VERSION(0, 29, 0) ++#define POPPLER_EVEN_NEWER_NEW_COLOR_SPACE_API ++#endif ++ ++#if POPPLER_CHECK_VERSION(0, 25, 0) ++#define POPPLER_EVEN_NEWER_COLOR_SPACE_API ++#endif ++ ++#endif +diff --git a/src/extension/internal/pdfinput/svg-builder.cpp b/src/extension/internal/pdfinput/svg-builder.cpp +--- a/src/extension/internal/pdfinput/svg-builder.cpp ++++ b/src/extension/internal/pdfinput/svg-builder.cpp +@@ -625,7 +625,7 @@ gchar *SvgBuilder::_createPattern(GfxPattern *pattern, GfxState *state, bool is_ + if ( pattern != NULL ) { + if ( pattern->getType() == 2 ) { // Shading pattern + GfxShadingPattern *shading_pattern = static_cast(pattern); +- double *ptm; ++ const double *ptm; + double m[6] = {1, 0, 0, 1, 0, 0}; + double det; + +@@ -672,7 +672,7 @@ gchar *SvgBuilder::_createTilingPattern(GfxTilingPattern *tiling_pattern, + + Inkscape::XML::Node *pattern_node = _xml_doc->createElement("svg:pattern"); + // Set pattern transform matrix +- double *p2u = tiling_pattern->getMatrix(); ++ const double *p2u = tiling_pattern->getMatrix(); + double m[6] = {1, 0, 0, 1, 0, 0}; + double det; + det = _ttm[0] * _ttm[3] - _ttm[1] * _ttm[2]; // see LP Bug 1168908 +@@ -698,7 +698,7 @@ gchar *SvgBuilder::_createTilingPattern(GfxTilingPattern *tiling_pattern, + pattern_node->setAttribute("patternUnits", "userSpaceOnUse"); + // Set pattern tiling + // FIXME: don't ignore XStep and YStep +- double *bbox = tiling_pattern->getBBox(); ++ const double *bbox = tiling_pattern->getBBox(); + sp_repr_set_svg_double(pattern_node, "x", 0.0); + sp_repr_set_svg_double(pattern_node, "y", 0.0); + sp_repr_set_svg_double(pattern_node, "width", bbox[2] - bbox[0]); +@@ -751,7 +751,7 @@ gchar *SvgBuilder::_createTilingPattern(GfxTilingPattern *tiling_pattern, + */ + gchar *SvgBuilder::_createGradient(GfxShading *shading, double *matrix, bool for_shading) { + Inkscape::XML::Node *gradient; +- Function *func; ++ _POPPLER_CONST Function *func; + int num_funcs; + bool extend0, extend1; + +@@ -865,7 +865,7 @@ static bool svgGetShadingColorRGB(GfxShading *shading, double offset, GfxRGB *re + + #define INT_EPSILON 8 + bool SvgBuilder::_addGradientStops(Inkscape::XML::Node *gradient, GfxShading *shading, +- Function *func) { ++ _POPPLER_CONST Function *func) { + int type = func->getType(); + if ( type == 0 || type == 2 ) { // Sampled or exponential function + GfxRGB stop1, stop2; +@@ -877,9 +877,9 @@ bool SvgBuilder::_addGradientStops(Inkscape::XML::Node *gradient, GfxShading *sh + _addStopToGradient(gradient, 1.0, &stop2, 1.0); + } + } else if ( type == 3 ) { // Stitching +- StitchingFunction *stitchingFunc = static_cast(func); +- double *bounds = stitchingFunc->getBounds(); +- double *encode = stitchingFunc->getEncode(); ++ auto stitchingFunc = static_cast<_POPPLER_CONST StitchingFunction*>(func); ++ const double *bounds = stitchingFunc->getBounds(); ++ const double *encode = stitchingFunc->getEncode(); + int num_funcs = stitchingFunc->getNumFuncs(); + + // Add stops from all the stitched functions +@@ -890,7 +890,7 @@ bool SvgBuilder::_addGradientStops(Inkscape::XML::Node *gradient, GfxShading *sh + svgGetShadingColorRGB(shading, bounds[i + 1], &color); + // Add stops + if (stitchingFunc->getFunc(i)->getType() == 2) { // process exponential fxn +- double expE = (static_cast(stitchingFunc->getFunc(i)))->getE(); ++ double expE = (static_cast<_POPPLER_CONST ExponentialFunction*>(stitchingFunc->getFunc(i)))->getE(); + if (expE > 1.0) { + expE = (bounds[i + 1] - bounds[i])/expE; // approximate exponential as a single straight line at x=1 + if (encode[2*i] == 0) { // normal sequence +@@ -1020,9 +1020,9 @@ void SvgBuilder::updateFont(GfxState *state) { + GfxFont *font = state->getFont(); + // Store original name + if (font->getName()) { +- _font_specification = g_strdup(font->getName()->getCString()); ++ _font_specification = font->getName()->getCString(); + } else { +- _font_specification = (char*) "Arial"; ++ _font_specification = "Arial"; + } + + // Prune the font name to get the correct font family name +@@ -1030,7 +1030,7 @@ void SvgBuilder::updateFont(GfxState *state) { + char *font_family = NULL; + char *font_style = NULL; + char *font_style_lowercase = NULL; +- char *plus_sign = strstr(_font_specification, "+"); ++ const char *plus_sign = strstr(_font_specification, "+"); + if (plus_sign) { + font_family = g_strdup(plus_sign + 1); + _font_specification = plus_sign + 1; +@@ -1148,7 +1148,7 @@ void SvgBuilder::updateFont(GfxState *state) { + Inkscape::CSSOStringStream os_font_size; + double css_font_size = _font_scaling * state->getFontSize(); + if ( font->getType() == fontType3 ) { +- double *font_matrix = font->getFontMatrix(); ++ const double *font_matrix = font->getFontMatrix(); + if ( font_matrix[0] != 0.0 ) { + css_font_size *= font_matrix[3] / font_matrix[0]; + } +@@ -1193,7 +1193,7 @@ void SvgBuilder::updateTextPosition(double tx, double ty) { + void SvgBuilder::updateTextMatrix(GfxState *state) { + _flushText(); + // Update text matrix +- double *text_matrix = state->getTextMat(); ++ const double *text_matrix = state->getTextMat(); + double w_scale = sqrt( text_matrix[0] * text_matrix[0] + text_matrix[2] * text_matrix[2] ); + double h_scale = sqrt( text_matrix[1] * text_matrix[1] + text_matrix[3] * text_matrix[3] ); + double max_scale; +diff --git a/src/extension/internal/pdfinput/svg-builder.h b/src/extension/internal/pdfinput/svg-builder.h +--- a/src/extension/internal/pdfinput/svg-builder.h ++++ b/src/extension/internal/pdfinput/svg-builder.h +@@ -15,6 +15,7 @@ + #endif + + #ifdef HAVE_POPPLER ++#include "poppler-transition-api.h" + + class SPDocument; + namespace Inkscape { +@@ -80,7 +81,7 @@ struct SvgGlyph { + bool style_changed; // Set to true if style has to be reset + SPCSSAttr *style; + int render_mode; // Text render mode +- char *font_specification; // Pointer to current font specification ++ const char *font_specification; // Pointer to current font specification + }; + + /** +@@ -174,7 +175,7 @@ private: + void _addStopToGradient(Inkscape::XML::Node *gradient, double offset, + GfxRGB *color, double opacity); + bool _addGradientStops(Inkscape::XML::Node *gradient, GfxShading *shading, +- Function *func); ++ _POPPLER_CONST Function *func); + gchar *_createTilingPattern(GfxTilingPattern *tiling_pattern, GfxState *state, + bool is_stroke=false); + // Image/mask creation +@@ -202,7 +203,7 @@ private: + + SPCSSAttr *_font_style; // Current font style + GfxFont *_current_font; +- char *_font_specification; ++ const char *_font_specification; + double _font_scaling; + bool _need_font_update; + Geom::Affine _text_matrix; diff --git a/gnu/packages/patches/poppler-CVE-2018-19149.patch b/gnu/packages/patches/poppler-CVE-2018-19149.patch deleted file mode 100644 index 3641f5f078..0000000000 --- a/gnu/packages/patches/poppler-CVE-2018-19149.patch +++ /dev/null @@ -1,80 +0,0 @@ -Fix CVE-2018-19149: - -https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2018-19149 -https://gitlab.freedesktop.org/poppler/poppler/issues/664 - -Patch copied from upstream source repository: - -https://gitlab.freedesktop.org/poppler/poppler/commit/f162ecdea0dda5dbbdb45503c1d55d9afaa41d44 - -From f162ecdea0dda5dbbdb45503c1d55d9afaa41d44 Mon Sep 17 00:00:00 2001 -From: Marek Kasik -Date: Fri, 20 Apr 2018 11:38:13 +0200 -Subject: [PATCH] Fix crash on missing embedded file - -Check whether an embedded file is actually present in the PDF -and show warning in that case. - -https://bugs.freedesktop.org/show_bug.cgi?id=106137 -https://gitlab.freedesktop.org/poppler/poppler/issues/236 ---- - glib/poppler-attachment.cc | 26 +++++++++++++++++--------- - glib/poppler-document.cc | 3 ++- - 2 files changed, 19 insertions(+), 10 deletions(-) - -diff --git a/glib/poppler-attachment.cc b/glib/poppler-attachment.cc -index c6502e9d..11ba5bb5 100644 ---- a/glib/poppler-attachment.cc -+++ b/glib/poppler-attachment.cc -@@ -111,17 +111,25 @@ _poppler_attachment_new (FileSpec *emb_file) - attachment->description = _poppler_goo_string_to_utf8 (emb_file->getDescription ()); - - embFile = emb_file->getEmbeddedFile(); -- attachment->size = embFile->size (); -+ if (embFile != NULL && embFile->streamObject()->isStream()) -+ { -+ attachment->size = embFile->size (); - -- if (embFile->createDate ()) -- _poppler_convert_pdf_date_to_gtime (embFile->createDate (), (time_t *)&attachment->ctime); -- if (embFile->modDate ()) -- _poppler_convert_pdf_date_to_gtime (embFile->modDate (), (time_t *)&attachment->mtime); -+ if (embFile->createDate ()) -+ _poppler_convert_pdf_date_to_gtime (embFile->createDate (), (time_t *)&attachment->ctime); -+ if (embFile->modDate ()) -+ _poppler_convert_pdf_date_to_gtime (embFile->modDate (), (time_t *)&attachment->mtime); - -- if (embFile->checksum () && embFile->checksum ()->getLength () > 0) -- attachment->checksum = g_string_new_len (embFile->checksum ()->getCString (), -- embFile->checksum ()->getLength ()); -- priv->obj_stream = embFile->streamObject()->copy(); -+ if (embFile->checksum () && embFile->checksum ()->getLength () > 0) -+ attachment->checksum = g_string_new_len (embFile->checksum ()->getCString (), -+ embFile->checksum ()->getLength ()); -+ priv->obj_stream = embFile->streamObject()->copy(); -+ } -+ else -+ { -+ g_warning ("Missing stream object for embedded file"); -+ g_clear_object (&attachment); -+ } - - return attachment; - } -diff --git a/glib/poppler-document.cc b/glib/poppler-document.cc -index 83f6aea6..ea319344 100644 ---- a/glib/poppler-document.cc -+++ b/glib/poppler-document.cc -@@ -670,7 +670,8 @@ poppler_document_get_attachments (PopplerDocument *document) - attachment = _poppler_attachment_new (emb_file); - delete emb_file; - -- retval = g_list_prepend (retval, attachment); -+ if (attachment != NULL) -+ retval = g_list_prepend (retval, attachment); - } - return g_list_reverse (retval); - } --- -2.19.1 - diff --git a/gnu/packages/patches/texlive-bin-luatex-poppler-compat.patch b/gnu/packages/patches/texlive-bin-luatex-poppler-compat.patch new file mode 100644 index 0000000000..d8b9bf172a --- /dev/null +++ b/gnu/packages/patches/texlive-bin-luatex-poppler-compat.patch @@ -0,0 +1,318 @@ +Fix LuaTeX compatibility with Poppler 0.72. + +Upstream LuaTeX have moved from Poppler to "pplib" and thus upstream +fixes are unavailable. This is based on Arch Linux patches, with minor +changes for Poppler 0.72: +https://git.archlinux.org/svntogit/packages.git/tree/trunk?h=packages/texlive-bin&id=f1b424435c8fa31d9296c7a6dc17f939a8332780 + +diff --git a/texk/web2c/luatexdir/image/pdftoepdf.w b/texk/web2c/luatexdir/image/pdftoepdf.w +--- a/texk/web2c/luatexdir/image/pdftoepdf.w ++++ b/texk/web2c/luatexdir/image/pdftoepdf.w +@@ -35,7 +35,7 @@ + + extern void md5(Guchar *msg, int msgLen, Guchar *digest); + +-static GBool isInit = gFalse; ++static bool isInit = false; + + /* Maintain AVL tree of all PDF files for embedding */ + +@@ -363,10 +363,10 @@ void copyReal(PDF pdf, double d) + + static void copyString(PDF pdf, GooString * string) + { +- char *p; ++ const char *p; + unsigned char c; + size_t i, l; +- p = string->getCString(); ++ p = string->c_str(); + l = (size_t) string->getLength(); + if (pdf->cave) + pdf_out(pdf, ' '); +@@ -393,7 +393,7 @@ static void copyString(PDF pdf, GooString * string) + pdf->cave = true; + } + +-static void copyName(PDF pdf, char *s) ++static void copyName(PDF pdf, const char *s) + { + pdf_out(pdf, '/'); + for (; *s != 0; s++) { +@@ -468,14 +468,14 @@ static void copyObject(PDF pdf, PdfDocument * pdf_doc, Object * obj) + break; + /* + case objNum: +- GBool isNum() { return type == objInt || type == objReal; } ++ bool isNum() { return type == objInt || type == objReal; } + break; + */ + case objString: + copyString(pdf, (GooString *)obj->getString()); + break; + case objName: +- copyName(pdf, (char *)obj->getName()); ++ copyName(pdf, obj->getName()); + break; + case objNull: + pdf_add_null(pdf); +@@ -531,22 +531,22 @@ static PDFRectangle *get_pagebox(Page * page, int pagebox_spec) + { + switch (pagebox_spec) { + case PDF_BOX_SPEC_MEDIA: +- return page->getMediaBox(); ++ return (PDFRectangle *) page->getMediaBox(); + break; + case PDF_BOX_SPEC_CROP: +- return page->getCropBox(); ++ return (PDFRectangle *) page->getCropBox(); + break; + case PDF_BOX_SPEC_BLEED: +- return page->getBleedBox(); ++ return (PDFRectangle *) page->getBleedBox(); + break; + case PDF_BOX_SPEC_TRIM: +- return page->getTrimBox(); ++ return (PDFRectangle *) page->getTrimBox(); + break; + case PDF_BOX_SPEC_ART: +- return page->getArtBox(); ++ return (PDFRectangle *) page->getArtBox(); + break; + default: +- return page->getMediaBox(); ++ return (PDFRectangle *) page->getMediaBox(); + break; + } + } +@@ -587,11 +587,11 @@ void read_pdf_info(image_dict * idict) + PDFRectangle *pagebox; + int pdf_major_version_found, pdf_minor_version_found; + float xsize, ysize, xorig, yorig; +- if (isInit == gFalse) { ++ if (isInit == false) { + if (!(globalParams)) + globalParams = new GlobalParams(); +- globalParams->setErrQuiet(gFalse); +- isInit = gTrue; ++ globalParams->setErrQuiet(false); ++ isInit = true; + } + if (img_type(idict) == IMG_TYPE_PDF) + pdf_doc = refPdfDocument(img_filepath(idict), FE_FAIL); +@@ -966,7 +966,7 @@ void epdf_free() + if (PdfDocumentTree != NULL) + avl_destroy(PdfDocumentTree, destroyPdfDocument); + PdfDocumentTree = NULL; +- if (isInit == gTrue) ++ if (isInit == true) + delete globalParams; +- isInit = gFalse; ++ isInit = false; + } +diff --git a/texk/web2c/luatexdir/lua/lepdflib.cc b/texk/web2c/luatexdir/lua/lepdflib.cc +--- a/texk/web2c/luatexdir/lua/lepdflib.cc ++++ b/texk/web2c/luatexdir/lua/lepdflib.cc +@@ -240,7 +240,7 @@ static int l_new_Attribute(lua_State * L) + if (uobj->pd != NULL && uobj->pd->pc != uobj->pc) + pdfdoc_changed_error(L); + uout = new_Attribute_userdata(L); +- uout->d = new Attribute(n, nlen, (Object *)uobj->d); ++ uout->d = new Attribute((GooString)n, (Object *)uobj->d); + uout->atype = ALLOC_LEPDF; + uout->pc = uobj->pc; + uout->pd = uobj->pd; +@@ -439,7 +439,7 @@ static int l_new_Object(lua_State * L) + break; + case 1: + if (lua_isboolean (L,1)) { +- uout->d = new Object(lua_toboolean(L, 1)? gTrue : gFalse); ++ uout->d = new Object(lua_toboolean(L, 1)? true : false); + uout->atype = ALLOC_LEPDF; + uout->pc = 0; + uout->pd = NULL; +@@ -596,7 +596,7 @@ static int m_##in##_##function(lua_State * L) \ + uin = (udstruct *) luaL_checkudata(L, 1, M_##in); \ + if (uin->pd != NULL && uin->pd->pc != uin->pc) \ + pdfdoc_changed_error(L); \ +- o = ((in *) uin->d)->function(); \ ++ o = (out *) ((in *) uin->d)->function(); \ + if (o != NULL) { \ + uout = new_##out##_userdata(L); \ + uout->d = o; \ +@@ -676,7 +676,7 @@ static int m_##in##_##function(lua_State * L) \ + pdfdoc_changed_error(L); \ + gs = (GooString *)((in *) uin->d)->function(); \ + if (gs != NULL) \ +- lua_pushlstring(L, gs->getCString(), gs->getLength()); \ ++ lua_pushlstring(L, gs->c_str(), gs->getLength()); \ + else \ + lua_pushnil(L); \ + return 1; \ +@@ -911,7 +911,7 @@ static int m_Array_getString(lua_State * L) + if (i > 0 && i <= len) { + gs = new GooString(); + if (((Array *) uin->d)->getString(i - 1, gs)) +- lua_pushlstring(L, gs->getCString(), gs->getLength()); ++ lua_pushlstring(L, gs->c_str(), gs->getLength()); + else + lua_pushnil(L); + delete gs; +@@ -1063,7 +1063,7 @@ static int m_Catalog_getJS(lua_State * L) + if (i > 0 && i <= len) { + gs = ((Catalog *) uin->d)->getJS(i - 1); + if (gs != NULL) +- lua_pushlstring(L, gs->getCString(), gs->getLength()); ++ lua_pushlstring(L, gs->c_str(), gs->getLength()); + else + lua_pushnil(L); + delete gs; +@@ -1125,12 +1125,12 @@ m_poppler_get_INT(Dict, getLength); + + static int m_Dict_add(lua_State * L) + { +- char *s; ++ const char *s; + udstruct *uin, *uobj; + uin = (udstruct *) luaL_checkudata(L, 1, M_Dict); + if (uin->pd != NULL && uin->pd->pc != uin->pc) + pdfdoc_changed_error(L); +- s = copyString(luaL_checkstring(L, 2)); ++ s = luaL_checkstring(L, 2); + uobj = (udstruct *) luaL_checkudata(L, 3, M_Object); + ((Dict *) uin->d)->add(s, std::move(*((Object *) uobj->d))); + return 0; +@@ -1378,7 +1378,7 @@ static int m_GooString__tostring(lua_State * L) + uin = (udstruct *) luaL_checkudata(L, 1, M_GooString); + if (uin->pd != NULL && uin->pd->pc != uin->pc) + pdfdoc_changed_error(L); +- lua_pushlstring(L, ((GooString *) uin->d)->getCString(), ++ lua_pushlstring(L, ((GooString *) uin->d)->c_str(), + ((GooString *) uin->d)->getLength()); + return 1; + } +@@ -1527,9 +1527,9 @@ static int m_Object_initBool(lua_State * L) + pdfdoc_changed_error(L); + luaL_checktype(L, 2, LUA_TBOOLEAN); + if (lua_toboolean(L, 2) != 0) +- *((Object *) uin->d) = Object(gTrue); ++ *((Object *) uin->d) = Object(true); + else +- *((Object *) uin->d) = Object(gFalse); ++ *((Object *) uin->d) = Object(false); + return 0; + } + +@@ -1814,7 +1814,7 @@ static int m_Object_getString(lua_State * L) + pdfdoc_changed_error(L); + if (((Object *) uin->d)->isString()) { + gs = (GooString *)((Object *) uin->d)->getString(); +- lua_pushlstring(L, gs->getCString(), gs->getLength()); ++ lua_pushlstring(L, gs->c_str(), gs->getLength()); + } else + lua_pushnil(L); + return 1; +@@ -2051,7 +2051,7 @@ static int m_Object_dictAdd(lua_State * L) + pdfdoc_changed_error(L); + if (!