From unknown Thu Aug 14 12:21:02 2025 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 X-Mailer: MIME-tools 5.509 (Entity 5.509) Content-Type: text/plain; charset=utf-8 From: bug#33676 <33676@debbugs.gnu.org> To: bug#33676 <33676@debbugs.gnu.org> Subject: Status: GuixSD on eoma68-a20? Reply-To: bug#33676 <33676@debbugs.gnu.org> Date: Thu, 14 Aug 2025 19:21:02 +0000 retitle 33676 GuixSD on eoma68-a20? reassign 33676 guix submitter 33676 Danny Milosavljevic severity 33676 normal thanks From debbugs-submit-bounces@debbugs.gnu.org Sat Dec 08 12:12:45 2018 Received: (at submit) by debbugs.gnu.org; 8 Dec 2018 17:12:45 +0000 Received: from localhost ([127.0.0.1]:38727 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVg9l-0007Yq-Bw for submit@debbugs.gnu.org; Sat, 08 Dec 2018 12:12:45 -0500 Received: from eggs.gnu.org ([208.118.235.92]:40487) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVg9j-0007Yd-RY for submit@debbugs.gnu.org; Sat, 08 Dec 2018 12:12:44 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gVg9d-0005Vd-Nr for submit@debbugs.gnu.org; Sat, 08 Dec 2018 12:12:38 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=-0.0 required=5.0 tests=BAYES_40 autolearn=disabled version=3.3.2 Received: from lists.gnu.org ([2001:4830:134:3::11]:46022) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1gVg9d-0005VG-JJ for submit@debbugs.gnu.org; Sat, 08 Dec 2018 12:12:37 -0500 Received: from eggs.gnu.org ([2001:4830:134:3::10]:50088) by lists.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1gVg9c-0006Zv-Kg for bug-guix@gnu.org; Sat, 08 Dec 2018 12:12:37 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gVg9X-0005S5-FJ for bug-guix@gnu.org; Sat, 08 Dec 2018 12:12:36 -0500 Received: from dd26836.kasserver.com ([85.13.145.193]:57124) by eggs.gnu.org with esmtps (TLS1.0:DHE_RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1gVg9X-0005Kz-7S; Sat, 08 Dec 2018 12:12:31 -0500 Received: from localhost (178.113.145.90.wireless.dyn.drei.com [178.113.145.90]) by dd26836.kasserver.com (Postfix) with ESMTPSA id 6752D3362B4A; Sat, 8 Dec 2018 18:12:20 +0100 (CET) Date: Sat, 8 Dec 2018 18:12:14 +0100 From: Danny Milosavljevic To: swedebugia Subject: Re: GuixSD on eoma68-a20? Message-ID: <20181208181214.2308472a@scratchpost.org> In-Reply-To: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> X-Mailer: Claws Mail 3.17.1 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; boundary="Sig_/NMbaBS9gWxQajhO1Ne4Yq42"; protocol="application/pgp-signature" X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] [fuzzy] X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.6.x X-Received-From: 2001:4830:134:3::11 X-Spam-Score: -5.0 (-----) X-Debbugs-Envelope-To: submit Cc: guix-devel , bug-guix@gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -6.0 (------) --Sig_/NMbaBS9gWxQajhO1Ne4Yq42 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable Hi swedebugia, On Sat, 8 Dec 2018 17:39:01 +0100 swedebugia wrote: > Could we pre-order some of these owned by the foundation to > be used to to hack on this? >=20 > See https://www.crowdsupply.com/eoma68/micro-desktop Guix received one but we have so far be unable to get the GuixSD flash image because something always breaks on Hydra before it's done (for example lack of disk space - see https://hydra.gnu.org/build/3198097/log/ra= w . Note: The latter thing counts as "successful" build. WTF?). I have the device here in my hand (I tested it using u-boot only - works fi= ne). I'm now setting up my own build server and trying to get the flash image that way - which is ridiculous. Also, be aware that the Allwinner A20 is really really slow. There are ARM computers worth using as a normal PC, but this one isn't. I tried. (For example the Allwinner R40 is quite okay to use as a PC - see Sinovoip Banana Pi M2 Ultra) I like the concept of easily upgradeable computers, though! --Sig_/NMbaBS9gWxQajhO1Ne4Yq42 Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEds7GsXJ0tGXALbPZ5xo1VCwwuqUFAlwL+24ACgkQ5xo1VCww uqWlfggAjUZecWgeq5NTGfKgoZPTdw2jzY9Vcp+i1ZORdsm7Uq2TCiqGg3mH0F2f 63jiN4edPHfKNbtXTDJ3JzcViB+Q5sRDf9rWRzSlxtcWEEpeDYDRIPo9M40EVKiI