((Object *) uin->d)->isDict()) + luaL_error(L, "Object is not a Dict"); +- ((Object *) uin->d)->dictAdd(copyString(s), std::move(*((Object *) uobj->d))); ++ ((Object *) uin->d)->dictAdd(s, std::move(*((Object *) uobj->d))); + return 0; + } + +@@ -2470,9 +2470,9 @@ static int m_PDFDoc_getFileName(lua_State * L) + uin = (udstruct *) luaL_checkudata(L, 1, M_PDFDoc); + if (uin->pd != NULL && uin->pd->pc != uin->pc) + pdfdoc_changed_error(L); +- gs = ((PdfDocument *) uin->d)->doc->getFileName(); ++ gs = (GooString *) ((PdfDocument *) uin->d)->doc->getFileName(); + if (gs != NULL) +- lua_pushlstring(L, gs->getCString(), gs->getLength()); ++ lua_pushlstring(L, gs->c_str(), gs->getLength()); + else + lua_pushnil(L); + return 1; +@@ -2559,9 +2559,9 @@ static int m_PDFDoc_readMetadata(lua_State * L) + if (uin->pd != NULL && uin->pd->pc != uin->pc) + pdfdoc_changed_error(L); + if (((PdfDocument *) uin->d)->doc->getCatalog()->isOk()) { +- gs = ((PdfDocument *) uin->d)->doc->readMetadata(); ++ gs = (GooString *) ((PdfDocument *) uin->d)->doc->readMetadata(); + if (gs != NULL) +- lua_pushlstring(L, gs->getCString(), gs->getLength()); ++ lua_pushlstring(L, gs->c_str(), gs->getLength()); + else + lua_pushnil(L); + } else +@@ -2577,7 +2577,7 @@ static int m_PDFDoc_getStructTreeRoot(lua_State * L) + if (uin->pd != NULL && uin->pd->pc != uin->pc) + pdfdoc_changed_error(L); + if (((PdfDocument *) uin->d)->doc->getCatalog()->isOk()) { +- obj = ((PdfDocument *) uin->d)->doc->getStructTreeRoot(); ++ obj = (StructTreeRoot *) ((PdfDocument *) uin->d)->doc->getStructTreeRoot(); + uout = new_StructTreeRoot_userdata(L); + uout->d = obj; + uout->pc = uin->pc; +@@ -3038,12 +3038,12 @@ m_poppler_get_BOOL(Attribute, isHidden); + + static int m_Attribute_setHidden(lua_State * L) + { +- GBool i; ++ bool i; + udstruct *uin; + uin = (udstruct *) luaL_checkudata(L, 1, M_Attribute); + if (uin->pd != NULL && uin->pd->pc != uin->pc) + pdfdoc_changed_error(L); +- i = (GBool) lua_toboolean(L, 2); ++ i = (bool) lua_toboolean(L, 2); + ((Attribute *) uin->d)->setHidden(i); + return 0; + } +@@ -3180,7 +3180,7 @@ static int m_StructElement_getParentRef(lua_State * L) + // Ref is false if the C++ functione return false + static int m_StructElement_getPageRef(lua_State * L) + { +- GBool b; ++ bool b; + Ref *r; + udstruct *uin, *uout; + uin = (udstruct *) luaL_checkudata(L, 1, M_StructElement); +@@ -3226,16 +3226,16 @@ static int m_StructElement_setRevision(lua_State * L) + + static int m_StructElement_getText(lua_State * L) + { +- GBool i; ++ bool i; + GooString *gs; + udstruct *uin; + uin = (udstruct *) luaL_checkudata(L, 1, M_StructElement); + if (uin->pd != NULL && uin->pd->pc != uin->pc) + pdfdoc_changed_error(L); +- i = (GBool) lua_toboolean(L, 2); ++ i = (bool) lua_toboolean(L, 2); + gs = ((StructElement *) uin->d)->getText(i); + if (gs != NULL) +- lua_pushlstring(L, gs->getCString(), gs->getLength()); ++ lua_pushlstring(L, gs->c_str(), gs->getLength()); + else + lua_pushnil(L); + return 1; +@@ -3321,7 +3321,7 @@ static int m_StructElement_findAttribute(lua_State * L) + { + Attribute::Type t; + Attribute::Owner o; +- GBool g; ++ bool g; + udstruct *uin, *uout; + const Attribute *a; + uin = (udstruct *) luaL_checkudata(L, 1, M_StructElement); +@@ -3329,7 +3329,7 @@ static int m_StructElement_findAttribute(lua_State * L) + pdfdoc_changed_error(L); + t = (Attribute::Type) luaL_checkint(L,1); + o = (Attribute::Owner) luaL_checkint(L,2); +- g = (GBool) lua_toboolean(L, 3); ++ g = (bool) lua_toboolean(L, 3); + a = ((StructElement *) uin->d)->findAttribute(t,g,o); + + if (a!=NULL){ diff --git a/gnu/packages/patches/texlive-bin-pdftex-poppler-compat.patch b/gnu/packages/patches/texlive-bin-pdftex-poppler-compat.patch new file mode 100644 index 0000000000..eba4733f32 --- /dev/null +++ b/gnu/packages/patches/texlive-bin-pdftex-poppler-compat.patch @@ -0,0 +1,188 @@ +Fix compatibility with Poppler 0.72. + +These files are taken from the upstream "poppler0.72.0.cc" variants and +diffed against the "newpoppler" files from the 20180414 distribution. + +See revision 49336: +https://tug.org/svn/texlive/trunk/Build/source/texk/web2c/pdftexdir/ + +--- a/texk/web2c/pdftexdir/pdftoepdf-newpoppler.cc 1970-01-01 01:00:00.000000000 +0100 ++++ b/texk/web2c/pdftexdir/pdftoepdf-newpoppler.cc 2018-12-09 21:14:58.479732695 +0100 +@@ -22,7 +22,7 @@ + https://git.archlinux.org/svntogit/packages.git/plain/texlive-bin/trunk + by Arch Linux. A little modifications are made to avoid a crash for + some kind of pdf images, such as figure_missing.pdf in gnuplot. +-The poppler should be 0.59.0 or newer versions. ++The poppler should be 0.72.0 or newer versions. + POPPLER_VERSION should be defined. + */ + +@@ -120,7 +120,7 @@ + + static InObj *inObjList; + static UsedEncoding *encodingList; +-static GBool isInit = gFalse; ++static bool isInit = false; + + // -------------------------------------------------------------------- + // Maintain list of open embedded PDF files +@@ -317,7 +317,7 @@ + pdf_puts("<<\n"); + assert(r->type == objFont); // FontDescriptor is in fd_tree + for (i = 0, l = obj->dictGetLength(); i < l; ++i) { +- key = obj->dictGetKey(i); ++ key = (char *)obj->dictGetKey(i); + if (strncmp("FontDescriptor", key, strlen("FontDescriptor")) == 0 + || strncmp("BaseFont", key, strlen("BaseFont")) == 0 + || strncmp("Encoding", key, strlen("Encoding")) == 0) +@@ -427,7 +427,7 @@ + charset = fontdesc.dictLookup("CharSet"); + if (!charset.isNull() && + charset.isString() && is_subsetable(fontmap)) +- epdf_mark_glyphs(fd, (char *)charset.getString()->getCString()); ++ epdf_mark_glyphs(fd, (char *)charset.getString()->c_str()); + else + embed_whole_font(fd); + addFontDesc(fontdescRef.getRef(), fd); +@@ -454,7 +454,7 @@ + for (i = 0, l = obj->dictGetLength(); i < l; ++i) { + fontRef = obj->dictGetValNF(i); + if (fontRef.isRef()) +- copyFont(obj->dictGetKey(i), &fontRef); ++ copyFont((char *)obj->dictGetKey(i), &fontRef); + else if (fontRef.isDict()) { // some programs generate pdf with embedded font object + copyName((char *)obj->dictGetKey(i)); + pdf_puts(" "); +@@ -566,7 +566,7 @@ + pdf_printf("%s", convertNumToPDF(obj->getNum())); + } else if (obj->isString()) { + s = (GooString *)obj->getString(); +- p = s->getCString(); ++ p = (char *)s->c_str(); + l = s->getLength(); + if (strlen(p) == (unsigned int) l) { + pdf_puts("("); +@@ -664,7 +664,7 @@ + ("PDF inclusion: CID fonts are not supported" + " (try to disable font replacement to fix this)"); + } +- if ((s = ((Gfx8BitFont *) r->font)->getCharName(i)) != 0) ++ if ((s = (char *)((Gfx8BitFont *) r->font)->getCharName(i)) != 0) + glyphNames[i] = s; + else + glyphNames[i] = notdef; +@@ -683,7 +683,7 @@ + } + + // get the pagebox according to the pagebox_spec +-static PDFRectangle *get_pagebox(Page * page, int pagebox_spec) ++static const PDFRectangle *get_pagebox(Page * page, int pagebox_spec) + { + if (pagebox_spec == pdfboxspecmedia) + return page->getMediaBox(); +@@ -715,7 +715,7 @@ + { + PdfDocument *pdf_doc; + Page *page; +- PDFRectangle *pagebox; ++ const PDFRectangle *pagebox; + #ifdef POPPLER_VERSION + int pdf_major_version_found, pdf_minor_version_found; + #else +@@ -724,8 +724,8 @@ + // initialize + if (!isInit) { + globalParams = new GlobalParams(); +- globalParams->setErrQuiet(gFalse); +- isInit = gTrue; ++ globalParams->setErrQuiet(false); ++ isInit = true; + } + // open PDF file + pdf_doc = find_add_document(image_name); +@@ -849,7 +849,7 @@ + pageObj = xref->fetch(pageRef->num, pageRef->gen); + pageDict = pageObj.getDict(); + rotate = page->getRotate(); +- PDFRectangle *pagebox; ++ const PDFRectangle *pagebox; + // write the Page header + pdf_puts("/Type /XObject\n"); + pdf_puts("/Subtype /Form\n"); +@@ -977,7 +977,7 @@ + } + l = dic1.getLength(); + for (i = 0; i < l; i++) { +- groupDict.dictAdd(copyString(dic1.getKey(i)), ++ groupDict.dictAdd((const char *)copyString(dic1.getKey(i)), + dic1.getValNF(i)); + } + // end modification +@@ -1001,14 +1001,14 @@ + pdf_puts("/Resources <<\n"); + for (i = 0, l = obj1->dictGetLength(); i < l; ++i) { + obj2 = obj1->dictGetVal(i); +- key = obj1->dictGetKey(i); ++ key = (char *)obj1->dictGetKey(i); + if (strcmp("Font", key) == 0) + copyFontResources(&obj2); + else if (strcmp("ProcSet", key) == 0) + copyProcSet(&obj2); + else +- copyOtherResources(&obj2, key); ++ copyOtherResources(&obj2, (char *)key); + } + pdf_puts(">>\n"); + } + +--- a/texk/web2c/pdftexdir/pdftosrc-newpoppler.cc 1970-01-01 01:00:00.000000000 +0100 ++++ b/texk/web2c/pdftexdir/pdftosrc-newpoppler.cc 2018-12-09 21:14:58.479732695 +0100 +@@ -20,7 +20,7 @@ + /* + This is based on the patch texlive-poppler-0.59.patch <2017-09-19> at + https://git.archlinux.org/svntogit/packages.git/plain/texlive-bin/trunk +-by Arch Linux. The poppler should be 0.59.0 or newer versions. ++by Arch Linux. The poppler should be 0.72.0 or newer versions. + POPPLER_VERSION should be defined. + */ + +@@ -109,7 +109,7 @@ + fprintf(stderr, "No SourceName found\n"); + exit(1); + } +- outname = (char *)srcName.getString()->getCString(); ++ outname = (char *)srcName.getString()->c_str(); + // We cannot free srcName, as objname shares its string. + // srcName.free(); + } else if (objnum > 0) { +@@ -118,7 +118,7 @@ + fprintf(stderr, "Not a Stream object\n"); + exit(1); + } +- sprintf(buf, "%s", fileName->getCString()); ++ sprintf(buf, "%s", fileName->c_str()); + if ((p = strrchr(buf, '.')) == 0) + p = strchr(buf, 0); + if (objgen == 0) +@@ -128,7 +128,7 @@ + outname = buf; + } else { // objnum < 0 means we are extracting the XRef table + extract_xref_table = true; +- sprintf(buf, "%s", fileName->getCString()); ++ sprintf(buf, "%s", fileName->c_str()); + if ((p = strrchr(buf, '.')) == 0) + p = strchr(buf, 0); + sprintf(p, ".xref"); +@@ -173,9 +173,9 @@ + + // parse the header: object numbers and offsets + objStr.streamReset(); +- str = new EmbedStream(objStr.getStream(), Object(objNull), gTrue, first); ++ str = new EmbedStream(objStr.getStream(), Object(objNull), true, first); + lexer = new Lexer(xref, str); +- parser = new Parser(xref, lexer, gFalse); ++ parser = new Parser(xref, lexer, false); + for (n = 0; n < nObjects; ++n) { + obj1 = parser->getObj(); + obj2 = parser->getObj(); + diff --git a/gnu/packages/patches/texlive-bin-xetex-poppler-compat.patch b/gnu/packages/patches/texlive-bin-xetex-poppler-compat.patch new file mode 100644 index 0000000000..cac716cc59 --- /dev/null +++ b/gnu/packages/patches/texlive-bin-xetex-poppler-compat.patch @@ -0,0 +1,31 @@ +Fix compatibility with Poppler 0.72. + +Patch taken from upstream: +https://tug.org/svn/texlive/trunk/Build/source/texk/web2c/xetexdir/pdfimage.cpp?r1=44964&r2=48969&diff_format=u + +--- a/texk/web2c/xetexdir/pdfimage.cpp 2017/08/06 07:12:02 44964 ++++ b/texk/web2c/xetexdir/pdfimage.cpp 2018/10/22 04:01:42 48969 +@@ -82,19 +82,19 @@ + switch (pdf_box) { + default: + case pdfbox_crop: +- r = page->getCropBox(); ++ r = (PDFRectangle *)page->getCropBox(); + break; + case pdfbox_media: +- r = page->getMediaBox(); ++ r = (PDFRectangle *)page->getMediaBox(); + break; + case pdfbox_bleed: +- r = page->getBleedBox(); ++ r = (PDFRectangle *)page->getBleedBox(); + break; + case pdfbox_trim: +- r = page->getTrimBox(); ++ r = (PDFRectangle *)page->getTrimBox(); + break; + case pdfbox_art: +- r = page->getArtBox(); ++ r = (PDFRectangle *)page->getArtBox(); + break; + } diff --git a/gnu/packages/pdf.scm b/gnu/packages/pdf.scm index 4170e4a0ae..d5e23f6c9e 100644 --- a/gnu/packages/pdf.scm +++ b/gnu/packages/pdf.scm @@ -82,15 +82,14 @@ (define-public poppler (package (name "poppler") - (replacement poppler/fixed) - (version "0.68.0") + (version "0.72.0") (source (origin (method url-fetch) (uri (string-append "https://poppler.freedesktop.org/poppler-" version ".tar.xz")) (sha256 (base32 - "0n0f7mv24lzv9p3dlzakpdhqg7ygcvl6l40grcz95xldzgq083gr")))) + "0lfs1b1jfamxl13zbl5n448dqvl9n8frbv8180y7b7kfyaw7wx61")))) (build-system cmake-build-system) ;; FIXME: ;; use libcurl: no @@ -132,14 +131,6 @@ (license license:gpl2+) (home-page "https://poppler.freedesktop.org/"))) -(define poppler/fixed - (package - (inherit poppler) - (source (origin - (inherit (package-source poppler)) - (patches (append (origin-patches (package-source poppler)) - (search-patches "poppler-CVE-2018-19149.patch"))))))) - (define-public poppler-data (package (name "poppler-data") diff --git a/gnu/packages/scribus.scm b/gnu/packages/scribus.scm index 615d7e23a2..52b96cd5d4 100644 --- a/gnu/packages/scribus.scm +++ b/gnu/packages/scribus.scm @@ -56,7 +56,56 @@ (sha256 (base32 "00ys0p6h3iq77kh72dkl0qrf7qvznq18qdrgiq10gfxja1995034")) - (patches (search-patches "scribus-poppler.patch")))) + (patches (append + (search-patches "scribus-poppler.patch") + (list (origin + (method url-fetch) + (uri (string-append + "https://github.com/scribusproject/scribus/commit/" + "7d4ceeb5cac32287769e3c0238699e0b3e56c24d.patch")) + (file-name "scribus-poppler-0.64.patch") + (sha256 + (base32 + "1kr27bfzkpabrh42nsrrvlqyycdg9isbavpaa5spgmrhidcg02xj"))) + (origin + (method url-fetch) + (uri (string-append + "https://github.com/scribusproject/scribus/commit/" + "76561c1a55cd07c268f8f2b2fea888532933700b.patch")) + (file-name "scribus-poppler-config.patch") + (sha256 + (base32 + "01k18xjj82c3ndzp89dlpfhhdccc8z0acf8b04r592jyr5y9rc19"))) + (origin + (method url-fetch) + (uri (string-append + "https://github.com/scribusproject/scribus/commit/" + "8e05d26c19097ac2ad5b4ebbf40a3771ee6faf9c.patch")) + (file-name "scribus-poppler-0.69.patch") + (sha256 + (base32 + "1avdmsj5l543j0irq18nxgiw99n395jj56ih5dsal59fn0wbqk42"))) + (origin + (method url-fetch) + (uri (string-append "https://git.archlinux.org/svntogit/" + "community.git/plain/trunk/scribus-" + "poppler-0.70.patch?h=packages/scribus&id=" + "8ef43ee2fceb0753ed5a76bb0a11c84775898ffc")) + (file-name "scribus-poppler-0.70.patch") + (sha256 + (base32 + "0dw7ix3jaj0y1q97cmmqwb2qgdx760yhxx86wa8rnx0xhfi5x6qr")))))) + (modules '((guix build utils))) + (snippet + '(begin + (for-each (lambda (file) + (substitute* file + ;; These are required for compatibility with Poppler 0.71. + (("GBool") "bool") (("gTrue") "true") (("gFalse") "false") + ;; ...and this for Poppler 0.72. + (("getCString") "c_str"))) + (find-files "scribus/plugins/import/pdf")) + #t)))) (build-system cmake-build-system) (arguments `(#:tests? #f ;no test target diff --git a/gnu/packages/tex.scm b/gnu/packages/tex.scm index 916aa54d58..d345e89430 100644 --- a/gnu/packages/tex.scm +++ b/gnu/packages/tex.scm @@ -102,15 +102,19 @@ (patches (list ;; This is required for compatibility with Poppler 0.64.0 and to fix a - ;; segmentation fault in dvipdfm-x from XeTeX. + ;; segmentation fault in dvipdfm-x from XeTeX, and also contains a fix + ;; for CVE-2018-17407. (origin (method url-fetch) (uri (string-append "http://www.linuxfromscratch.org/patches/blfs/" - "svn/texlive-" version "-source-upstream_fixes-1.patch")) + "svn/texlive-" version "-source-upstream_fixes-2.patch")) (file-name "texlive-poppler-compat.patch") (sha256 (base32 - "0f8vhyj167y4xj0jx47vkybrcacfpxw0wdn1b777yq3xmhlahhlg"))))))) + "04sxy1qv9y575mxwyg3y7rx7mh540pfjqx7yni7ncb5wjbq9pq1a"))) + (search-patch "texlive-bin-luatex-poppler-compat.patch") + (search-patch "texlive-bin-pdftex-poppler-compat.patch") + (search-patch "texlive-bin-xetex-poppler-compat.patch"))))) (build-system