Bm02fN5ox+hNukbXjuiDYa5LV2JSU8nYWXhCi+9lBFoRIQLRhxlwwLOxNmO1po48 jBNMQYaOwuFXKUJn7hs8yOX50hhiDGZ44KPkguibZI0kqvbN0XlizB0EHJT5ILS4 sdFfMXCJfcVdVdnf3rcq5vk+laVWpvxPUQVRFa7pmVDMWJgU5AFClWw4wl3djOpi B+fjSabgd+p/5hD2HQyXcsl0w6A8Bg== =vl7I -----END PGP SIGNATURE----- --Sig_/NMbaBS9gWxQajhO1Ne4Yq42-- From debbugs-submit-bounces@debbugs.gnu.org Sat Dec 08 14:15:50 2018 Received: (at 33676) by debbugs.gnu.org; 8 Dec 2018 19:15:50 +0000 Received: from localhost ([127.0.0.1]:38762 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVi4s-0002BI-BW for submit@debbugs.gnu.org; Sat, 08 Dec 2018 14:15:50 -0500 Received: from dd26836.kasserver.com ([85.13.145.193]:51560) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVi4q-0002BA-Rz for 33676@debbugs.gnu.org; Sat, 08 Dec 2018 14:15:49 -0500 Received: from localhost (178.113.145.90.wireless.dyn.drei.com [178.113.145.90]) by dd26836.kasserver.com (Postfix) with ESMTPSA id 2E18D336043C; Sat, 8 Dec 2018 20:15:47 +0100 (CET) Date: Sat, 8 Dec 2018 20:15:42 +0100 From: Danny Milosavljevic To: Ricardo Wurmus Subject: Re: bug#33676: GuixSD on eoma68-a20? Message-ID: <20181208201542.241ac6a7@scratchpost.org> In-Reply-To: <87k1kjgbxv.fsf@elephly.net> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <87k1kjgbxv.fsf@elephly.net> X-Mailer: Claws Mail 3.17.1 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; boundary="Sig_/jZL1jNIFbTL+yay=BB5RWgD"; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: swedebugia , guix-devel@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Sig_/jZL1jNIFbTL+yay=BB5RWgD Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable Hi Ricardo, On Sat, 08 Dec 2018 18:34:04 +0100 Ricardo Wurmus wrote: > > Guix received one but we have so far be unable to get the GuixSD flash > > image because something always breaks on Hydra before it's done (for > > example lack of disk space - see https://hydra.gnu.org/build/3198097/lo= g/raw . > > Note: The latter thing counts as "successful" build. WTF?). =20 >=20 > Is this now better with ci.guix.info (berlin.guixsd.org)? No idea. How to I get the flash-image using ci.guix.info ? I tried "guix system disk-image --system=3Darmhf-linux gnu/system/install.s= cm" but that builds a lot of stuff from source. Let's see whether it will be done = before the sun exploded :) > > I have the device here in my hand (I tested it using u-boot only - work= s fine). =20 >=20 > Oh, so it works out of the box with GuixSD already? As I said, I've tested it with u-boot only so far. --Sig_/jZL1jNIFbTL+yay=BB5RWgD Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEds7GsXJ0tGXALbPZ5xo1VCwwuqUFAlwMGF4ACgkQ5xo1VCww uqXgdAf+JlHGI1oZZRm7omk4Uysg4jpmQv8wCOhuNvUnWbr7NnT1IBN4XuNO9zx1 JAA4ZOpZrpYtJS5o2ymfBb31Tp9OKZlRwS+T9cFrs23HREyASaBXkBoixi9fIJO7 mq71q2cfAX6XZU/qNuBdcWaHQJ6j2/a0e07R5i1AdMLcBVTRvncvxuM09jDY9xR+ hzlO4flUfkyXAVFe9319Ke6B8dhevHjnrhan3mOY4WIgeeEriRAdQI0YppjpVOEP fA5GxpBvC8HC2f96E9An5DoVDizi6ES4dIFSn96be4oM+utJNb+JCPHJgu15Pfax HgLEx3motcDvW5fvHg7XDoPn86TieA== =HafG -----END PGP SIGNATURE----- --Sig_/jZL1jNIFbTL+yay=BB5RWgD-- From debbugs-submit-bounces@debbugs.gnu.org Sat Dec 08 16:01:03 2018 Received: (at 33676) by debbugs.gnu.org; 8 Dec 2018 21:01:03 +0000 Received: from localhost ([127.0.0.1]:38817 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVjif-0004l5-Cx for submit@debbugs.gnu.org; Sat, 08 Dec 2018 16:01:02 -0500 Received: from world.peace.net ([64.112.178.59]:48758) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVjic-0004kn-9B for 33676@debbugs.gnu.org; Sat, 08 Dec 2018 16:00:59 -0500 Received: from mhw by world.peace.net with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.89) (envelope-from ) id 1gVjiW-000194-2h; Sat, 08 Dec 2018 16:00:52 -0500 From: Mark H Weaver To: Danny Milosavljevic Subject: Re: GuixSD on eoma68-a20? References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> Date: Sat, 08 Dec 2018 15:59:58 -0500 In-Reply-To: <20181208181214.2308472a@scratchpost.org> (Danny Milosavljevic's message of "Sat, 8 Dec 2018 18:12:14 +0100") Message-ID: <87pnubn386.fsf@netris.