gnu-build-system) (inputs `(("texlive-extra-src" ,texlive-extra-src) -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:58 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:58 +0000 Received: from localhost ([127.0.0.1]:42445 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdO-0001Mm-MX for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:58 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:48133) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdG-0001LM-2H for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:43 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 054C121311 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:37 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:37 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=BS6EZGgJ2PeD3 Tr/IJPcbdBFnmrDPCihRFuTu2WgCWk=; b=gUfEYPs2fMKcRWHoxcFANhH/LxmZ8 g71QL/2ne8x7SIkWa217j4E2vhUVQpqIn27EykTBLNbZMl/teonbJu1bGc1hU6Fu wogxWX0sTYLgCCD00KwbJ5ER/0jqTqNs0SYTKtvMcfhE92/szwJVUgvPxCgOnZ71 AajJL7s9HxUf/jqk3ANV1rJKKUeCZuZ0TAy4vszDfscNfxfgbhfz9gm2/KtiJhFe 2dryMXfjQxN8kSfWEXc/JrgE6HikLLL1EFr787PrdzEMdZ78pjOQtjSGEjIObGIO e7Lu9vT7mFlGTuo+V+hQFNddCJTrmhL0mlzbYVmPYNITqowSYLezBUY+w== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=BS6EZGgJ2PeD3Tr/IJPcbdBFnmrDPCihRFuTu2WgCWk=; b=Fn5iUz6l pf3k+yqCreGPev/J9c84WLP+ftmD/x8Gk7x8eAVLvEigpO74CyRW60PHuR6rMQ2Z Nwd2ZLqbzv/eJuqL6S8qb8CVjPW3wnerKWFKGE0V44pmLfqLf8wYS0h0jBqQTKI6 KW9bKjq0BNwoPkUxN6OfjxGbUxpOz7sW/7YL57avbgfYz6YAUiOS0rm+ltDkw3ga nZTHNuivt3INf+n95jb4db6Dhm8DrII1Ar2Hl5HvXj1ukcmoaNfhoL6vo1jBQQwT CtNrycjFvSYyxP0NuVm7g5fX1Esss+8+F7ynrUA9DZXAhtVYa5q8Z7Kt7GynEYB2 au/m0OZuDY7/nw== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecufghrlhcuvffnffculddqiedmnecujfgurhephffvufffkffojghfggfgsedtke ertdertddtnecuhfhrohhmpeforghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgr shhtmhgrihhlrdgtohhmqeenucffohhmrghinhepnhhishhtrdhgohhvpdgthhhrohhmih humhdrohhrghdpghhhohhsthhstghrihhpthdrtghomhenucfkphepiedvrdduiedrvddv iedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrg hilhdrtghomhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 4DFEAE4430 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:36 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 12/23] gnu: ghostscript: Update to 9.26. Date: Tue, 11 Dec 2018 02:14:05 +0100 Message-Id: <20181211011416.15902-12-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) * gnu/packages/patches/ghostscript-bug-699708.patch, gnu/packages/patches/ghostscript-CVE-2018-16509.patch: Delete files. * gnu/local.mk (dist_patch_DATA): Remove them. * gnu/packages/ghostscript.scm (ghostscript): Update to 9.26. [source](patches): Remove obsolete. --- gnu/local.mk | 2 - gnu/packages/ghostscript.scm | 8 +- .../patches/ghostscript-CVE-2018-16509.patch | 193 ------------------ .../patches/ghostscript-bug-699708.patch | 160 --------------- 4 files changed, 3 insertions(+), 360 deletions(-) delete mode 100644 gnu/packages/patches/ghostscript-CVE-2018-16509.patch delete mode 100644 gnu/packages/patches/ghostscript-bug-699708.patch diff --git a/gnu/local.mk b/gnu/local.mk index aaab4c72ec..45d8effc11 100644 --- a/gnu/local.mk +++ b/gnu/local.mk @@ -738,8 +738,6 @@ dist_patch_DATA = \ %D%/packages/patches/ghc-8.0-fall-back-to-madv_dontneed.patch \ %D%/packages/patches/ghc-dont-pass-linker-flags-via-response-files.patch \ %D%/packages/patches/ghc-haddock-library-unbundle.patch \ - %D%/packages/patches/ghostscript-CVE-2018-16509.patch \ - %D%/packages/patches/ghostscript-bug-699708.patch \ %D%/packages/patches/ghostscript-no-header-id.patch \ %D%/packages/patches/ghostscript-no-header-uuid.patch \ %D%/packages/patches/ghostscript-no-header-creationdate.patch \ diff --git a/gnu/packages/ghostscript.scm b/gnu/packages/ghostscript.scm index b46451d94e..d8c0050513 100644 --- a/gnu/packages/ghostscript.scm +++ b/gnu/packages/ghostscript.scm @@ -135,7 +135,7 @@ printing, and psresize, for adjusting page sizes.") (define-public ghostscript (package (name "ghostscript") - (version "9.24") + (version "9.26") (source (origin (method url-fetch) @@ -145,10 +145,8 @@ printing, and psresize, for adjusting page sizes.") "/ghostscript-" version ".tar.xz")) (sha256 (base32 - "1mk922rnml93w2g42yxiyn8xqanc50cm65irrgh0b6lp4kgifjfl")) - (patches (search-patches "ghostscript-CVE-2018-16509.patch" - "ghostscript-bug-699708.patch" - "ghostscript-no-header-creationdate.patch" + "1645f47all5w27bfhiq15vycdm954lmr6agqkrp68ksq6xglgvch")) + (patches (search-patches "ghostscript-no-header-creationdate.patch" "ghostscript-no-header-id.patch" "ghostscript-no-header-uuid.patch")) (modules '((guix build utils))) diff --git a/gnu/packages/patches/ghostscript-CVE-2018-16509.patch b/gnu/packages/patches/ghostscript-CVE-2018-16509.patch deleted file mode 100644 index 50ffa3cb98..0000000000 --- a/gnu/packages/patches/ghostscript-CVE-2018-16509.patch +++ /dev/null @@ -1,193 +0,0 @@ -Ghostscript 9.24 was released with an incomplete fix for CVE-2018-16509: -https://nvd.nist.gov/vuln/detail/CVE-2018-16509 -https://bugs.chromium.org/p/project-zero/issues/detail?id=1640#c19 -https://bugs.ghostscript.com/show_bug.cgi?id=699718 - -The reproducers no longer work after applying these commits: - -https://git.ghostscript.com/?p=ghostpdl.git;a=commitdiff;h=5812b1b78fc4d36fdc293b7859de69241140d590 -https://git.ghostscript.com/?p=ghostpdl.git;a=commitdiff;h=e914f1da46e33decc534486598dc3eadf69e6efb -https://git.ghostscript.com/?p=ghostpdl.git;a=commitdiff;h=3e5d316b72e3965b7968bb1d96baa137cd063ac6 -https://git.ghostscript.com/?p=ghostpdl.git;a=commitdiff;h=643b24dbd002fb9c131313253c307cf3951b3d47 - -This patch is a "squashed" version of those. - -diff --git a/Resource/Init/gs_setpd.ps b/Resource/Init/gs_setpd.ps -index bba3c8c0e..8fa7c51df 100644 ---- a/Resource/Init/gs_setpd.ps -+++ b/Resource/Init/gs_setpd.ps -@@ -95,27 +95,41 @@ level2dict begin - { % Since setpagedevice doesn't create new device objects, - % we must (carefully) reinstall the old parameters in - % the same device. -- .currentpagedevice pop //null currentdevice //null .trysetparams -+ .currentpagedevice pop //null currentdevice //null -+ { .trysetparams } .internalstopped -+ { -+ //null -+ } if - dup type /booleantype eq - { pop pop } -- { % This should never happen! -+ { - SETPDDEBUG { (Error in .trysetparams!) = pstack flush } if -- cleartomark pop pop pop -+ {cleartomark pop pop pop} .internalstopped pop -+ % if resetting the entire device state failed, at least put back the -+ % security related key -+ currentdevice //null //false mark /.LockSafetyParams -+ currentpagedevice /.LockSafetyParams .knownget not -+ {systemdict /SAFER .knownget not {//false} } if -+ .putdeviceparamsonly - /.installpagedevice cvx /rangecheck signalerror - } - ifelse pop pop - % A careful reading of the Red Book reveals that an erasepage - % should occur, but *not* an initgraphics. - erasepage .beginpage -- } bind def -+ } bind executeonly def - - /.uninstallpagedevice -- { 2 .endpage { .currentnumcopies //false .outputpage } if -+ { -+ {2 .endpage { .currentnumcopies //false .outputpage } if} .internalstopped pop - nulldevice - } bind def - - (%grestorepagedevice) cvn -- { .uninstallpagedevice grestore .installpagedevice -+ { -+ .uninstallpagedevice -+ grestore -+ .installpagedevice - } bind def - - (%grestoreallpagedevice) cvn -diff --git a/psi/zdevice2.c b/psi/zdevice2.c -index 0c7080d57..159a0c0d9 100644 ---- a/psi/zdevice2.c -+++ b/psi/zdevice2.c -@@ -251,8 +251,8 @@ z2currentgstate(i_ctx_t *i_ctx_p) - /* ------ Wrappers for operators that reset the graphics state. ------ */ - - /* Check whether we need to call out to restore the page device. */ --static bool --restore_page_device(const gs_gstate * pgs_old, const gs_gstate * pgs_new) -+static int -+restore_page_device(i_ctx_t *i_ctx_p, const gs_gstate * pgs_old, const gs_gstate * pgs_new) - { - gx_device *dev_old = gs_currentdevice(pgs_old); - gx_device *dev_new; -@@ -260,9 +260,10 @@ restore_page_device(const gs_gstate * pgs_old, const gs_gstate * pgs_new) - gx_device *dev_t2; - bool samepagedevice = obj_eq(dev_old->memory, &gs_int_gstate(pgs_old)->pagedevice, - &gs_int_gstate(pgs_new)->pagedevice); -+ bool LockSafetyParams = dev_old->LockSafetyParams; - - if ((dev_t1 = (*dev_proc(dev_old, get_page_device)) (dev_old)) == 0) -- return false; -+ return 0; - /* If we are going to putdeviceparams in a callout, we need to */ - /* unlock temporarily. The device will be re-locked as needed */ - /* by putdeviceparams from the pgs_old->pagedevice dict state. */ -@@ -271,23 +272,51 @@ restore_page_device(const gs_gstate * pgs_old, const gs_gstate * pgs_new) - dev_new = gs_currentdevice(pgs_new); - if (dev_old != dev_new) { - if ((dev_t2 = (*dev_proc(dev_new, get_page_device)) (dev_new)) == 0) -- return false; -- if (dev_t1 != dev_t2) -- return true; -+ samepagedevice = true; -+ else if (dev_t1 != dev_t2) -+ samepagedevice = false; -+ } -+ -+ if (LockSafetyParams && !samepagedevice) { -+ const int required_ops = 512; -+ const int required_es = 32; -+ -+ /* The %grestorepagedevice must complete: the biggest danger -+ is operand stack overflow. As we use get/putdeviceparams -+ that means pushing all the device params onto the stack, -+ pdfwrite having by far the largest number of parameters -+ at (currently) 212 key/value pairs - thus needing (currently) -+ 424 entries on the op stack. Allowing for working stack -+ space, and safety margin..... -+ */ -+ if (required_ops + ref_stack_count(&o_stack) >= ref_stack_max_count(&o_stack)) { -+ gs_currentdevice(pgs_old)->LockSafetyParams = LockSafetyParams; -+ return_error(gs_error_stackoverflow); -+ } -+ /* We also want enough exec stack space - 32 is an overestimate of -+ what we need to complete the Postscript call out. -+ */ -+ if (required_es + ref_stack_count(&e_stack) >= ref_stack_max_count(&e_stack)) { -+ gs_currentdevice(pgs_old)->LockSafetyParams = LockSafetyParams; -+ return_error(gs_error_execstackoverflow); -+ } - } - /* - * The current implementation of setpagedevice just sets new - * parameters in the same device object, so we have to check - * whether the page device dictionaries are the same. - */ -- return !samepagedevice; -+ return samepagedevice ? 0 : 1; - } - - /* - grestore - */ - static int - z2grestore(i_ctx_t *i_ctx_p) - { -- if (!restore_page_device(igs, gs_gstate_saved(igs))) -+ int code = restore_page_device(i_ctx_p, igs, gs_gstate_saved(igs)); -+ if (code < 0) return code; -+ -+ if (code == 0) - return gs_grestore(igs); - return push_callout(i_ctx_p, "%grestorepagedevice"); - } -@@ -297,7 +326,9 @@ static int - z2grestoreall(i_ctx_t *i_ctx_p) - { - for (;;) { -- if (!restore_page_device(igs, gs_gstate_saved(igs))) { -+ int code = restore_page_device(i_ctx_p, igs, gs_gstate_saved(igs)); -+ if (code < 0) return code; -+ if (code == 0) { - bool done = !gs_gstate_saved(gs_gstate_saved(igs)); - - gs_grestore(igs); -@@ -328,11 +359,15 @@ z2restore(i_ctx_t *i_ctx_p) - if (code < 0) return code; - - while (gs_gstate_saved(gs_gstate_saved(igs))) { -- if (restore_page_device(igs, gs_gstate_saved(igs))) -+ code = restore_page_device(i_ctx_p, igs, gs_gstate_saved(igs)); -+ if (code < 0) return code; -+ if (code > 0) - return push_callout(i_ctx_p, "%restore1pagedevice"); - gs_grestore(igs); - } -- if (restore_page_device(igs, gs_gstate_saved(igs))) -+ code = restore_page_device(i_ctx_p, igs, gs_gstate_saved(igs)); -+ if (code < 0) return code; -+ if (code > 0) - return push_callout(i_ctx_p, "%restorepagedevice"); - - code = dorestore(i_ctx_p, asave); -@@ -355,9 +390,12 @@ static int - z2setgstate(i_ctx_t *i_ctx_p) - { - os_ptr op = osp; -+ int code; - - check_stype(*op, st_igstate_obj); -- if (!restore_page_device(igs, igstate_ptr(op))) -+ code = restore_page_device(i_ctx_p, igs, igstate_ptr(op)); -+ if (code < 0) return code; -+ if (code == 0) - return zsetgstate(i_ctx_p); - return push_callout(i_ctx_p, "%setgstatepagedevice"); - } diff --git a/gnu/packages/patches/ghostscript-bug-699708.patch b/gnu/packages/patches/ghostscript-bug-699708.patch deleted file mode 100644 index 1567be1c6f..0000000000 --- a/gnu/packages/patches/ghostscript-bug-699708.patch +++ /dev/null @@ -1,160 +0,0 @@ -Additional security fix that missed 9.24. - -Taken from upstream: -http://git.ghostscript.com/?p=ghostpdl.git;a=commitdiff;h=fb713b3818b52d8a6cf62c951eba2e1795ff9624 - -From fb713b3818b52d8a6cf62c951eba2e1795ff9624 Mon Sep 17 00:00:00 2001 -From: Chris Liddell -Date: Thu, 6 Sep 2018 09:16:22 +0100 -Subject: [PATCH] Bug 699708 (part 1): 'Hide' non-replaceable error handlers - for SAFER - -We already had a 'private' dictionary for non-standard errors: gserrordict. - -This now includes all the default error handlers, the dictionary is made -noaccess and all the prodedures are bound and executeonly. - -When running with -dSAFER, in the event of a Postscript error, instead of -pulling the handler from errordict, we'll pull it from gserrordict - thus -malicious input cannot trigger problems by the use of custom error handlers. - -errordict remains open and writeable, so files such as the Quality Logic tests -that install their own handlers will still 'work', with the exception that the -custom error handlers will not be called. - -This is a 'first pass', 'sledgehammer' approach: a nice addition would to allow -an integrator to specify a list of errors that are not to be replaced (for -example, embedded applications would probably want to ensure that VMerror is -always handled as they intend). ---- - Resource/Init/gs_init.ps | 29 ++++++++++++++++++----------- - psi/interp.c | 30 +++++++++++++++++++++--------- - 2 files changed, 39 insertions(+), 20 deletions(-) - -diff --git a/Resource/Init/gs_init.ps b/Resource/Init/gs_init.ps -index 071c39205..bc8b7951c 100644 ---- a/Resource/Init/gs_init.ps -+++ b/Resource/Init/gs_init.ps -@@ -881,7 +881,7 @@ userdict /.currentresourcefile //null put - { not exch pop exit } { pop } ifelse - } - for exch pop .quit -- } bind def -+ } bind executeonly def - /.errorhandler % .errorhandler - - { % Detect an internal 'stopped'. - 1 .instopped { //null eq { pop pop stop } if } if -@@ -926,7 +926,7 @@ userdict /.currentresourcefile //null put - $error /globalmode get $error /.nosetlocal get and .setglobal - $error /.inerror //false put - stop -- } bind def -+ } bind executeonly def - % Define the standard handleerror. We break out the printing procedure - % (.printerror) so that it can be extended for binary output - % if the Level 2 facilities are present. -@@ -976,7 +976,7 @@ userdict /.currentresourcefile //null put - ifelse % newerror - end - flush -- } bind def -+ } bind executeonly def - /.printerror_long % long error printout, - % $error is on the dict stack - { % Push the (anonymous) stack printing procedure. -@@ -1053,14 +1053,14 @@ userdict /.currentresourcefile //null put - { (Current file position is ) print position = } - if - -- } bind def -+ } bind executeonly def - % Define a procedure for clearing the error indication. - /.clearerror - { $error /newerror //false put - $error /errorname //null put - $error /errorinfo //null put - 0 .setoserrno -- } bind def -+ } bind executeonly def - - % Define $error. This must be in local VM. - .currentglobal //false .setglobal -@@ -1086,11 +1086,15 @@ end - /errordict ErrorNames length 3 add dict - .forcedef % errordict is local, systemdict is global - .setglobal % back to global VM --% For greater Adobe compatibility, we put all non-standard errors in a --% separate dictionary, gserrordict. It does not need to be in local VM, --% because PostScript programs do not access it. -+% gserrordict contains all the default error handling methods, but unlike -+% errordict it is noaccess after creation (also it is in global VM). -+% When running 'SAFER', we'll ignore the contents of errordict, which -+% may have been tampered with by the running job, and always use gserrordict -+% gserrordict also contains any non-standard errors, for better compatibility -+% with Adobe. -+% - % NOTE: the name gserrordict is known to the interpreter. --/gserrordict 5 dict def -+/gserrordict ErrorNames length 3 add dict def - % Register an error in errordict. We make this a procedure because we only - % register the Level 1 errors here: the rest are registered by "feature" - % files. However, ErrorNames contains all of the error names regardless of -@@ -1119,8 +1123,11 @@ errordict begin - } bind def - end % errordict - --% Put non-standard errors in gserrordict. --gserrordict /unknownerror errordict /unknownerror get put -+% Put all the default handlers in gserrordict -+gserrordict -+errordict {2 index 3 1 roll put} forall -+noaccess pop -+% remove the non-standard errors from errordict - errordict /unknownerror .undef - % Define a stable private copy of handleerror that we will always use under - % JOBSERVER mode. -diff --git a/psi/interp.c b/psi/interp.c -index c27b70dca..d41a9d3f5 100644 ---- a/psi/interp.c -+++ b/psi/interp.c -@@ -661,16 +661,28 @@ again: - return code; - if (gs_errorname(i_ctx_p, code, &error_name) < 0) - return code; /* out-of-range error code! */ -- /* -- * For greater Adobe compatibility, only the standard PostScript errors -- * are defined in errordict; the rest are in gserrordict. -+ -+ /* If LockFilePermissions is true, we only refer to gserrordict, which -+ * is not accessible to Postcript jobs - */ -- if (dict_find_string(systemdict, "errordict", &perrordict) <= 0 || -- (dict_find(perrordict, &error_name, &epref) <= 0 && -- (dict_find_string(systemdict, "gserrordict", &perrordict) <= 0 || -- dict_find(perrordict, &error_name, &epref) <= 0)) -- ) -- return code; /* error name not in errordict??? */ -+ if (i_ctx_p->LockFilePermissions) { -+ if (((dict_find_string(systemdict, "gserrordict", &perrordict) <= 0 || -+ dict_find(perrordict, &error_name, &epref) <= 0)) -+ ) -+ return code; /* error name not in errordict??? */ -+ } -+ else { -+ /* -+ * For greater Adobe compatibility, only the standard PostScript errors -+ * are defined in errordict; the rest are in gserrordict. -+ */ -+ if (dict_find_string(systemdict, "errordict", &perrordict) <= 0 || -+ (dict_find(perrordict, &error_name, &epref) <= 0 && -+ (dict_find_string(systemdict, "gserrordict", &perrordict) <= 0 || -+ dict_find(perrordict, &error_name, &epref) <= 0)) -+ ) -+ return code; /* error name not in errordict??? */ -+ } - doref = *epref; - epref = &doref; - /* Push the error object on the operand stack if appropriate. */ --- -2.18.0 - -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:58 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:58 +0000 Received: from localhost ([127.0.0.1]:42459 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdW-0001Nd-7q for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:58 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:41769) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdH-0001LP-IV for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:43 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 8365E21BE2 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:38 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:38 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=zkzjPE251LVJp i6VU470W0PyR9mRi1qFOaiggKKDZRs=; b=Xzht5NeG2pX56OT2kxqPnxvkA3WTu 4pVdIIGmsMR+CbnfpgClhJsnv36uwTgRyXtE2pPHBhW+EsjQJrDjMhoOqyeKOTYi z0IJfLdMp7IqhTbZP+aaUG0FVhUqXOBl6A/iMt7nQKBU99+5deLZyJmrDuDsvkcM u50UATEpvmR0inxbUgql33njTJffKye7tcLtm5Cnb6J9qeUGMRRmDDHeBgTltKp3 AGX7Fgouc47WGWTFYDYI7p1BTeZWGkFQfzM/PHO6wwxXmfMvWNQks+EDLgGWDfz1 a709GdS9uBOFS4810cfO/5t9E95ipXabr5kUhBNUnb3eTDkUiLPxJyX4Q== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=zkzjPE251LVJpi6VU470W0PyR9mRi1qFOaiggKKDZRs=; b=DTVOKnVD 8jM7+lu6QYEhB+L6Fg7fR5c3OKFkAhr6lLtl8ck1sWnLAc9bOO5tDlwYifq++13t RHVvZV2MbyuIaOM0xCpEuU8bIyzpa0DNVw46RWAN8L74wdFUZvrzRqPyBmQsltRH l4I8rBxWQ+MHodfuLYIuePAcbj8XI9+X0HTvxs5GgFnaKFCgdP/sGK6PPo9cclHc kZGYNFdds7sDpCbPf3gebvBUSOhZ0nWN6puiersD+6yoYLO8BPn27rpjfA+tGjgj w7XtPxxNXjZh4LqT5UT66GXizDUCqFgna+SzKruMkGiLmWCTfnQeCrdHBjY0QzT7 iGbnrV0GfF1U4g== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucfkphepiedvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmh gsrghkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpeeh X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id E1E2BE467B for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:37 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 13/23] gnu: icu4c: Update to 63.1. Date: Tue, 11 Dec 2018 02:14:06 +0100 Message-Id: <20181211011416.15902-13-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/icu4c.scm (icu4c): Update to 63.1. --- gnu/packages/icu4c.scm | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/gnu/packages/icu4c.scm b/gnu/packages/icu4c.scm index 2d28107e81..6e93d6aed9 100644 --- a/gnu/packages/icu4c.scm +++ b/gnu/packages/icu4c.scm @@ -32,7 +32,7 @@ (define-public icu4c (package (name "icu4c") - (version "62.1") + (version "63.1") (source (origin (method url-fetch) (uri (string-append @@ -42,7 +42,7 @@ (string-map (lambda (x) (if (char=? x #\.) #\_ x)) version) "-src.tgz")) (sha256 - (base32 "18ssgnwzzpm1g1fvbm9h1fvryiwxvvn5wc3fdakdsl33cs6qdn9x")))) + (base32 "17fbk0lm2clsxbmjzvyp245ayx0n4chji3ky1f3fbz2ljjv91i05")))) (build-system gnu-build-system) (inputs `(("perl" ,perl))) -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:58 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:59 +0000 Received: from localhost ([127.0.0.1]:42461 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdW-0001Nl-Kl for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:58 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:54359) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdJ-0001Lb-4W for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:45 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 195F321C9C for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:40 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:40 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=aa4QS3kFOAsCl fBPfhYUqPmMmbplO28YGcDFsqGiUi4=; b=d2bZWWx0XJmtpDg8DMuP33V411251 pgUGECFxQFsSRoS/K4H/gP1+hjPIIPo7SoYljDCFk4QdGEBlut6gRZE83ChiiV2t s1lSpQWC/tTeQi9+a0QhWYjkorv1jchc68iukG3OBL0jBliw+nkGf7AIbXMiOZv6 aLI88e9+zKemBdLvMOf6fC7xh7V4/YFYNGygd8Ixg/3/PtyertKlPuoqocKfr6Kz cpYe8DB3pEqeCLMKsJAEN5YHD//72zuVU2AV85Tebi/ABb8rOzGxTJpMq66oEaiy lqANdXHBIuJUZC6dM4ifA3fI7XSxNWZwCFJLbxQrtNmyCkku2IDS+pw+w== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=aa4QS3kFOAsClfBPfhYUqPmMmbplO28YGcDFsqGiUi4=; b=IFdhKIc9 lk+vDHCzuD9OgptD3+sss8w0oh+EazA0KGhQFv5hSLFwo2f429Xo7saUMroRcGLO DC+xJDMOAMnygbW56MeQEJLOX9ve0wevCtiSE0eWpLLHool2xqh4VdW8fYW3nXCt FoPG2YA+z91P8d+aPVINpFsXEUogPqXzq6QEIQ1n3BWnxGOVAMFG3l0DXwFNS5an mmobn/4HE0uqA8YM3tACKJJac/5P5JbqKx38qzAjdjsuZHj94+LWhnRNjc6zT3gB iMKU6cLWTd5XoV6eQnxaJsa9AdkCVnneN9D3g+tQ7j6gLzJ9V9bFN+1x73bFILKl 7TTbYXA15ZTxVg== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucffohhmrghinhepihgrnhgrrdhorhhgnecukfhppeeivddrudeirddvvdeirddugedtne curfgrrhgrmhepmhgrihhlfhhrohhmpehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhm necuvehluhhsthgvrhfuihiivgeptd X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 77908E4430 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:39 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 14/23] gnu: tzdata-for-tests: Update to 2018g. Date: Tue, 11 Dec 2018 02:14:07 +0100 Message-Id: <20181211011416.15902-14-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/base.scm (tzdata-for-tests): Inherit TZDATA. --- gnu/packages/base.scm | 18 +----------------- 1 file changed, 1 insertion(+), 17 deletions(-) diff --git a/gnu/packages/base.scm b/gnu/packages/base.scm index 55a0290600..932416a60d 100644 --- a/gnu/packages/base.scm +++ b/gnu/packages/base.scm @@ -1173,23 +1173,7 @@ and daylight-saving rules.") (define-public tzdata-for-tests (hidden-package (package - (inherit tzdata) - (version "2018d") - (source (origin - (method url-fetch) - (uri (string-append "https://www.iana.org/time-zones/repository" - "/releases/tzdata" version ".tar.gz")) - (sha256 - (base32 - "0m6020dnk9r40z7k36jp13fa06xip3hn0fdx3nly66jzxgffs1ji")))) - (inputs `(("tzcode" ,(origin - (method url-fetch) - (uri (string-append - "http://www.iana.org/time-zones/repository/releases/tzcode" - version ".tar.gz")) - (sha256 - (base32 - "1nd882yhsazmcfqmcqyfig3axycryl30gmizgqhqsx5dpa2lxr3x"))))))))) + (inherit tzdata)))) (define-public libiconv (package -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:59 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:59 +0000 Received: from localhost ([127.0.0.1]:42463 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdW-0001Nw-WE for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:59 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:42689) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdK-0001M3-OL for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:46 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id AEE1921C6B for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:41 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:41 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=91htqeHdjaGzD 6s9Tnyh6agDHzDKajkcXtNscxopGZk=; b=Ku19G59ZvkQPJXMPAaQCpWkN+8AUm WhRAcJmyn/pOVECoKo8IIIz6yzNh2JXxD2vjVKNucmPN/rfINF1bvNLqqTYvj1QW IAkCQkjmpzj8yhs40nPGwM+K2GRBM5hEHx26enckHAilG/1F8oFbAP3ekzqUWcBO mJoPmvHIbSGrS4xaFsfydbq5OtH0USlhGJpsF05Y9iEvpvVFJQIuoRE9ioNdPVaH 5M1PspUnVShFxkl522uoHqueGpKqaJnz969aUwz+Ii0GP4eWxFQLo8+zYZ1I/+gV NvrXiVPEDzGOwduQiA0vRsLKwEALpXLtY9AOakzazs5HEHHNdpvo5/1BQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=91htqeHdjaGzD6s9Tnyh6agDHzDKajkcXtNscxopGZk=; b=GQ2fImhX Yhf37ML/2aznjmuCwjsBWTTdYiqNXV+B5xfS6F0FGBhNsslZmoZw211uajrpMC7c 2o0SjjhyLfWpRwIxrAJEI6MTC9cD6LbtF8pU7WdEP8JxRW1C2wPJUSuldowoiy4r QQBVXAFqZ0RFGGWFeziYmgZbd9PaCzsboVyyhooVLgwNMWWacZ8XCwD6W01uj80+ 7AjFnEcPIoDGNFIfdj+VC6lUKjYHO3wxEQ2qjbZuqVz3O4xsYUhR8gAXfMSroMP7 mFA+IRdaNihwclO0Qqw3ybE6IplST4y2QWqUGtBWqdB6ajv7tssqIZ+9fkTFlSxp wZigTWRbiQLuPQ== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucffohhmrghinhepghhnuhdrohhrghenucfkphepiedvrdduiedrvddviedrudegtdenuc frrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrghilhdrtghomhen ucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 10BC1E4430 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:40 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 15/23] gnu: nghttp2: Update to 1.35.1. Date: Tue, 11 Dec 2018 02:14:08 +0100 Message-Id: <20181211011416.15902-15-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/web.scm (nghttp2): Update to 1.35.1. [native-inputs]: Add GCC-7. [arguments]: Add workaround for . --- gnu/packages/web.scm | 9 +++++++-- 1 file changed, 7 insertions(+), 2 deletions(-) diff --git a/gnu/packages/web.scm b/gnu/packages/web.scm index caf56e4119..17deb5c222 100644 --- a/gnu/packages/web.scm +++ b/gnu/packages/web.scm @@ -79,6 +79,7 @@ #:use-module (gnu packages flex) #:use-module (gnu packages freedesktop) #:use-module (gnu packages kerberos) + #:use-module (gnu packages gcc) #:use-module (gnu packages gd) #:use-module (gnu packages gettext) #:use-module (gnu packages glib) @@ -6696,7 +6697,7 @@ derivation by David Revoy from the original MonsterID by Andreas Gohr.") (define-public nghttp2 (package (name "nghttp2") - (version "1.32.0") + (version "1.35.1") (source (origin (method url-fetch) @@ -6705,12 +6706,13 @@ derivation by David Revoy from the original MonsterID by Andreas Gohr.") name "-" version ".tar.xz")) (sha256 (base32 - "0zbgp8f80h2zlfn8cd2ldrmgl81jzcdh1141n71aqmfckzaqj2kh")))) + "0fi6qg2w82636wixwkqy7bclpgxslmvg82r431hs8h6aqc4mnzwv")))) (build-system gnu-build-system) (outputs (list "out" "lib")) ; only libnghttp2 (native-inputs `(("pkg-config" ,pkg-config) + ("gcc" ,gcc-7) ; 1.35.0 requires GCC6 or later ;; Required by tests. ("cunit" ,cunit) @@ -6742,6 +6744,9 @@ derivation by David Revoy from the original MonsterID by Andreas Gohr.") (("@prefix@") (assoc-ref outputs "lib"))) #t)) + (add-before 'configure 'work-around-bug-30756 + (lambda _ + (for-each unsetenv '("C_INCLUDE_PATH" "CPLUS_INCLUDE_PATH")) #t)) (add-before 'check 'set-timezone-directory (lambda* (#:key inputs #:allow-other-keys) (setenv "TZDIR" (string-append (assoc-ref inputs "tzdata") -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:14:59 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:14:59 +0000 Received: from localhost ([127.0.0.1]:42465 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdX-0001Nz-Ab for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:59 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:48493) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdM-0001MB-SW for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:49 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 4051021311 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:43 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:43 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=FJJ8oYW0D6x2G 2hrr5WOPhhurR3gjlcs6QXUKRPuBow=; b=XZMFYQHCx1ZcOutTQBoUwKWGAk9a2 HMcMgPruDJJzswOt2kDBoLD9AuJV3T++LSxFCBUaZlUVd5r6F7W7RsTJ96YEcRY+ oetbM7xrYD6Zd4rkuT4X/hl+UXJt2ufh7PGmUZ0yB5AUDlezAwSRfUf2x3OPBrtq Vqpiev33C1WjnKyA+xGLUzxMUa366zjRE3CB2/MjGchUjkAOihYrwDqRpaHtR1If Odx07sxhpKvOhkgK8Wfhsefl17Ck6QgPXzxionY94TrD6fxzjOJhidOK6YW1ep05 AsZMwocGntZHSEBFIRvzIfT+cTKZTP3xXxRtzPIEnIdLBOyVtanirFJ7Q== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=FJJ8oYW0D6x2G2hrr5WOPhhurR3gjlcs6QXUKRPuBow=; b=jeAL4JFD mEpqjtadwTcZrIrqeIr1gQKhbDNhXVK0XhU3KRcjXy4NIhBhVpwGHB9SVbSAl5bx /4dhbUW1qsRQqSDVF8JZSVTE3NBeFUTL74FMijd4v8/lq78F6EiJg1HNItDcX7ie Ie0f4nkaXdPSwA6A+IizKwfnGxYYi1ZbBHv4EmeC9mVjBI2zY+5XzXfRhPS0x9y4 oH9usRWBsrcKzQxVsXnhyRahlWC9mOgKga6+xioLA4Q0puCagun/2kbJ3d/EhFqH lNgbYSJ9NkQvwclj9NMHRvhYUZtuHHnSQ1VvlIbXAaS5qaGwg74CQx/hxtG9Vk/r y5urmesMJRNimA== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucfkphepiedvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmh gsrghkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpeej X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id A521CE462B for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:42 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 16/23] gnu: nettle: Update to 3.4.1. Date: Tue, 11 Dec 2018 02:14:09 +0100 Message-Id: <20181211011416.15902-16-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/nettle.scm (nettle): Update to 3.4.1. --- gnu/packages/nettle.scm | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/gnu/packages/nettle.scm b/gnu/packages/nettle.scm index 1212f32812..1f91b74d8b 100644 --- a/gnu/packages/nettle.scm +++ b/gnu/packages/nettle.scm @@ -75,14 +75,14 @@ themselves.") ;; This version is not API-compatible with version 2. In particular, lsh ;; cannot use it yet. So keep it separate. (package (inherit nettle-2) - (version "3.4") + (version "3.4.1") (source (origin (method url-fetch) (uri (string-append "mirror://gnu/nettle/nettle-" version ".tar.gz")) (sha256 (base32 - "150y8655h629wn946dvzasq16qxsc1m9nf58mifvhl350bgl4ymf")))) + "1bcji95n1iz9p9vsgdgr26v6s7zhpsxfbjjwpqcihpfd6lawyhgr")))) (arguments (substitute-keyword-arguments (package-arguments nettle-2) ((#:configure-flags flags) -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:15:03 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:15:03 +0000 Received: from localhost ([127.0.0.1]:42467 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdX-0001O7-JB for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:15:03 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:34341) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdN-0001MI-UK for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:50 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id DCC2C21FBF for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:44 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:44 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=PVVc2hcb65zo0 SHY6mmJDfHvjiBjsduqhm+h6qGQhzo=; b=J+PiE6IqKh5Qond20h6A/+mCNdTNQ d5+zHyelzHF0nBeafMYq2pbkf8xsWl+ggvzlfSfJ3gRUqPoaZMs2iFKJimK+1s/G 950YwQ7TOjVnQzLE3rnPzYGKP5uQqRJHCBlAUw48Cz6Rn1P9HgmbW0uI8apcm72S e/QbNfWG0nYVNQ+i6F+XFeJKuKln8VRY4YXykyRhlDodlBIgpVGF/MexVekbybAw pYU0I4+IZpCGudPfHdtpS3UBLR00S/2OiodIh2PxKxSpzaEmi/INeAakT10Go9xa Eeej29tRhfn2RTO6VEFLckEN2fHvJYlI8L4TMDDu5oLW91SMB7VLr5MrQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=PVVc2hcb65zo0SHY6mmJDfHvjiBjsduqhm+h6qGQhzo=; b=x08i9IAc oVLlpK8R/clhK68e+81KulJDNocF//3juo4JOORbx4Tpz0+6+l9nEbEhuVCfDSTF zVZcqXmwT7wMSt/QfbioIlyGeazUbqs56iPtkXy1TBoySp+rmwT+gc7bO/QzOjzf 9Uu7bufFeYCF5gQa17HoKjjKRFa/LwPU9QJokOwzi7EpYWLY/PWPzBA1holpLQ6G hVdW8Ocr0hs0J+EO/qZylK4zB0OS0KiHUWuASBwKB/d5GS5dIG5D6dDK9fZz0jXG 638DnrUTk17y8H42WnQitGUAgp/pSTO0zqrb2LseeNPbIliP8LrNMMqF8j14id7d gFYJjtpKTmUJLw== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucffohhmrghinhepmhhithhrvgdrohhrghdpghhithhhuhgsrdgtohhmpdgthihruhhsih hmrghprdhorhhgnecukfhppeeivddrudeirddvvdeirddugedtnecurfgrrhgrmhepmhgr ihhlfhhrohhmpehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmnecuvehluhhsthgvrh fuihiivgeptd X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 400DEE4430 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:44 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 17/23] gnu: cyrus-sasl: Update to 2.1.27. Date: Tue, 11 Dec 2018 02:14:10 +0100 Message-Id: <20181211011416.15902-17-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: 0.3 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/patches/cyrus-sasl-CVE-2013-4122.patch: Delete file. * gnu/local.mk (dist_patch_DATA): Remove it. * gnu/packages/cyrus-sasl.scm (cyrus-sasl): Update to 2.1.27. [source](patches): Remove. [inputs]: Move MIT-KRB5 from here ... [propagated-inputs]: ... to here. New field. --- gnu/local.mk | 1 - gnu/packages/cyrus-sasl.scm | 9 +- .../patches/cyrus-sasl-CVE-2013-4122.patch | 130 ------------------ 3 files changed, 5 insertions(+), 135 deletions(-) delete mode 100644 gnu/packages/patches/cyrus-sasl-CVE-2013-4122.patch diff --git a/gnu/local.mk b/gnu/local.mk index 45d8effc11..0d279e55eb 100644 --- a/gnu/local.mk +++ b/gnu/local.mk @@ -649,7 +649,6 @@ dist_patch_DATA = \ %D%/packages/patches/cube-nocheck.patch \ %D%/packages/patches/cursynth-wave-rand.patch \ %D%/packages/patches/cvs-2017-12836.patch \ - %D%/packages/patches/cyrus-sasl-CVE-2013-4122.patch \ %D%/packages/patches/datamash-arm-tests.patch \ %D%/packages/patches/dbus-helper-search-path.patch \ %D%/packages/patches/deja-dup-use-ref-keyword-for-iter.patch \ diff --git a/gnu/packages/cyrus-sasl.scm b/gnu/packages/cyrus-sasl.scm index 60c1e0ef94..0a5e464719 100644 --- a/gnu/packages/cyrus-sasl.scm +++ b/gnu/packages/cyrus-sasl.scm @@ -31,7 +31,7 @@ (define-public cyrus-sasl (package (name "cyrus-sasl") - (version "2.1.26") + (version "2.1.27") (source (origin (method url-fetch) (uri (list (string-append @@ -40,13 +40,14 @@ (string-append "ftp://ftp.cyrusimap.org/cyrus-sasl/cyrus-sasl-" version ".tar.gz"))) - (patches (search-patches "cyrus-sasl-CVE-2013-4122.patch")) (sha256 (base32 - "1hvvbcsg21nlncbgs0cgn3iwlnb3vannzwsp6rwvnn9ba4v53g4g")))) + "1m85zcpgfdhm43cavpdkhb1s2zq1b31472hq1w1gs3xh94anp1i6")))) (build-system gnu-build-system) (inputs `(("gdbm" ,gdbm) - ("mit-krb5" ,mit-krb5) ("openssl" ,openssl))) + (propagated-inputs + `(;; cyrus-sasl.pc refers to -lkrb5, so propagate it. + ("mit-krb5" ,mit-krb5))) (arguments '(#:configure-flags (list (string-append "--with-plugindir=" (assoc-ref %outputs "out") diff --git a/gnu/packages/patches/cyrus-sasl-CVE-2013-4122.patch b/gnu/packages/patches/cyrus-sasl-CVE-2013-4122.patch deleted file mode 100644 index fc72e42e03..0000000000 --- a/gnu/packages/patches/cyrus-sasl-CVE-2013-4122.patch +++ /dev/null @@ -1,130 +0,0 @@ -Fix CVE-2013-4122. - -https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2013-4122 - -Patch copied from upstream source repository: -https://github.com/cyrusimap/cyrus-sasl/commit/dedad73e5e7a75d01a5f3d5a6702ab8ccd2ff40d - -From dedad73e5e7a75d01a5f3d5a6702ab8ccd2ff40d Mon Sep 17 00:00:00 2001 -From: mancha -Date: Thu, 11 Jul 2013 10:08:07 +0100 -Subject: Handle NULL returns from glibc 2.17+ crypt() - -Starting with glibc 2.17 (eglibc 2.17), crypt() fails with EINVAL -(w/ NULL return) if the salt violates specifications. Additionally, -on FIPS-140 enabled Linux systems, DES/MD5-encrypted passwords -passed to crypt() fail with EPERM (w/ NULL return). - -When using glibc's crypt(), check return value to avoid a possible -NULL pointer dereference. - -Patch by mancha1@hush.com. ---- - pwcheck/pwcheck_getpwnam.c | 3 ++- - pwcheck/pwcheck_getspnam.c | 4 +++- - saslauthd/auth_getpwent.c | 4 +++- - saslauthd/auth_shadow.c | 8 +++----- - 4 files changed, 11 insertions(+), 8 deletions(-) - -diff --git a/pwcheck/pwcheck_getpwnam.c b/pwcheck/pwcheck_getpwnam.c -index 4b34222..400289c 100644 ---- a/pwcheck/pwcheck_getpwnam.c -+++ b/pwcheck/pwcheck_getpwnam.c -@@ -32,6 +32,7 @@ char *userid; - char *password; - { - char* r; -+ char* crpt_passwd; - struct passwd *pwd; - - pwd = getpwnam(userid); -@@ -41,7 +42,7 @@ char *password; - else if (pwd->pw_passwd[0] == '*') { - r = "Account disabled"; - } -- else if (strcmp(pwd->pw_passwd, crypt(password, pwd->pw_passwd)) != 0) { -+ else if (!(crpt_passwd = crypt(password, pwd->pw_passwd)) || strcmp(pwd->pw_passwd, (const char *)crpt_passwd) != 0) { - r = "Incorrect password"; - } - else { -diff --git a/pwcheck/pwcheck_getspnam.c b/pwcheck/pwcheck_getspnam.c -index 2b11286..6d607bb 100644 ---- a/pwcheck/pwcheck_getspnam.c -+++ b/pwcheck/pwcheck_getspnam.c -@@ -32,13 +32,15 @@ char *userid; - char *password; - { - struct spwd *pwd; -+ char *crpt_passwd; - - pwd = getspnam(userid); - if (!pwd) { - return "Userid not found"; - } - -- if (strcmp(pwd->sp_pwdp, crypt(password, pwd->sp_pwdp)) != 0) { -+ crpt_passwd = crypt(password, pwd->sp_pwdp); -+ if (!crpt_passwd || strcmp(pwd->sp_pwdp, (const char *)crpt_passwd) != 0) { - return "Incorrect password"; - } - else { -diff --git a/saslauthd/auth_getpwent.c b/saslauthd/auth_getpwent.c -index fc8029d..d4ebe54 100644 ---- a/saslauthd/auth_getpwent.c -+++ b/saslauthd/auth_getpwent.c -@@ -77,6 +77,7 @@ auth_getpwent ( - { - /* VARIABLES */ - struct passwd *pw; /* pointer to passwd file entry */ -+ char *crpt_passwd; /* encrypted password */ - int errnum; - /* END VARIABLES */ - -@@ -105,7 +106,8 @@ auth_getpwent ( - } - } - -- if (strcmp(pw->pw_passwd, (const char *)crypt(password, pw->pw_passwd))) { -+ crpt_passwd = crypt(password, pw->pw_passwd); -+ if (!crpt_passwd || strcmp(pw->pw_passwd, (const char *)crpt_passwd)) { - if (flags & VERBOSE) { - syslog(LOG_DEBUG, "DEBUG: auth_getpwent: %s: invalid password", login); - } -diff --git a/saslauthd/auth_shadow.c b/saslauthd/auth_shadow.c -index 677131b..1988afd 100644 ---- a/saslauthd/auth_shadow.c -+++ b/saslauthd/auth_shadow.c -@@ -210,8 +210,8 @@ auth_shadow ( - RETURN("NO Insufficient permission to access NIS authentication database (saslauthd)"); - } - -- cpw = strdup((const char *)crypt(password, sp->sp_pwdp)); -- if (strcmp(sp->sp_pwdp, cpw)) { -+ cpw = crypt(password, sp->sp_pwdp); -+ if (!cpw || strcmp(sp->sp_pwdp, (const char *)cpw)) { - if (flags & VERBOSE) { - /* - * This _should_ reveal the SHADOW_PW_LOCKED prefix to an -@@ -221,10 +221,8 @@ auth_shadow ( - syslog(LOG_DEBUG, "DEBUG: auth_shadow: pw mismatch: '%s' != '%s'", - sp->sp_pwdp, cpw); - } -- free(cpw); - RETURN("NO Incorrect password"); - } -- free(cpw); - - /* - * The following fields will be set to -1 if: -@@ -286,7 +284,7 @@ auth_shadow ( - RETURN("NO Invalid username"); - } - -- if (strcmp(upw->upw_passwd, crypt(password, upw->upw_passwd)) != 0) { -+ if (!(cpw = crypt(password, upw->upw_passwd)) || (strcmp(upw->upw_passwd, (const char *)cpw) != 0)) { - if (flags & VERBOSE) { - syslog(LOG_DEBUG, "auth_shadow: pw mismatch: %s != %s", - password, upw->upw_passwd); --- -cgit v0.12 - -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:15:03 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:15:04 +0000 Received: from localhost ([127.0.0.1]:42475 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdb-0001P9-Cw for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:15:03 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:48493) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdO-0001MB-8G for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:51 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 3CA2421311 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:50 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:50 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=NkL7WDWz7jf/N KJx30KR516F4hIg2Hrt8qY6/hE9gHM=; b=o0I3gpHaS63HBpp7c3HDXPQoK+6z3 FPo8BiNo6hH3jCi2nIaTqMx3KCAAZG4p+HmdjFshfPW/nW/2UXS6pzivm1BiytRE LAU+iLU44U+g0GRw9mn85d7bfQT4SLSyRudYNi4JWL+6cJ1xnboFJcCYPmBjwS+u BlC/2M2ZiqabS00zs7y3JZrp1FwKfACAN+mo2DYn0TVvo7Jl0ddD9Igmdyt73aOw EDHrT/oVkYJUwAJGf1h9bhYCRD4bbvRbIq4mS+RyLgeZ8csEhK6JKwuUIfrCHVx+ CzoYp/j7NpM4k/2GJqmf+I9f/zAEUsR2pg3R/MfSoD7vRo+X75O1ZVrrA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=NkL7WDWz7jf/NKJx30KR516F4hIg2Hrt8qY6/hE9gHM=; b=m6CW5GF6 0vKm+mxtqOafy4ylWdpfluAwBBcbzO1KOL0k14zb88+1dAG9xHoTsCbwi5FUhRGT SdDXr+bHbGGDZd8xz2pBqTEqz2Z8eE0E1jbLMI+O9nQjm4Odi90ZS8uG3ZM4meWP Vhuu8InIb1b3FPeV9UULJnsva7PUu08lWiXmKGPXa6xhRP/dfKNMWBjUiykp+PAJ wMIjcT/L5gZG9/gRxwNLg51q30LLNgohW81TxBaPYzNJLFk4EaOkUAsaKNPZH5co sEpfjmPWJWVxg/9MBp1Mns4Gbp1B0EAA5FvHS3abuQ7duC+QmbOCdOWdCfu2RT2y Xm/Ei5xGK13UeQ== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucffohhmrghinheplhhisghuvhdrohhrghenucfkphepiedvrdduiedrvddviedrudegtd enucfrrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrghilhdrtgho mhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 86346E4430 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:49 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 20/23] gnu: libuv: Update to 1.24.0. Date: Tue, 11 Dec 2018 02:14:13 +0100 Message-Id: <20181211011416.15902-20-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/libevent.scm (libuv): Update to 1.24.0. --- gnu/packages/libevent.scm | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/gnu/packages/libevent.scm b/gnu/packages/libevent.scm index 2de29707ca..c9ed941202 100644 --- a/gnu/packages/libevent.scm +++ b/gnu/packages/libevent.scm @@ -122,14 +122,14 @@ limited support for fork events.") (define-public libuv (package (name "libuv") - (version "1.23.0") + (version "1.24.0") (source (origin (method url-fetch) (uri (string-append "https://dist.libuv.org/dist/v" version "/libuv-v" version ".tar.gz")) (sha256 (base32 - "09yf7c71n8b80nbsv4lsmq5nqmb0rylhpx3z9jgkv5za9lr6sx6i")))) + "01pg0zsfr8mxlpipkbpw0dpsl26x5s966f5br7dx9ac29abk419q")))) (build-system gnu-build-system) (arguments '(;; XXX: Some tests want /dev/tty, attempt to make connections, etc. -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:15:04 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:15:04 +0000 Received: from localhost ([127.0.0.1]:42477 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdb-0001PH-Ss for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:15:04 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:36897) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdP-0001MQ-IA for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:51 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 7AC8C21C9C for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:46 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:46 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=53o8VJek3vH/e nYcyvBmSfCyOSJf220gqYHIBelFtks=; b=AbF2n19H2hCkgc8/URuZGSgsmxbbZ 1MJ3VtwJjYllfsyZ+LCb7+Fc3ydW0G7mw1pZV8JYxnrl1bOz4v/hEDQI70GBrT42 t0dBM5EzcZ9RKwvqPfpgVrp/+//b/U+sVFV1b0LfJK+Okc7gVWphfe0gusZk5G5u SvBmtR1mTnudcSm7I10J2VRQzja4MFU0v6OnGeP5CkjhWSAkx7Qs4a1M7JChA/jz Nm21HOd6dgBE8tCe1Y1uqElFdUWKdU0A4UjeMY1Pla3nyUQpjYAG7DKOvkNd/CvF UfQrp6vKRUf3832YJOkXe4hCuQn2eYDn3qFFc1vMyJQFtFMbsZ7iVnWdg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=53o8VJek3vH/enYcyvBmSfCyOSJf220gqYHIBelFtks=; b=fIbFXlqH 2X/83daRJMCQSZlZ7R5io3ob6CNOMXv+JGl6Yz6xWknBWWVmFh2a1lMTex0m+u5Z sfYRLYFFTzzdNXy8FnZBX+Yujl+GKvX4YFPnpTweoTUz+vOTUXAOTCugNNJmCl9z PuXMFluSK5mi9Zw/D4dnL+AEJuL73xYFGc9ZVUKyYoWCpJHCmMA4smmx3CTFJzvD 8Ksnqh3t3O98FTY9CXpGUhTYu+Sox1KwBkCzmfrgYKtTfzbiT2+843owIujhaM6Z BotIRd1mtC1WiUjWjSmjUqzqH8xyQ4BcAf69l5S1HqeKngyWuwp7n791dm7MYzKg NjEecUHPVejl0A== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucffohhmrghinhepughighhiphdrohhrghenucfkphepiedvrdduiedrvddviedrudegtd enucfrrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrghilhdrtgho mhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id DA059E446A for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:45 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 18/23] gnu: jansson: Update to 2.12. Date: Tue, 11 Dec 2018 02:14:11 +0100 Message-Id: <20181211011416.15902-18-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/web.scm (jansson): Update to 2.12. [source](uri): Use bzip2 compressed tarball. --- gnu/packages/web.scm | 6 +++--- 1 file changed, 3 insertions(+), 3 deletions(-) diff --git a/gnu/packages/web.scm b/gnu/packages/web.scm index 17deb5c222..f8315d4379 100644 --- a/gnu/packages/web.scm +++ b/gnu/packages/web.scm @@ -510,15 +510,15 @@ libraries for working with JNLP applets.") (define-public jansson (package (name "jansson") - (version "2.11") + (version "2.12") (source (origin (method url-fetch) (uri (string-append "http://www.digip.org/jansson/releases/jansson-" - version ".tar.gz")) + version ".tar.bz2")) (sha256 (base32 - "1x5jllzzqamq6kahx9d9a5mrarm9m3f30vfxvcqpi6p4mcnz91bf")))) + "1lp1mv8pjp5yziws66cy0dhpcam4bbjqhffk13v4vgdybp674pb4")))) (build-system gnu-build-system) (home-page "http://www.digip.org/jansson/") (synopsis "JSON C library") -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:15:06 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:15:06 +0000 Received: from localhost ([127.0.0.1]:42479 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdc-0001PV-7S for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:15:04 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:34341) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdP-0001MI-T9 for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:52 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id D049D21F6E for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:51 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:51 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=LEvYsnWrlZeh9 HvwVuOoUETwiKxiv9r17daWicuesIU=; b=XTepM+04/jEzGoYHGuzus9Oi0VFSX ShC0i0AlOkL5hitJZFWUTiqhc2kQ/yyFVEl9/Hq/bAsF6qJEwv9h3NxNvAoPTe3d MmMk8nWrpRF3iAU9NAKJtaGVLpSrWn7vcFCvDuLh4Xo9SpaTOf1qVvRnxeZy3sOA DHqczkQ5Yc8amTGKwv//1rFXqE18Xzxqvp6tOzYPsM7LMyXG4xV6Cxkv/m6Sxmfc hH7gEHw984LuNKwQnqIcswaKf+AAxobX8ty3t3XiEg10GDGMFx7I3kERY58XZpWY pfxWE5x+Ax6g0CZ4QfzWsXp8bXKb04HbfvV2QQNo34s6xZ4z2eNtvtNzA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=LEvYsnWrlZeh9HvwVuOoUETwiKxiv9r17daWicuesIU=; b=ALZHQCbU HEPyYKCbcrW5W7IJ2WFZRSyLbFlKQ0s3mSnpR9rySfyT1p0mEuRZXDCNZLOmEUYg n0lCsN7pMFiVF+4RIc6Wrg1OYFya4gQaKfcVwVr4xMPjpPTlH66SNOT1AyLk6oc/ PkliZfNd9V9MxLk3k9xU93UxQHHMTaR/D51GeaEHruqU4Dh0mt2l9qNeJCTWu3UD /ASQFBYLnnXsxr8IEexM8iHMt9KlgmqBXdNiOPjhL9W/lT9sWbOkbQZzVHKPeFab 8810KQYHUwXjq5J/igsIi5T1Kxi9ufqo7Ktvou0Tupcgz6Z1CSlP5SF66qBBGB2S srpOFUvaBCJOhg== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucffohhmrghinheptghmrghkvgdrohhrghenucfkphepiedvrdduiedrvddviedrudegtd enucfrrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrghilhdrtgho mhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 2A330E446A for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:51 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 21/23] gnu: CMake: Update to 3.13.1. Date: Tue, 11 Dec 2018 02:14:14 +0100 Message-Id: <20181211011416.15902-21-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/cmake.scm (cmake): Update to 3.13.1. --- gnu/packages/cmake.scm | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/gnu/packages/cmake.scm b/gnu/packages/cmake.scm index 5abf087557..7186cf98df 100644 --- a/gnu/packages/cmake.scm +++ b/gnu/packages/cmake.scm @@ -44,7 +44,7 @@ (define-public cmake (package (name "cmake") - (version "3.12.2") + (version "3.13.1") (source (origin (method url-fetch) (uri (string-append "https://www.cmake.org/files/v" @@ -52,7 +52,7 @@ "/cmake-" version ".tar.gz")) (sha256 (base32 - "19410mxgcyvk5q42phaclb1hz6rl08z4yj8iriq706p5k5bli5qg")) + "04123d7fgnn1fs5p0nwyq397ss89r0y4wkg9a09qiwkjsvk1rzmy")) (modules '((guix build utils))) (snippet '(begin -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:15:07 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:15:07 +0000 Received: from localhost ([127.0.0.1]:42482 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWde-0001Pm-H8 for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:15:06 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:47985) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdR-0001Ma-Ha for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:53 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 7CB9E21785 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:48 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:48 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=NlAZhUNOP3+11 zcpfnZOjUyR/TfjYTIbaGqSDz4ONY8=; b=nr+/P1WxOVEiH/WXsNVYoT4JGOtkE oobUnauvgCmgbWqJchrM7v1896m4UNDU+ppW168mY3JHnG2gnWkbrl8IAMVZz/mr GC55Swls9aO1HqnGMj7LLbs/YHYqMXv1sM1oAb1WCT03ScTIXpoiU4VnsAze9mX3 vQSxcYn4MynkHRIa3kodRnlSoD+ydROKqmk7slZApF1tbKuJK5R8PITTO1LMcM7a IO+UK7NLe5JJvdYaK+qljKBe+m5+gaOjezuKUYX15LWVZ56sd+vQDuytnBGx8JbT TTntCt5+daS/lCSuFiABjlJ6QURYwgGfsv+sqSXnk7lM8bb8h3omr0VuQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=NlAZhUNOP3+11zcpfnZOjUyR/TfjYTIbaGqSDz4ONY8=; b=q2B4HEg3 YK+urzLaYh+HJWW495pmy8xGDqjLZtuAbfHDIXZ/og1hvyteezki+zELfebxtiDe hKBTmGzZ0lGlrni46ZJl8X43MEpZF8+Rn5GVR9mw8FgC+AhbsmS1FAEBUfswBugs IrszuDr1fcgB9NcHKZBWNqBp2Pw+5au5a7ur83sVkSfZoObag+TX5s9qdjtPB1QL /eEMnncRzZjso+tcQxvuB86+2it94dLswzIE+csEoX9SekkrSKUf2wZKpgNVwg25 EInP32jtRm0QjnNqpagM4y7X6uNS+JgnBkQRSHOXO6oFmNHomn6D3elB179W9fA1 DEwkfwG/FMs2UA== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucfkphepiedvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmh gsrghkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpeek X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id E461BE462B for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:47 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 19/23] gnu: GnuTLS: Update to 3.6.5. Date: Tue, 11 Dec 2018 02:14:12 +0100 Message-Id: <20181211011416.15902-19-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/patches/gnutls-skip-pkgconfig-test.patch: Delete file. * gnu/local.mk (dist_patch_DATA): Remove it. * gnu/packages/tls.scm (gnutls): Update to 3.6.5. [source](patches): Remove obsolete. [source](snippet): Add Guile detection fix. --- gnu/local.mk | 1 - .../patches/gnutls-skip-pkgconfig-test.patch | 24 ------------------- gnu/packages/tls.scm | 17 +++++++++---- 3 files changed, 12 insertions(+), 30 deletions(-) delete mode 100644 gnu/packages/patches/gnutls-skip-pkgconfig-test.patch diff --git a/gnu/local.mk b/gnu/local.mk index 0d279e55eb..3f2ca7a845 100644 --- a/gnu/local.mk +++ b/gnu/local.mk @@ -772,7 +772,6 @@ dist_patch_DATA = \ %D%/packages/patches/gnucash-price-quotes-perl.patch \ %D%/packages/patches/gnucash-disable-failing-tests.patch \ %D%/packages/patches/gnutls-skip-trust-store-test.patch \ - %D%/packages/patches/gnutls-skip-pkgconfig-test.patch \ %D%/packages/patches/gobject-introspection-absolute-shlib-path.patch \ %D%/packages/patches/gobject-introspection-cc.patch \ %D%/packages/patches/gobject-introspection-girepository.patch \ diff --git a/gnu/packages/patches/gnutls-skip-pkgconfig-test.patch b/gnu/packages/patches/gnutls-skip-pkgconfig-test.patch deleted file mode 100644 index 1fad7c14e3..0000000000 --- a/gnu/packages/patches/gnutls-skip-pkgconfig-test.patch +++ /dev/null @@ -1,24 +0,0 @@ -FIXME: The static test fails with an error such as: - -/tmp/guix-build-gnutls-3.5.13.drv-0/ccOnGPmc.o: In function `main': -c.29617.tmp.c:(.text+0x5): undefined reference to `gnutls_global_init' -collect2: error: ld returned 1 exit status -FAIL pkgconfig.sh (exit status: 1) - -diff --git a/tests/pkgconfig.sh b/tests/pkgconfig.sh -index 6bd4e62f9..05aab8278 100755 ---- a/tests/pkgconfig.sh -+++ b/tests/pkgconfig.sh -@@ -57,11 +57,7 @@ echo "Trying dynamic linking with:" - echo " * flags: $(${PKGCONFIG} --libs gnutls)" - echo " * common: ${COMMON}" - echo " * lib: ${CFLAGS}" --cc ${TMPFILE} -o ${TMPFILE_O} $(${PKGCONFIG} --libs gnutls) $(${PKGCONFIG} --cflags gnutls) ${COMMON} -- --echo "" --echo "Trying static linking with $(${PKGCONFIG} --libs --static gnutls)" --cc ${TMPFILE} -o ${TMPFILE_O} $(${PKGCONFIG} --static --libs gnutls) $(${PKGCONFIG} --cflags gnutls) ${COMMON} -+gcc ${TMPFILE} -o ${TMPFILE_O} $(${PKGCONFIG} --libs gnutls) $(${PKGCONFIG} --cflags gnutls) ${COMMON} - - rm -f ${TMPFILE} ${TMPFILE_O} - diff --git a/gnu/packages/tls.scm b/gnu/packages/tls.scm index d9971441c6..73be90d0d3 100644 --- a/gnu/packages/tls.scm +++ b/gnu/packages/tls.scm @@ -162,7 +162,7 @@ living in the same process.") (define-public gnutls (package (name "gnutls") - (version "3.5.18") + (version "3.6.5") (source (origin (method url-fetch) (uri @@ -171,12 +171,19 @@ living in the same process.") (string-append "mirror://gnupg/gnutls/v" (version-major+minor version) "/gnutls-" version ".tar.xz")) - (patches - (search-patches "gnutls-skip-trust-store-test.patch" - "gnutls-skip-pkgconfig-test.patch")) + (patches (search-patches "gnutls-skip-trust-store-test.patch")) (sha256 (base32 - "0d02x28fwkkx7xzn7807nww6idchizzq3plx8sfcyiw7wzclh8mf")))) + "0ddvg97dyrh8dkffv1mdc0knxx5my3qdbzv97s4a6jggmk9wwgh7")) + (modules '((guix build utils))) + (snippet + '(begin + ;; XXX: The generated configure script in GnuTLS 3.6.5 + ;; apparently does not know about Guile 2.2. + (substitute* "configure" + (("guile_versions_to_search=\"2\\.0 1\\.8\"") + "guile_versions_to_search=\"2.2 2.0 1.8\"")) + #t)))) (build-system gnu-build-system) (arguments `(; Ensure we don't keep a reference to this buggy software. -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:15:07 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:15:07 +0000 Received: from localhost ([127.0.0.1]:42485 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWde-0001Px-W7 for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:15:07 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:36897) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdR-0001MQ-L9 for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:14:53 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 9E3BD21BE2 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:53 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:53 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=DfYi7rlyp6eKS 00wY9TqBsz4gFyGSuHiXuU25qcRdzQ=; b=qMG2VVI6HEBhUktZ6JnXHrMMlceKw jcwTB2Xdz+j/7ZiIURJOlm7ij6pxzQUZ6uZ4Sub+bRf734BOj5HMhiQB0lnvLFPd gjoBKQR+60U8UzXwVaohKIFpJZvZyS1orjmLq+mQsiIahOqbUJGSckKHl2Vb9f95 pEuGVKxdxaGq0YyT8yfwKH3tSYTByz5352j+L1czjJc7rWQZjVRDsflQEWn7vVt2 JJ/u3T9KhEwEfdv/ts22zckksQe9JoPz+xXZyl8wS2LabjHt3ijK0bgpBd/3WCPb u1xKfyH4VQRGAHGYS0NaFetwcvt6AM1FLld6hmbW01gSV+DFgxmjgD3Wg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=DfYi7rlyp6eKS00wY9TqBsz4gFyGSuHiXuU25qcRdzQ=; b=WnWIVGL4 6o2pz0yQW+JZwq9h6nAP6rDoXHk8OlyHY7CdppC+zxmPEgIOyQN7sbEwuqA54sLd rMUrF+oX6n29emh+MhGl8uPs5nKV9T0PtCN5heAwU2GOUhaHOl9UPGb+eoSSGqiw uf8ROlO7gOY9HivVM2GuA4mwRsWF5DheD5TPOkS+Tx2uCzqNQiuxNi2q235VCSJi RC9uw8gll7EVqIt1ly4EiBKVp/YPK4+QTgsoeW5SPhwO7vgDU+APRUpTsbeqlT/d AJ6FBtErz4lEJtLeAeGNVTzLpjEPIh7lWmR52SFpFXTznWzsu/Q+zioFqGW8d1r3 nVH6kTtdB8Jr3w== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucffohhmrghinhepghhithhhuhgsrdgtohhmnecukfhppeeivddrudeirddvvdeirdduge dtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehmsggrkhhkvgesfhgrshhtmhgrihhlrdgt ohhmnecuvehluhhsthgvrhfuihiivgeptd X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id C5D1DE450E for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:52 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 22/23] gnu: meson: Update to 0.49.0. Date: Tue, 11 Dec 2018 02:14:15 +0100 Message-Id: <20181211011416.15902-22-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/build-tools.scm (meson): Update to 0.49.0. --- gnu/packages/build-tools.scm | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/gnu/packages/build-tools.scm b/gnu/packages/build-tools.scm index d42d03cee9..628b36fff5 100644 --- a/gnu/packages/build-tools.scm +++ b/gnu/packages/build-tools.scm @@ -158,7 +158,7 @@ files and generates build instructions for the Ninja build system.") (define-public meson (package (name "meson") - (version "0.48.2") + (version "0.49.0") (source (origin (method url-fetch) (uri (string-append "https://github.com/mesonbuild/meson/" @@ -166,7 +166,7 @@ files and generates build instructions for the Ninja build system.") version ".tar.gz")) (sha256 (base32 - "01jmm2wmnqhqk6f2gfhzhyzh0il6bjbyl8syy457p76ws2zxisir")))) + "0l8m1v7cl5ybm7psfqmmdqbvmnsbb1qhb8ni3hwap3i0mk29a0zv")))) (build-system python-build-system) (arguments `(;; FIXME: Tests require many additional inputs, a fix for the RUNPATH -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 20:15:08 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 01:15:08 +0000 Received: from localhost ([127.0.0.1]:42488 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdf-0001QA-9j for submit@debbugs.gnu.org; Mon, 10 Dec 2018 20:15:08 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:40321) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWWdY-0001NW-4d for 33701@debbugs.gnu.org; Mon, 10 Dec 2018 20:15:00 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 1911521F73 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:55 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Mon, 10 Dec 2018 20:14:55 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:date:message-id:in-reply-to:references :mime-version:content-transfer-encoding; s=fm1; bh=1tiwdAlv0b/zV k8kzU1c3BkTLC5FM6siWB8lSV0mLr4=; b=Srkh4VjjKMCz25oC9HSmgxnYNX4Jl 5Jf3o9htmLziG447vWHqa67MlfbNkUqL4vtE21C8GLNUfs41rIaTwar51NOJv0FV ruJ58dGVqn3XvdoriwHJmqaDl0INbNOlvpUiiKeNIkJqdbXtSl1gOw6qKjSjVmM6 uESau4Y4Vkon06Cl7NG0rgFcU3RtcATNlGNbkAX6iBrnCX0b2gPYzOAqXjDLa08O iLl68TqRw+qIiOTqmRMWZio30FzrFQPEctieSMbKpU2g8lP6S/aeUnWo8akLj5KS or8RgtjqBgBgtD2kNbGISoaXwAO+KuhS7G25TqP6CwbZCbcaKRyB/lTbA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:date:from :in-reply-to:message-id:mime-version:references:subject:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=1tiwdAlv0b/zVk8kzU1c3BkTLC5FM6siWB8lSV0mLr4=; b=JDCU1JLp GbmNjY5Pqig77bDLVJlO/4q87Ruc3X6B8emIJz3vRROqH68MpvBeYl2Hai50irIg qHu5lCNvlm1QRd/SMdABmpbgz6kgxNuuSW6f1qu5eQBPaUQul1l+UvJG+Sq5FCLQ XYuV22YC3gACEVc6YYvESdb2+S6R3/FcrFhq31FG5uGvLD7XG6QdqWBhrlfToGtv bEJp36Hjrxr6dCxVyovxp8Qgj3qqpdBRUbtTGRdBbAbS8zp9n0OIcqUhO0W9WZuu S91vgZ/AZsIWwCnwDKSFAUM9e/ZZ273dtejAVUDQskZfVHc5qgtan8bR61Zz3Se4 2U2Iegp3ens0hw== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegiedgfeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucffohhmrghinhepghhnohhmvgdrohhrghenucfkphepiedvrdduiedrvddviedrudegtd enucfrrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrghilhdrtgho mhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 73F6AE4893 for <33701@debbugs.gnu.org>; Mon, 10 Dec 2018 20:14:54 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: [PATCH staging 23/23] gnu: glib-networking: Update to 2.59.1. Date: Tue, 11 Dec 2018 02:14:16 +0100 Message-Id: <20181211011416.15902-23-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.0 In-Reply-To: <20181211011416.15902-1-mbakke@fastmail.com> References: <20181211011416.15902-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) * gnu/packages/gnome.scm (glib-networking): Update to 2.59.1. [build-system]: Change to MESON-BUILD-SYSTEM. [arguments]: Remove. (libsoup)[arguments]: Remove obsolete 'pre-check' code. --- gnu/local.mk | 1 - gnu/packages/gnome.scm | 73 +------------------ .../glib-networking-ssl-cert-file.patch | 29 -------- 3 files changed, 3 insertions(+), 100 deletions(-) delete mode 100644 gnu/packages/patches/glib-networking-ssl-cert-file.patch diff --git a/gnu/local.mk b/gnu/local.mk index 3f2ca7a845..03627b98c1 100644 --- a/gnu/local.mk +++ b/gnu/local.mk @@ -741,7 +741,6 @@ dist_patch_DATA = \ %D%/packages/patches/ghostscript-no-header-uuid.patch \ %D%/packages/patches/ghostscript-no-header-creationdate.patch \ %D%/packages/patches/giflib-make-reallocarray-private.patch \ - %D%/packages/patches/glib-networking-ssl-cert-file.patch \ %D%/packages/patches/glib-tests-timer.patch \ %D%/packages/patches/glibc-CVE-2015-5180.patch \ %D%/packages/patches/glibc-CVE-2015-7547.patch \ diff --git a/gnu/packages/gnome.scm b/gnu/packages/gnome.scm index 9d8e4a8d33..059eb46cdc 100644 --- a/gnu/packages/gnome.scm +++ b/gnu/packages/gnome.scm @@ -2396,7 +2396,7 @@ library.") (define-public glib-networking (package (name "glib-networking") - (version "2.54.1") + (version "2.59.1") (source (origin (method url-fetch) (uri (string-append "mirror://gnome/sources/glib-networking/" @@ -2404,29 +2404,8 @@ library.") name "-" version ".tar.xz")) (sha256 (base32 - "0bq16m9nh3gcz9x2fvygr0iwxd2pxcbrm3lj3kihsnh1afv8g9za")) - (patches - (search-patches "glib-networking-ssl-cert-file.patch")))) - (build-system gnu-build-system) - (arguments - `(#:configure-flags - '("--with-ca-certificates=/etc/ssl/certs/ca-certificates.crt") - #:phases - (modify-phases %standard-phases - (add-before 'configure 'patch-giomoduledir - ;; Install GIO modules into $out/lib/gio/modules. - (lambda _ - (substitute* "configure" - (("GIO_MODULE_DIR=.*") - (string-append "GIO_MODULE_DIR=" %output - "/lib/gio/modules\n"))) - #t)) - (add-before 'check 'use-empty-ssl-cert-file - (lambda _ - ;; The ca-certificates.crt is not available in the build - ;; environment. - (setenv "SSL_CERT_FILE" "/dev/null") - #t))))) + "09nf78wzjfvbd722smn4wq4c7njyswg3kvgvim2h635b5dl94jqd")))) + (build-system meson-build-system) (native-inputs `(("pkg-config" ,pkg-config) ("intltool" ,intltool))) @@ -2516,55 +2495,9 @@ libxml to ease remote use of the RESTful API.") ;; The 'check-local' target runs 'env LANG=C sort -u', ;; unset 'LC_ALL' to make 'LANG' working. (unsetenv "LC_ALL") - ;; The ca-certificates.crt is not available in the build - ;; environment. - (setenv "SSL_CERT_FILE" "/dev/null") ;; HTTPD in Guix uses mod_event and does not build prefork. (substitute* "tests/httpd.conf" (("^LoadModule mpm_prefork_module.*$") "\n")) - - ;; Generate a self-signed certificate that has "localhost" as its - ;; 'dnsName'. Failing to do that, and starting with GnuTLS - ;; 3.5.12, tests such as "ssl-tests" fail: - ;; - ;; ERROR:ssl-test.c:406:do_tls_interaction_test: Unexpected status 6 Unacceptable TLS certificate (expected 200 OK) - ;; - ;; 'certtool' is interactive so we have to pipe it the answers. - ;; Reported at . - (let ((pipe (open-output-pipe "certtool --generate-self-signed \ - --load-privkey tests/test-key.pem --outfile tests/test-cert.pem"))) - (for-each (lambda (line) - (display line pipe) - (newline pipe)) - '("" ;Common name - "" ;UID - "Guix" ;Organizational unit name - "GNU" ;Organization name - "" ;Locality name - "" ;State or province - "" ;Country - "" ;subject's domain component (DC) - "" ;E-mail - "" ;serial number - "-1" ;expiration time - "N" ;belong to authority? - "N" ;web client certificate? - "N" ;IPsec IKE? - "Y" ;web server certificate? - "localhost" ;dnsName of subject - "" ;dnsName of subject (end) - "" ;URI of subject - "127.0.0.1" ;IP address of subject - "" ;signing? - "" ;encryption? - "" ;sign OCSP requests? - "" ;sign code? - "" ;time stamping? - "" ;email protection? - "" ;URI of the CRL distribution point - "y" ;above info OK? - )) - (close-pipe pipe)) #t)) (replace 'install (lambda _ diff --git a/gnu/packages/patches/glib-networking-ssl-cert-file.patch b/gnu/packages/patches/glib-networking-ssl-cert-file.patch deleted file mode 100644 index 32bdd0790f..0000000000 --- a/gnu/packages/patches/glib-networking-ssl-cert-file.patch +++ /dev/null @@ -1,29 +0,0 @@ -From b010e41346d418220582c20ab8d7f3971e4fb78a Mon Sep 17 00:00:00 2001 -From: =?UTF-8?q?=E5=AE=8B=E6=96=87=E6=AD=A6?= -Date: Fri, 14 Aug 2015 17:28:36 +0800 -Subject: [PATCH] gnutls: Allow overriding the anchor file location by - 'SSL_CERT_FILE' - ---- - tls/gnutls/gtlsbackend-gnutls.c | 4 +++- - 1 file changed, 3 insertions(+), 1 deletion(-) - -diff --git a/tls/gnutls/gtlsbackend-gnutls.c b/tls/gnutls/gtlsbackend-gnutls.c -index 55ec1a5..217d3c8 100644 ---- a/tls/gnutls/gtlsbackend-gnutls.c -+++ b/tls/gnutls/gtlsbackend-gnutls.c -@@ -101,8 +101,10 @@ g_tls_backend_gnutls_real_create_database (GTlsBackendGnutls *self, - GError **error) - { - const gchar *anchor_file = NULL; -+ anchor_file = g_getenv ("SSL_CERT_FILE"); - #ifdef GTLS_SYSTEM_CA_FILE -- anchor_file = GTLS_SYSTEM_CA_FILE; -+ if (!anchor_file) -+ anchor_file = GTLS_SYSTEM_CA_FILE; - #endif - return g_tls_file_database_new (anchor_file, error); - } --- -2.4.3 - -- 2.20.0 From debbugs-submit-bounces@debbugs.gnu.org Tue Dec 11 15:42:25 2018 Received: (at 33701) by debbugs.gnu.org; 11 Dec 2018 20:42:25 +0000 Received: from localhost ([127.0.0.1]:44233 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWorG-0007iF-0H for submit@debbugs.gnu.org; Tue, 11 Dec 2018 15:42:25 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:48651) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWorB-0007hv-2x for 33701@debbugs.gnu.org; Tue, 11 Dec 2018 15:42:18 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id B76352211C for <33701@debbugs.gnu.org>; Tue, 11 Dec 2018 15:42:11 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Tue, 11 Dec 2018 15:42:11 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm1; bh=5szTJRSQN8EP90yvNCFXDLB156 Tfn/CTYIOyT+PCDnE=; b=ofavtdt9+HKTaFUBqK5jMBzdwmxnhJEZGBGOMU4ZhD 7NrC5WMoSr+cD+5VU/32h2O9uLkcb/0TFCIpGMN8wCjMlqqmYLNlWWn65I5Cpg8n BlBzYSW/t7LGgepCA7UwWKjHTraFcS1ddI6u8PMd5/YNSdVZajaLSFcGLHJIB90w h/DrGc+R/EGgGfquDaM7NXjh3KQhZ8i9AEYdS6zbZJ0C/zQvFzMLWa+cN2ClWAhp 53x+qqSUsbM1aZKopj7GuE0o1HFn6klu4/LB2eYMwRNEhv+1lnOd6h/jS3ytaiyq oX5BnReUrn3P0xW1VtlnDFPKPUUVcOMba8J7fk/Dk7zg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; bh=5szTJR SQN8EP90yvNCFXDLB156Tfn/CTYIOyT+PCDnE=; b=PVsP/ENnGwcvJK7wiw1gWO clw5H2Q0bnVwuH5jj1JfAKPqptEq2FGVJ00g0ybzxjhlCUeHCHSXsGPE0gKuT9Px CVCuoNhtPIlbBh1lUrJ7uGnQtkmP2xSammQHa3wBsMFYX3pHBzHBEHfJaSjLkmXI QR15WA1R82JqLwFtAsOPGfAvtPtV4IEteOx7Q1x/1KX3uXv9AFmp595GjN/Y2M37 9lRk2BmW6cWRIIFmsinzTaScGZsDrVf2Z5WhTeZezqMmvp6jg5UGIPXA5en+cO46 AkSbyPlwDbrx03ruCl0s4LWKRWl1AFMjdpYJuuG85jUuQFMYUBFYdtNz60fn8Hig == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegjedgudegtdcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpqfhuthenuceurghilhhouhhtmecu fedttdenucenucfjughrpefhvffujghffgffkfggtgesghdtreertdertdenucfhrhhomh epofgrrhhiuhhsuceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheq necukfhppeeivddrudeirddvvdeirddugedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpe hmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmnecuvehluhhsthgvrhfuihiivgeptd X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id DA7B7E4122 for <33701@debbugs.gnu.org>; Tue, 11 Dec 2018 15:42:10 -0500 (EST) From: Marius Bakke To: 33701@debbugs.gnu.org Subject: Re: [bug#33701] [PATCH staging 00/23] Glib/GTK+ updates In-Reply-To: <20181211011205.15542-1-mbakke@fastmail.com> References: <20181211011205.15542-1-mbakke@fastmail.com> User-Agent: Notmuch/0.28 (https://notmuchmail.org) Emacs/26.1 (x86_64-pc-linux-gnu) Date: Tue, 11 Dec 2018 21:42:09 +0100 Message-ID: <87k1kfssm6.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain Marius Bakke writes: > This late series adds around 1000 rebuilds to the current staging > branch. They also bring many of the GNOME family libraries to the > latest upstream versions. > > The good: > * Latest Ghostscript, Poppler, Harfbuzz, GnuTLS, and other > security-critical libraries. Some of these have changed > build systems, or ABIs, so future patching is easier. > * Most/all regressions are already fixed. Whoops, I spoke too soon: I upgraded glib-networking from 2.58 to 2.59 in the last minute (to fix a test failure), but the change broke libsoup and possibly more. In v2 of this series, two patches have diverged. Libsoup was adjusted to cope with the new "certtool" API from GnuTLS 3.6: --=-=-= Content-Type: text/x-patch Content-Disposition: inline; filename=0019-gnu-GnuTLS-Update-to-3.6.5.patch Content-Transfer-Encoding: quoted-printable From=20cab3a4a7fe3e719f2991384c161043bbfae742d6 Mon Sep 17 00:00:00 2001 From: Marius Bakke Date: Mon, 10 Dec 2018 02:38:32 +0100 Subject: [PATCH staging 19/23] gnu: GnuTLS: Update to 3.6.5. * gnu/packages/patches/gnutls-skip-pkgconfig-test.patch: Delete file. * gnu/local.mk (dist_patch_DATA): Remove it. * gnu/packages/tls.scm (gnutls): Update to 3.6.5. [source](patches): Remove obsolete. [source](snippet): Add Guile detection fix. * gnu/packages/gnome.scm (libsoup)[arguments]: Adjust 'certtool' invokation= to cope with the new API. =2D-- gnu/local.mk | 1 - gnu/packages/gnome.scm | 3 ++- .../patches/gnutls-skip-pkgconfig-test.patch | 24 ------------------- gnu/packages/tls.scm | 17 +++++++++---- 4 files changed, 14 insertions(+), 31 deletions(-) delete mode 100644 gnu/packages/patches/gnutls-skip-pkgconfig-test.patch diff --git a/gnu/local.mk b/gnu/local.mk index 0d279e55eb..3f2ca7a845 100644 =2D-- a/gnu/local.mk +++ b/gnu/local.mk @@ -772,7 +772,6 @@ dist_patch_DATA =3D \ %D%/packages/patches/gnucash-price-quotes-perl.patch \ %D%/packages/patches/gnucash-disable-failing-tests.patch \ %D%/packages/patches/gnutls-skip-trust-store-test.patch \ =2D %D%/packages/patches/gnutls-skip-pkgconfig-test.patch \ %D%/packages/patches/gobject-introspection-absolute-shlib-path.patch \ %D%/packages/patches/gobject-introspection-cc.patch \ %D%/packages/patches/gobject-introspection-girepository.patch \ diff --git a/gnu/packages/gnome.scm b/gnu/packages/gnome.scm index 9d8e4a8d33..cea9445191 100644 =2D-- a/gnu/packages/gnome.scm +++ b/gnu/packages/gnome.scm @@ -2556,7 +2556,8 @@ libxml to ease remote use of the RESTful API.") "" ;URI of subject "127.0.0.1" ;IP address of subject "" ;signing? =2D "" ;encryption? + "" ;encryption (RSA)? + "" ;data encryption? "" ;sign OCSP requests? "" ;sign code? "" ;time stamping? diff --git a/gnu/packages/patches/gnutls-skip-pkgconfig-test.patch b/gnu/pa= ckages/patches/gnutls-skip-pkgconfig-test.patch deleted file mode 100644 index 1fad7c14e3..0000000000 =2D-- a/gnu/packages/patches/gnutls-skip-pkgconfig-test.patch +++ /dev/null @@ -1,24 +0,0 @@ =2DFIXME: The static test fails with an error such as: =2D =2D/tmp/guix-build-gnutls-3.5.13.drv-0/ccOnGPmc.o: In function `main': =2Dc.29617.tmp.c:(.text+0x5): undefined reference to `gnutls_global_init' =2Dcollect2: error: ld returned 1 exit status =2DFAIL pkgconfig.sh (exit status: 1) =2D =2Ddiff --git a/tests/pkgconfig.sh b/tests/pkgconfig.sh =2Dindex 6bd4e62f9..05aab8278 100755 =2D--- a/tests/pkgconfig.sh =2D+++ b/tests/pkgconfig.sh =2D@@ -57,11 +57,7 @@ echo "Trying dynamic linking with:" =2D echo " * flags: $(${PKGCONFIG} --libs gnutls)" =2D echo " * common: ${COMMON}" =2D echo " * lib: ${CFLAGS}" =2D-cc ${TMPFILE} -o ${TMPFILE_O} $(${PKGCONFIG} --libs gnutls) $(${PKGCONF= IG} --cflags gnutls) ${COMMON} =2D- =2D-echo "" =2D-echo "Trying static linking with $(${PKGCONFIG} --libs --static gnutls)" =2D-cc ${TMPFILE} -o ${TMPFILE_O} $(${PKGCONFIG} --static --libs gnutls) $(= ${PKGCONFIG} --cflags gnutls) ${COMMON} =2D+gcc ${TMPFILE} -o ${TMPFILE_O} $(${PKGCONFIG} --libs gnutls) $(${PKGCON= FIG} --cflags gnutls) ${COMMON} =2D=20 =2D rm -f ${TMPFILE} ${TMPFILE_O} =2D=20 diff --git a/gnu/packages/tls.scm b/gnu/packages/tls.scm index d9971441c6..73be90d0d3 100644 =2D-- a/gnu/packages/tls.scm +++ b/gnu/packages/tls.scm @@ -162,7 +162,7 @@ living in the same process.") (define-public gnutls (package (name "gnutls") =2D (version "3.5.18") + (version "3.6.5") (source (origin (method url-fetch) (uri @@ -171,12 +171,19 @@ living in the same process.") (string-append "mirror://gnupg/gnutls/v" (version-major+minor version) "/gnutls-" version ".tar.xz")) =2D (patches =2D (search-patches "gnutls-skip-trust-store-test.patch" =2D "gnutls-skip-pkgconfig-test.patch")) + (patches (search-patches "gnutls-skip-trust-store-test.patch"= )) (sha256 (base32 =2D "0d02x28fwkkx7xzn7807nww6idchizzq3plx8sfcyiw7wzclh8mf")))) + "0ddvg97dyrh8dkffv1mdc0knxx5my3qdbzv97s4a6jggmk9wwgh7")) + (modules '((guix build utils))) + (snippet + '(begin + ;; XXX: The generated configure script in GnuTLS 3.6.5 + ;; apparently does not know about Guile 2.2. + (substitute* "configure" + (("guile_versions_to_search=3D\"2\\.0 1\\.8\"") + "guile_versions_to_search=3D\"2.2 2.0 1.8\"")) + #t)))) (build-system gnu-build-system) (arguments `(; Ensure we don't keep a reference to this buggy software. =2D-=20 2.20.0 --=-=-= Content-Type: text/plain ...while Glib-Networking was downgraded to 2.58, and removes related code at the same time: --=-=-= Content-Type: text/x-patch Content-Disposition: inline; filename=0023-gnu-glib-networking-Update-to-2.58.0.patch Content-Transfer-Encoding: quoted-printable From=20ade89abc16f2247e6d5db633f001ff853fa989ba Mon Sep 17 00:00:00 2001 From: Marius Bakke Date: Mon, 10 Dec 2018 07:39:52 +0100 Subject: [PATCH staging 23/23] gnu: glib-networking: Update to 2.58.0. * gnu/packages/gnome.scm (glib-networking): Update to 2.58.0. [build-system]: Change to MESON-BUILD-SYSTEM. [arguments]: Explicitly disable libproxy; add phase to appease tests. (libgdata, libsoup)[arguments]: Remove phase that sets SSL_CERT_FILE. * gnu/packages/spice.scm (spice)[arguments]: Likewise. * gnu/packages/web.scm (uhttpmock)[arguments]: Likewise. =2D-- gnu/local.mk | 1 - gnu/packages/gnome.scm | 43 +++++-------------- .../glib-networking-ssl-cert-file.patch | 29 ------------- gnu/packages/spice.scm | 6 +-- gnu/packages/web.scm | 9 ---- 5 files changed, 12 insertions(+), 76 deletions(-) delete mode 100644 gnu/packages/patches/glib-networking-ssl-cert-file.patch diff --git a/gnu/local.mk b/gnu/local.mk index 3f2ca7a845..03627b98c1 100644 =2D-- a/gnu/local.mk +++ b/gnu/local.mk @@ -741,7 +741,6 @@ dist_patch_DATA =3D \ %D%/packages/patches/ghostscript-no-header-uuid.patch \ %D%/packages/patches/ghostscript-no-header-creationdate.patch \ %D%/packages/patches/giflib-make-reallocarray-private.patch \ =2D %D%/packages/patches/glib-networking-ssl-cert-file.patch \ %D%/packages/patches/glib-tests-timer.patch \ %D%/packages/patches/glibc-CVE-2015-5180.patch \ %D%/packages/patches/glibc-CVE-2015-7547.patch \ diff --git a/gnu/packages/gnome.scm b/gnu/packages/gnome.scm index cea9445191..95bfcaf564 100644 =2D-- a/gnu/packages/gnome.scm +++ b/gnu/packages/gnome.scm @@ -360,12 +360,6 @@ formats like PNG, SVG, PDF and EPS.") (arguments '(#:phases (modify-phases %standard-phases =2D (add-before 'check 'use-empty-ssl-cert-file =2D (lambda _ =2D ;; The ca-certificates.crt is not available in the build =2D ;; environment. =2D (setenv "SSL_CERT_FILE" "/dev/null") =2D #t)) (add-before 'check 'disable-failing-tests (lambda _ ;; The PicasaWeb API tests fail with gnome-online-accounts@3.= 24.2. @@ -2396,7 +2390,7 @@ library.") (define-public glib-networking (package (name "glib-networking") =2D (version "2.54.1") + (version "2.58.0") (source (origin (method url-fetch) (uri (string-append "mirror://gnome/sources/glib-networking/" @@ -2404,29 +2398,17 @@ library.") name "-" version ".tar.xz")) (sha256 (base32 =2D "0bq16m9nh3gcz9x2fvygr0iwxd2pxcbrm3lj3kihsnh1afv8g9za")) =2D (patches =2D (search-patches "glib-networking-ssl-cert-file.patch")))) =2D (build-system gnu-build-system) + "0s006gs9nsq6mg31spqha1jffzmp6qjh10y27h0fxf1iw1ah5ymx")))) + (build-system meson-build-system) (arguments =2D `(#:configure-flags =2D '("--with-ca-certificates=3D/etc/ssl/certs/ca-certificates.crt") =2D #:phases =2D (modify-phases %standard-phases =2D (add-before 'configure 'patch-giomoduledir =2D ;; Install GIO modules into $out/lib/gio/modules. =2D (lambda _ =2D (substitute* "configure" =2D (("GIO_MODULE_DIR=3D.*") =2D (string-append "GIO_MODULE_DIR=3D" %output =2D "/lib/gio/modules\n"))) =2D #t)) =2D (add-before 'check 'use-empty-ssl-cert-file =2D (lambda _ =2D ;; The ca-certificates.crt is not available in the build =2D ;; environment. =2D (setenv "SSL_CERT_FILE" "/dev/null") =2D #t))))) + `(#:configure-flags '("-Dlibproxy_support=3Dfalse") + #:phases (modify-phases %standard-phases + (add-before 'check 'disable-TLSv1.3 + (lambda _ + ;; XXX: One test fails when TLS 1.3 is enabled, fixe= d in 2.60.0: + ;; . + (setenv "G_TLS_GNUTLS_PRIORITY" "NORMAL:-VERS-TLS1.3= ") + #t))))) (native-inputs `(("pkg-config" ,pkg-config) ("intltool" ,intltool))) @@ -2516,9 +2498,6 @@ libxml to ease remote use of the RESTful API.") ;; The 'check-local' target runs 'env LANG=3DC sort -u', ;; unset 'LC_ALL' to make 'LANG' working. (unsetenv "LC_ALL") =2D ;; The ca-certificates.crt is not available in the build =2D ;; environment. =2D (setenv "SSL_CERT_FILE" "/dev/null") ;; HTTPD in Guix uses mod_event and does not build prefork. (substitute* "tests/httpd.conf" (("^LoadModule mpm_prefork_module.*$") "\n")) diff --git a/gnu/packages/patches/glib-networking-ssl-cert-file.patch b/gnu= /packages/patches/glib-networking-ssl-cert-file.patch deleted file mode 100644 index 32bdd0790f..0000000000 =2D-- a/gnu/packages/patches/glib-networking-ssl-cert-file.patch +++ /dev/null @@ -1,29 +0,0 @@ =2DFrom b010e41346d418220582c20ab8d7f3971e4fb78a Mon Sep 17 00:00:00 2001 =2DFrom: =3D?UTF-8?q?=3DE5=3DAE=3D8B=3DE6=3D96=3D87=3DE6=3DAD=3DA6?=3D =2DDate: Fri, 14 Aug 2015 17:28:36 +0800 =2DSubject: [PATCH] gnutls: Allow overriding the anchor file location by =2D 'SSL_CERT_FILE' =2D =2D--- =2D tls/gnutls/gtlsbackend-gnutls.c | 4 +++- =2D 1 file changed, 3 insertions(+), 1 deletion(-) =2D =2Ddiff --git a/tls/gnutls/gtlsbackend-gnutls.c b/tls/gnutls/gtlsbackend-gn= utls.c =2Dindex 55ec1a5..217d3c8 100644 =2D--- a/tls/gnutls/gtlsbackend-gnutls.c =2D+++ b/tls/gnutls/gtlsbackend-gnutls.c =2D@@ -101,8 +101,10 @@ g_tls_backend_gnutls_real_create_database (GTlsBack= endGnutls *self, =2D GError **error) =2D { =2D const gchar *anchor_file =3D NULL; =2D+ anchor_file =3D g_getenv ("SSL_CERT_FILE"); =2D #ifdef GTLS_SYSTEM_CA_FILE =2D- anchor_file =3D GTLS_SYSTEM_CA_FILE; =2D+ if (!anchor_file) =2D+ anchor_file =3D GTLS_SYSTEM_CA_FILE; =2D #endif =2D return g_tls_file_database_new (anchor_file, error); =2D } =2D--=20 =2D2.4.3 =2D diff --git a/gnu/packages/spice.scm b/gnu/packages/spice.scm index 94e6aa8438..8ab5a335c8 100644 =2D-- a/gnu/packages/spice.scm +++ b/gnu/packages/spice.scm @@ -213,11 +213,7 @@ which allows users to view a desktop computing environ= ment.") "--enable-automated-tests") =20 ;; Several tests appear to be opening the same sockets concurrentl= y. =2D #:parallel-tests? #f =2D =2D #:phases (modify-phases %standard-phases =2D (add-before 'check 'use-empty-ssl-cert-file =2D (lambda _ (setenv "SSL_CERT_FILE" "/dev/null") #t))= ))) + #:parallel-tests? #f)) (synopsis "Server implementation of the SPICE protocol") (description "SPICE is a remote display system built for virtual environments which allows you to view a computing 'desktop' environment diff --git a/gnu/packages/web.scm b/gnu/packages/web.scm index f8315d4379..8dc6927897 100644 =2D-- a/gnu/packages/web.scm +++ b/gnu/packages/web.scm @@ -4241,15 +4241,6 @@ you'd expect.") (base32 "163py4klka423x7li2b685gmg3a6hjf074mlff2ajhmi3l0lm8x6")))) (build-system glib-or-gtk-build-system) =2D (arguments =2D `(#:phases =2D (modify-phases %standard-phases =2D (add-before 'check 'use-empty-ssl-cert-file =2D (lambda _ =2D ;; Search for ca-certificates.crt files =2D ;; during the check phase. =2D (setenv "SSL_CERT_FILE" "/dev/null") =2D #t))))) (native-inputs `(("gobject-introspection" ,gobject-introspection) ;; For check phase. =2D-=20 2.20.0 --=-=-= Content-Type: text/plain The reason for removing SSL_CERT_FILE completely instead of adjusting the patch is that Glib-Networking no longer does any certificate handling by itself, instead everything is handed over to GnuTLS. Thus supporting such a patch is difficult, and it does not seem to be needed anymore in practice. --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlwQISEACgkQoqBt8qM6 VPpY8Qf+OCOAFs7H0dqvFmkbhIvjIjDz5YKaAdMWR2W+xn9AfGiKRGpPgKqx3+++ AMLivLyz8DCAnf5nCKm/i80HpeLX9uGp/NWZGkJoGF56dVIQSdcaT3LDAdqJM0gC B1of5xJfShCcuegTTa9NkP+eSPYpgeoyoA80Lny7UGQhgfR526sxkalKEiGtqJTk gWkSaynQ1yVyYzlJwjFPK462m7ZzVAK1xpFWRRGZw3dK6v1fhCsX3jDtRGviaG0n sk5AFy3gIuvh/He+xa27jM0t9tGSuAPHGkmHMtfNfCdKeH0K8nl45EqL01wlIsnV yDvA8mO0bICtbl0DS3EL3pC2EINs7g== =+KEK -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Tue Dec 11 20:06:01 2018 Received: (at 33701) by debbugs.gnu.org; 12 Dec 2018 01:06:01 +0000 Received: from localhost ([127.0.0.1]:44313 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWsyP-0007aM-2D for submit@debbugs.gnu.org; Tue, 11 Dec 2018 20:06:01 -0500 Received: from wout2-smtp.messagingengine.com ([64.147.123.25]:38975) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWsyM-0007a8-Sy for 33701@debbugs.gnu.org; Tue, 11 Dec 2018 20:06:00 -0500 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.west.internal (Postfix) with ESMTP id B1B04C33; Tue, 11 Dec 2018 20:05:52 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute4.internal (MEProxy); Tue, 11 Dec 2018 20:05:53 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=famulari.name; h=date:from:to:cc:subject:message-id:references:mime-version :content-type:in-reply-to; s=mesmtp; bh=wz1YzGH1vUovZOj+MKiV86sD crCKxkzRjpD8bYvSJ4k=; b=aE7FbPBZhVHtO+tLqbXpS2xSyvt2pImHfuEaqGok pJot8xCI/VFe9iphyHBT4Fxd19KAbidDvLtgmoesTd8lkl3Rvg6tl1D8EtUxmDrU Y8m7HuOMTs+r1Zx3wa11duA3O9T/LRrIPRxjYP9jA/sbu1z4tBacZhARCMdE3dmX Yio= DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; bh=wz1YzG H1vUovZOj+MKiV86sDcrCKxkzRjpD8bYvSJ4k=; b=yy/hXjOh022QbQEYVtubQY BGrmfHtHdd9OCbqLHtj5hztIqX20RFC3pYUMO2VN7CcMA1L4J2aoyPUhxXHGeBd8 srsDhiMb/uVa1Wr7RB/L3yQgQ4gzpT/k9MrcacOz0I/mlINYvPvQmB5AtL+4+8ZH 27jAYgcViRPnjsMKHOran1LYmNMQCT8LW1rscU+oUkxavE6J4Ya5D9vwbBZMh8s0 voUh6qWSF4AclOllHVfnu15srcE/OtIKw4Sa33085Y/dlxtHpKZ+LMW2lIEgADLF FURDflXvyFhj7TomESWLOPMLF++WRUaCyJf80PulcvR5x1BJDfOqheaEbzrCYChQ == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegkedgfeduucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpeffhffvuffkfh ggtggujggfsehgtderredtredvnecuhfhrohhmpefnvghoucfhrghmuhhlrghrihcuoehl vghosehfrghmuhhlrghrihdrnhgrmhgvqeenucffohhmrghinhepghhuihigshgurdhorh hgnecukfhppedujedvrdehkedrvddtuddrvdefheenucfrrghrrghmpehmrghilhhfrhho mheplhgvohesfhgrmhhulhgrrhhirdhnrghmvgenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (unknown [172.58.201.235]) by mail.messagingengine.com (Postfix) with ESMTPA id 475EEE4445; Tue, 11 Dec 2018 20:05:51 -0500 (EST) Date: Tue, 11 Dec 2018 20:05:49 -0500 From: Leo Famulari To: Marius Bakke Subject: Re: [bug#33701] [PATCH staging 00/23] Glib/GTK+ updates Message-ID: <20181212010549.GA5512@jasmine.lan> References: <20181211011205.15542-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="bp/iNruPH9dso1Pn" Content-Disposition: inline In-Reply-To: <20181211011205.15542-1-mbakke@fastmail.com> User-Agent: Mutt/1.11.0 (2018-11-25) X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 Cc: 33701@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --bp/iNruPH9dso1Pn Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Tue, Dec 11, 2018 at 02:12:05AM +0100, Marius Bakke wrote: > This late series adds around 1000 rebuilds to the current staging > branch. They also bring many of the GNOME family libraries to the > latest upstream versions. >=20 > The good: > * Latest Ghostscript, Poppler, Harfbuzz, GnuTLS, and other > security-critical libraries. That's great. > Some of these have changed > build systems, or ABIs, so future patching is easier. Okay, makes sense. > * Most/all regressions are already fixed. Good :) > The bad: > * GCC7 is now in the closure of cURL (via nghttp2). Oh well. >=20 > The ugly: > * 37 files changed, 1225 insertions(+), 996 deletions(-) > * Total rebuild count for staging is around 4700 packages. >=20 > WDYT? It seems like a lot, but it's probably not higher than previous staging branches, right? I have an intuitive sense of how quickly Hydra could build this, but not for Cuirass on . Does it seem reasonable to you? --bp/iNruPH9dso1Pn Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEEsFFZSPHn08G5gDigJkb6MLrKfwgFAlwQXucACgkQJkb6MLrK fwjVuxAA7XOR2nQfwRQbprlJwZrRH0UwmG7T2ZzVMzFjj71DQGND7CXgCAXow0e+ iel4DIFZiRpGJORw73LZUubtA66z21XcJtTRyhbziQW7Mx6xpskxnJC3vksORV21 zhIi9K9Cg/Ftgb6M/eNqoVtrvpkQ8vwodXEdqJ0ve29plANUzlwKusd+IT5qSfiu hGXnmQ1TL0kBdOkn6vsBlvki77Ey58WHp2NB4qIPdmjkzNdMwZ7VT131PutU6Etb 3eAZKnrgnDuMW2P4kfk8hmuK79sZLaaO0MGIspLhKI/t7sS+8oq7zzq7YBeFQUwc rzBMLVzr5xz0I8FoJ17RK+eNW6569x/6zQTQeQ81DSAS1dGPRVPqUMLGOqIZj8+a 19M2Sbth6WdGJ0bYxb/lv9nPqaMi8wkbu6HwbTHE5XzxKzTm1Nl6/VID88QmLQDl n3JGvm4yupbj8+QGpauXGzoFwzxCb7Fwnx1XPzg1kwHodli3nNgfTmfs6OoliNsA CJwCaK/rKpfa48iaOWGxOw8eYLp0f1QmdOTagK/7xSEf21AyNWaonmJfXN1ZqBqc LDKkOcQAnw/KaRpZVD5JKjxU6Etv1XEk8FstXEAT5xeR5bulgYZaoGfzzY6iz2zE uo3pzVUP0f2+lrRdBxw4ojBSNKMtSbHzDaIpJsnh6+0zDCr0sK8= =c80Z -----END PGP SIGNATURE----- --bp/iNruPH9dso1Pn-- From debbugs-submit-bounces@debbugs.gnu.org Tue Dec 11 20:07:30 2018 Received: (at 33701) by debbugs.gnu.org; 12 Dec 2018 01:07:30 +0000 Received: from localhost ([127.0.0.1]:44318 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWszq-0007dD-Hk for submit@debbugs.gnu.org; Tue, 11 Dec 2018 20:07:30 -0500 Received: from wout2-smtp.messagingengine.com ([64.147.123.25]:52419) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWszo-0007cz-LO for 33701@debbugs.gnu.org; Tue, 11 Dec 2018 20:07:29 -0500 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.west.internal (Postfix) with ESMTP id 9C646DC9; Tue, 11 Dec 2018 20:07:22 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute4.internal (MEProxy); Tue, 11 Dec 2018 20:07:22 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=famulari.name; h=date:from:to:cc:subject:message-id:references:mime-version :content-type:in-reply-to; s=mesmtp; bh=WpzomO8aJ3PYJ4STeUWc1T3L rMhlZ5nat/EhBtUqlx0=; b=kfhpsNlIvDSUCpJOpms87+pEHHpa3+6ZFy7PZty5 aPARTtjPteNwm1dSb2E5nVoAuMR9GxoOe4+AoCgERlZG14EWqytsXOQnL+2ag2Dc hyQncNGEQcUn3EPlaNGsBNuC1CNI8EqHPTQP4LcpBgM+dgVPU8wQhJknlgGrCYyL E8U= DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; bh=WpzomO 8aJ3PYJ4STeUWc1T3LrMhlZ5nat/EhBtUqlx0=; b=tNMOOrK6fKvm6Dods7Xyn/ p2FKQBI5R5kGHy3BLuVEBw/wR6fk65pmbFu1HCU+zvl8y34Po3GxUpgMq8oTrRbl paHqR/jEJ0C1T91tYuHuVww6N+oDJdgQdbnHMknKRxzitL86++HW/9Nqk6CPQsfW GDZC5wuZBOQqldcM4xRRZIEWmeC5gz2Ts7MY33PLHAjYIySkats9FCacmBPJoGWP cWGS3OLra5BtyefuBpd0lSHdoFOW1FNc6M5a502B3yAWVyRm7rGObhl4eDmyOJq1 Pph8y9cPnVQN9w5xCEVyr2zhfHFTVmaG0BjYXIdMR+Wlp4DRayI1WRfhvw1UVJvQ == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegkedgfeduucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpeffhffvuffkfh ggtggujggfsehgtderredtredvnecuhfhrohhmpefnvghoucfhrghmuhhlrghrihcuoehl vghosehfrghmuhhlrghrihdrnhgrmhgvqeenucfkphepudejvddrheekrddvtddurddvfe ehnecurfgrrhgrmhepmhgrihhlfhhrohhmpehlvghosehfrghmuhhlrghrihdrnhgrmhgv necuvehluhhsthgvrhfuihiivgeptd X-ME-Proxy: Received: from localhost (unknown [172.58.201.235]) by mail.messagingengine.com (Postfix) with ESMTPA id C0AECE4750; Tue, 11 Dec 2018 20:07:21 -0500 (EST) Date: Tue, 11 Dec 2018 20:07:20 -0500 From: Leo Famulari To: Marius Bakke Subject: Re: [bug#33701] [PATCH staging 12/23] gnu: ghostscript: Update to 9.26. Message-ID: <20181212010720.GB5512@jasmine.lan> References: <20181211011416.15902-1-mbakke@fastmail.com> <20181211011416.15902-12-mbakke@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="wq9mPyueHGvFACwf" Content-Disposition: inline In-Reply-To: <20181211011416.15902-12-mbakke@fastmail.com> User-Agent: Mutt/1.11.0 (2018-11-25) X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 Cc: 33701@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --wq9mPyueHGvFACwf Content-Type: text/plain; charset=us-ascii Content-Disposition: inline On Tue, Dec 11, 2018 at 02:14:05AM +0100, Marius Bakke wrote: > * gnu/packages/patches/ghostscript-bug-699708.patch, > gnu/packages/patches/ghostscript-CVE-2018-16509.patch: Delete files. > * gnu/local.mk (dist_patch_DATA): Remove them. > * gnu/packages/ghostscript.scm (ghostscript): Update to 9.26. > [source](patches): Remove obsolete. Very good, this is an important update. --wq9mPyueHGvFACwf Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEEsFFZSPHn08G5gDigJkb6MLrKfwgFAlwQX0gACgkQJkb6MLrK fwg8zRAA39e5JRtw7Zq2069XGdimg3Cru+fg5bqIs/VqbqB/0K2kyOItACNR+2+X k2C/c1Q1uwqzCEK8pSxSy0Jo8K1ZhYE3XaA4NjEQHVvBKKLumGBG8UAG8QbImvM3 iLQ5hxikfT1zhji98IUjU8HtsLwTeyFVuNmkXFOFx3bArFWwoZY9ezPHRd0x72am a5gJ4xy0lLxQm5fZYdpvhpQ/eOl56VM2s23DfWhbdOxt1oa0GjzyTj3ovTBTclsz S6lDKMA1C44m9GoMEZxsaxmZjZo+ZYIbyr+OlTbosZ1mTG6p2eq8w8tw96pX00hn 1TwVeI+ozChgPpK/hNSUW7WI/YNKxWkBO0NKbLDSJ7zSEI3SEHF/S7EjOjE6VbjZ M23S2m9HR9ZujjJxh8V6CzMYHCREMXRrgOZwJKTYdX0qT3LEMupMgX+BPw5w35e/ YVSumyeIbbhbltjUPKu6+rMp3FFwrzYRIDGg5n6VVxWKzawQyLJnjmvjqc2cqUJQ 0GELZzEiP3SQ6B2YvUslccmFrptvPFRMG2dyoocx/lBMhfkJKbF7FQcu/zRXuMH8 lb1qvYQYtuK88W6NFLEpoyt60UgxbfesTAHvlb6PxvYpWK1ajWJpddtKOrnE/Kt/ UmnkQ6pOrbE37p6i/vwshrWubSkwUajtdkqL119XC50L0jqMfw4= =URiY -----END PGP SIGNATURE----- --wq9mPyueHGvFACwf-- From debbugs-submit-bounces@debbugs.gnu.org Tue Dec 11 20:09:06 2018 Received: (at 33701) by debbugs.gnu.org; 12 Dec 2018 01:09:06 +0000 Received: from localhost ([127.0.0.1]:44323 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWt1N-0007g9-W0 for submit@debbugs.gnu.org; Tue, 11 Dec 2018 20:09:06 -0500 Received: from wout2-smtp.messagingengine.com ([64.147.123.25]:37543) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWt1M-0007fc-Al for 33701@debbugs.gnu.org; Tue, 11 Dec 2018 20:09:04 -0500 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.west.internal (Postfix) with ESMTP id 47BBEBD5; Tue, 11 Dec 2018 20:08:58 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute4.internal (MEProxy); Tue, 11 Dec 2018 20:08:58 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=famulari.name; h=date:from:to:cc:subject:message-id:references:mime-version :content-type:in-reply-to; s=mesmtp; bh=njecHY8sZtlNjSXVoMjTeMZP 6Y+0mB5dMqA5+9cfCIg=; b=lHNL0MmtzQHaw/7uM0iWPPw/bPEhZdp10bYW6Vc0 rX1CS0nwobrrP3E6CeovtFRsWHEj+9fc/Ei8gnb9XWo8Jrqdk9nbltB7IujqeP1l gTBkDEH9ATJazkLILPxgl3WI5bOH14Wse7kEw0LdrnypoHKjHRQ36VByp/Wj2yEt iYs= DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; bh=njecHY 8sZtlNjSXVoMjTeMZP6Y+0mB5dMqA5+9cfCIg=; b=KrS/R0DKgS4NWrMumxSOew Lk2+d4maIN68dafOsaw2I66dwxgvLr9vXxWG+jQM72A8hJNXoa6jjbuKBGHqIRID S268n5FdHELul/JLHDijsXEDn65aWBLe76zU2Dv35ndzpPUzQAXFIw2HxgwkESo8 H4LetRWn5rESiAAYwWo4A/LIkisNJt9kXsM2ZjPH/Ygi486Eh2lXe0bxF9Jb2ClX NE3c4j4WItuVlbocfjN8trywJY8ZqX8fIrFgyhn7kFQi6UmVq3NeW5X/rrXLWFdR U48/oajtGHhexxs4914BzwP+Sp8OysaQBkGtvCU0tMvihs8lsclnatc31b4O6jFg == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegkedgfeduucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpeffhffvuffkfh ggtggujggfsehgtderredtredvnecuhfhrohhmpefnvghoucfhrghmuhhlrghrihcuoehl vghosehfrghmuhhlrghrihdrnhgrmhgvqeenucfkphepudejvddrheekrddvtddurddvfe ehnecurfgrrhgrmhepmhgrihhlfhhrohhmpehlvghosehfrghmuhhlrghrihdrnhgrmhgv necuvehluhhsthgvrhfuihiivgepud X-ME-Proxy: Received: from localhost (unknown [172.58.201.235]) by mail.messagingengine.com (Postfix) with ESMTPA id 79530E4443; Tue, 11 Dec 2018 20:08:56 -0500 (EST) Date: Tue, 11 Dec 2018 20:08:55 -0500 From: Leo Famulari To: Marius Bakke Subject: Re: [bug#33701] [PATCH staging 04/23] gnu: poppler: Update to 0.72.0. Message-ID: <20181212010855.GC5512@jasmine.lan> References: <20181211011416.15902-1-mbakke@fastmail.com> <20181211011416.15902-4-mbakke@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="oJ71EGRlYNjSvfq7" Content-Disposition: inline In-Reply-To: <20181211011416.15902-4-mbakke@fastmail.com> User-Agent: Mutt/1.11.0 (2018-11-25) X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701 Cc: 33701@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --oJ71EGRlYNjSvfq7 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline On Tue, Dec 11, 2018 at 02:13:57AM +0100, Marius Bakke wrote: > * gnu/packages/scribus.scm (scribus)[source](patches): Add upstream patch origins. > [source](modules, snippet): New fields. > * gnu/packages/libreoffice.scm (libreoffice)[source](patches): Add three > upstream origins. Can you add some brief comments explaining the purpose of these patches? --oJ71EGRlYNjSvfq7 Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEEsFFZSPHn08G5gDigJkb6MLrKfwgFAlwQX6cACgkQJkb6MLrK fwiFAQ//dCujWnq5ahlDb4kwsij4Talieg4B/jZrLs6mdFmHJdOQSgyrVlUPOjUw ZSAp54DsyLRG44RyUKkPNP7XZebjyoVbKSPCc+CRWlVoHxJTytAWoTi3zI4bNhZN lFhZWdG/jI2GVTJ4fjcpoKpQ7CG9WOzL+OsjBX6BVEKUCYz2Kid7UxMH/+M7Vkft CwW3H7Enk14oS6oJ22Z2Kg/58flDwgLngD1v6QEcY6oYsQwyyPM5Vln1aTcsOAro ScYr9Toyfea38x47ZziUx8GVVLe6nOsKz87+0PCAuwJlUb+juRzoSQEQ8rw817/x YkNLdlx6fIKnSCARDgIWIruO2vllplal7Yzr75Sr3jS+u6Uh8sG2jZ8f3TVA/4TD ismTZyJPFb0BDBk50EPZ+kr8sbdQuRMd0z7BoK8CdjmoEwrkbplqmPcY0+KiJRlf EYAdJqpOclQcBystJqga21Np98UT0Vmf6NDdLyw878jlrv0Y6zvyKIRP1QrAShj3 2lAkZ3UkLFpdTcaJnHH7FRpAwcclqpyjqFRrPXgvhrc7uqK9cjuBvzv+K0J8ozH1 Np8XBGuRDfFCb9CTaUeAMTQXdC8+XPufcfqipfxux2BT6QaBaF1rVUdAUoTJ/HuP k1k3vn6XUhkkL9rVGsfFHxYSz65H7Ygks1uXsH9eRx/jKucA4ko= =RZew -----END PGP SIGNATURE----- --oJ71EGRlYNjSvfq7-- From debbugs-submit-bounces@debbugs.gnu.org Wed Dec 12 15:57:43 2018 Received: (at 33701-done) by debbugs.gnu.org; 12 Dec 2018 20:57:44 +0000 Received: from localhost ([127.0.0.1]:45557 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gXBZf-0002zB-Jh for submit@debbugs.gnu.org; Wed, 12 Dec 2018 15:57:43 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:34477) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gXBZd-0002ys-74 for 33701-done@debbugs.gnu.org; Wed, 12 Dec 2018 15:57:41 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id C0716210F7; Wed, 12 Dec 2018 15:57:35 -0500 (EST) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Wed, 12 Dec 2018 15:57:35 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm1; bh=jLTFk+2DOou/t1+8dhZiOKPKkc 35sYewniCxY1zbOKo=; b=ZrzWGO/gLyVqdvOFloz9oX4Fg6IgCe0pYu93X2HEX/ muQJnh+YaS4/na1ut0DFIpCag9z2ZGa9rKMzO3IWm3K3Li0IXlj+t8VsZuyjRHmv cbydRnfEJWEDjLX85deITX0fwFv5fs3xCsy/Ih87UmABiN4DKGXiNDAWt7v9ePh3 NopnSk9LY/IN+OAvyNw5IDNkQvo3MvrSvp+cr62LDi1b9CdwD88nhGb7jt6iUCer eRAcu6FNQoaE3eNzds9pkJqSHpPEglsekBmG7uqrG1vMpwcVZ9tHfvmtxyzV8h0p STeJsZ4IFPmIYkyPbePSQVZCUdWyqyWIeHAXkNLE4yJw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; bh=jLTFk+ 2DOou/t1+8dhZiOKPKkc35sYewniCxY1zbOKo=; b=I139T2TbzzyPrfNlSO0LBs 0VL2YCvt9qTU2ECIITdT2/MfWuFoD9jHmXkkTCTC1cVoZDv2Lm2DDPjMLUeyRnUq v/WeUIodW2k4bJmjton3aT0KcfM47MB5SOv84XbVtB2snQuXuKAS9yedxX1p5AD+ cgZQ3jB83aCkqayNKdfDD6AhMEhwZ5OufLsU5WIS+/+V9ozWJex8PObUCAWyWhP2 k2orOY/PyA0rkpdVj3PiJfNFL4TsDPo+v4Dt+W5uKMF83f9mrHM1ndj1uLUy06eq jOyQKRAGTfch9P1sfrx0mFjlMtnT6fBoHRMwb4m5HzqEA42SuKbhqhXUvsAHbieQ == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtkedrudehtddgheefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufgjfhgffffkgggtsehgtderredtredtnecuhfhrohhmpe forghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeen ucffohhmrghinhepghhuihigshgurdhorhhgnecukfhppeeivddrudeirddvvdeirdduge dtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehmsggrkhhkvgesfhgrshhtmhgrihhlrdgt ohhmnecuvehluhhsthgvrhfuihiivgeptd X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 22269102DD; Wed, 12 Dec 2018 15:57:35 -0500 (EST) From: Marius Bakke To: Leo Famulari Subject: Re: [bug#33701] [PATCH staging 00/23] Glib/GTK+ updates In-Reply-To: <20181212010549.GA5512@jasmine.lan> References: <20181211011205.15542-1-mbakke@fastmail.com> <20181212010549.GA5512@jasmine.lan> User-Agent: Notmuch/0.28 (https://notmuchmail.org) Emacs/26.1 (x86_64-pc-linux-gnu) Date: Wed, 12 Dec 2018 21:57:32 +0100 Message-ID: <87lg4ubgzn.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33701-done Cc: 33701-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable Leo Famulari writes: >>=20 >> The ugly: >> * 37 files changed, 1225 insertions(+), 996 deletions(-) >> * Total rebuild count for staging is around 4700 packages. >>=20 >> WDYT? > > It seems like a lot, but it's probably not higher than previous staging > branches, right? I have an intuitive sense of how quickly Hydra could > build this, but not for Cuirass on . Does it seem > reasonable to you? I don't have a feeling for Berlin either, but its x86 build farm is vastly larger than Hydra. I think they can both handle ~5k * Arches package builds within a few weeks (modulo regressions). For x86_64, I expect Berlin to be done within a few days! I've pushed the series with additional Poppler comments, as well as a few new package updates. Thanks for checking! --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlwRdj0ACgkQoqBt8qM6 VPqwtggAxJAF/OcGi7TCdHaS6tLQBluLHRDk/4iSIDvudwoZA2+QLs4Dyg5Bq0Br atJipSvKCCJmmfU4xWFL3hCoPDRh0snk0upwRlAAa244r5e6k6/J3ZuO7NDuCEOb uI+iThX2OdIFOvDNumiFLgF+2MxOUQNYZfzqNxBtL1KqyvA5TWins2+mcSWgOsgV UjPOYOV8mXVj+A7Cs7B8mqC8sxcNaa1Z6fWEvomqvJkZEvv4TlESFJsXHbIoqXTz Cz2WpDanruyy/KckCcvYQTG92BIhhHCzEh/8YrjqzKcFipuvzsk2ghPdCw8mbZHP k5kllYbPUK++DjuGbiLqw9RqRwvl8w== =ObrE -----END PGP SIGNATURE----- --=-=-=-- From unknown Tue Aug 19 23:15:40 2025 Received: (at fakecontrol) by fakecontrolmessage; To: internal_control@debbugs.gnu.org From: Debbugs Internal Request Subject: Internal Control Message-Id: bug archived. Date: Thu, 10 Jan 2019 12:24:04 +0000 User-Agent: Fakemail v42.6.9 # This is a fake control message. # # The action: # bug archived. thanks # This fakemail brought to you by your local debbugs # administrator