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 33676 Cc: swedebugia@riseup.net, guix-devel@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hi Danny, Danny Milosavljevic writes: > On Sat, 8 Dec 2018 17:39:01 +0100 > swedebugia wrote: > >> Could we pre-order some of these owned by the foundation to >> be used to to hack on this? >> >> See https://www.crowdsupply.com/eoma68/micro-desktop > > Guix received one but we have so far be unable to get the GuixSD flash > image because something always breaks on Hydra before it's done (for > example lack of disk space - see https://hydra.gnu.org/build/3198097/log/raw . > Note: The latter thing counts as "successful" build. WTF?). This sounds like two distinct bugs: * Regarding the lack of disk space: if I'm not mistaken, as things are currently implemented, we must specify the size of the disk image manually. I guess we need to increase the size. * This error that occurs within QEMU is apparently not being propagated to the outer build script. That should be fixed. > I'm now setting up my own build server and trying to get the flash image > that way - which is ridiculous. You seem to be assuming that the problem building the disk image is a Hydra-specific problem. Do you have reason to believe so? I would guess that these bugs are in the disk image builder. What do you think? Regards, Mark From debbugs-submit-bounces@debbugs.gnu.org Sat Dec 08 18:30:24 2018 Received: (at 33676) by debbugs.gnu.org; 8 Dec 2018 23:30:24 +0000 Received: from localhost ([127.0.0.1]:38918 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVm3E-0008TJ-8L for submit@debbugs.gnu.org; Sat, 08 Dec 2018 18:30:24 -0500 Received: from eggs.gnu.org ([208.118.235.92]:43023) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVm3A-0008T1-TD for 33676@debbugs.gnu.org; Sat, 08 Dec 2018 18:30:22 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gVm32-00076K-W0 for 33676@debbugs.gnu.org; Sat, 08 Dec 2018 18:30:14 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00 autolearn=disabled version=3.3.2 Received: from fencepost.gnu.org ([2001:4830:134:3::e]:57706) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1gVm31-0006yn-01; Sat, 08 Dec 2018 18:30:12 -0500 Received: from [2a01:e0a:1d:7270:6a6c:dc17:fc02:cfda] (port=44028 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1gVm30-0001pE-NH; Sat, 08 Dec 2018 18:30:10 -0500 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Danny Milosavljevic Subject: Re: bug#33676: GuixSD on eoma68-a20? References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <87k1kjgbxv.fsf@elephly.net> <20181208201542.241ac6a7@scratchpost.org> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 19 Frimaire an 227 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Sun, 09 Dec 2018 00:30:08 +0100 In-Reply-To: <20181208201542.241ac6a7@scratchpost.org> (Danny Milosavljevic's message of "Sat, 8 Dec 2018 20:15:42 +0100") Message-ID: <871s6r61hb.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Received-From: 2001:4830:134:3::e X-Spam-Score: -5.0 (-----) X-Debbugs-Envelope-To: 33676 Cc: Ricardo Wurmus , guix-devel@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -6.0 (------) Hi, Danny Milosavljevic skribis: > On Sat, 08 Dec 2018 18:34:04 +0100 > Ricardo Wurmus wrote: > >> > Guix received one but we have so far be unable to get the GuixSD flash >> > image because something always breaks on Hydra before it's done (for >> > example lack of disk space - see https://hydra.gnu.org/build/3198097/l= og/raw . >> > Note: The latter thing counts as "successful" build. WTF?).=20=20 >>=20 >> Is this now better with ci.guix.info (berlin.guixsd.org)? > > No idea. How to I get the flash-image using ci.guix.info ? > > I tried "guix system disk-image --system=3Darmhf-linux gnu/system/install= .scm" but > that builds a lot of stuff from source. Let's see whether it will be don= e before > the sun exploded :) I=E2=80=99d suggest trying again, and possibly retrying a bit later so that substitutes have had a chance to be =E2=80=9Cbaked=E2=80=9D. hydra.gnu.org and now ci.guix.info both provide armhf-linux substitutes. They have much less armv7 CPU power than x86 but still, it shouldn=E2=80=99= t be that bad. Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Sat Dec 08 18:53:49 2018 Received: (at 33676) by debbugs.gnu.org; 8 Dec 2018 23:53:49 +0000 Received: from localhost ([127.0.0.1]:39008 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVmPt-0000e0-9s for submit@debbugs.gnu.org; Sat, 08 Dec 2018 18:53:49 -0500 Received: from dd26836.kasserver.com ([85.13.145.193]:43582) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVmPr-0000ds-EU for 33676@debbugs.gnu.org; Sat, 08 Dec 2018 18:53:47 -0500 Received: from localhost (178.113.145.90.wireless.dyn.drei.com [178.113.145.90]) by dd26836.kasserver.com (Postfix) with ESMTPSA id B3FF03363912; Sun, 9 Dec 2018 00:53:45 +0100 (CET) Date: Sun, 9 Dec 2018 00:53:43 +0100 From: Danny Milosavljevic To: Mark H Weaver Subject: Re: GuixSD on eoma68-a20? Message-ID: <20181209005343.7c8dc8e3@scratchpost.org> In-Reply-To: <87pnubn386.fsf@netris.org> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <87pnubn386.fsf@netris.org> X-Mailer: Claws Mail 3.17.1 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; boundary="Sig_/.RJTWt1zMRTrmpncHUBwcOs"; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: swedebugia@riseup.net, guix-devel@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Sig_/.RJTWt1zMRTrmpncHUBwcOs Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable Hi Mark, On Sat, 08 Dec 2018 15:59:58 -0500 Mark H Weaver wrote: > This sounds like two distinct bugs: >=20 > * Regarding the lack of disk space: if I'm not mistaken, as things are > currently implemented, we must specify the size of the disk image > manually. I guess we need to increase the size. Ah, you are right! https://hydra.gnu.org/build/3194622/log/raw (the usb-im= age for i686) also fails - but nobody noticed because we only distribute the iso image (which determines its size dynamically). I didn't make the connection that this is a fixed-size guest filesystem bef= ore. > * This error that occurs within QEMU is apparently not being propagated > to the outer build script. That should be fixed. Yes. > > I'm now setting up my own build server and trying to get the flash image > > that way - which is ridiculous. =20 >=20 > You seem to be assuming that the problem building the disk image is a > Hydra-specific problem. Do you have reason to believe so? I would > guess that these bugs are in the disk image builder. Probably! According to the progress bar it's missing an additional 40% ? That's... l= arge. I've increased the size for the time being, but according to the logs it was at 800 MiB in 2015. --Sig_/.RJTWt1zMRTrmpncHUBwcOs Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEds7GsXJ0tGXALbPZ5xo1VCwwuqUFAlwMWYcACgkQ5xo1VCww uqXTuAgAl5srjcRljw2QhHST6S+5xf6SKvxVj7JLw/lmNhY31I6PSEx0YRX9U5kj Cse9vqc/c7Xqd+jyyXS9NN/mxeF0kCPSe5Rm/Bkbn1nVmODXzvYVosealf5ggelO YliQtI1JpUWn+PEoKjP/8H5bWegiRD5Os5vO0F/MQ9v/5uaj9SGkUgq6ZDx+RAth WLeXa75WjTwD4JgYIENxB2VjVmPoH1NluXPW7quvxQCSYd+jgE7XS/ikfjK7RBYl 25GwvuvNgvG6CKONsNxZL5Lsby082xjUT1nN4dvhR+PYbGon4WCynW3WEMIKcVG/ Yjho1QdCSuC4nTNdVbBnp7joGumZQQ== =vLzO -----END PGP SIGNATURE----- --Sig_/.RJTWt1zMRTrmpncHUBwcOs-- From debbugs-submit-bounces@debbugs.gnu.org Sun Dec 09 00:21:36 2018 Received: (at 33676) by debbugs.gnu.org; 9 Dec 2018 05:21:36 +0000 Received: from localhost ([127.0.0.1]:39138 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVrX5-0000Oi-Ue for submit@debbugs.gnu.org; Sun, 09 Dec 2018 00:21:36 -0500 Received: from sender-of-o53.zoho.com ([135.84.80.218]:21750) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVrX3-0000OS-F7 for 33676@debbugs.gnu.org; Sun, 09 Dec 2018 00:21:34 -0500 ARC-Seal: i=1; a=rsa-sha256; t=1544290452; cv=none; d=zoho.com; s=zohoarc; b=mH6JWenRmBIq3PgH8t6bYnebPqPKYTqehs+ita60SHUS0Ct8wPFE24K04iWXarHjcUloh6dMLxWr4kq6du3DjHLX+Q+IV4jJxSWCH7Zp66gOik3CQR8q7Ggl1NgBrn8Ga7qGI76CdTtfht2KNR/n1KD5dSJwYDvLca9zCgkaYUo= ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=zoho.com; s=zohoarc; t=1544290452; h=Content-Type:Cc:Date:From:In-Reply-To:MIME-Version:Message-ID:References:Subject:To:ARC-Authentication-Results; bh=AABz+SN+Jf+Lr9WEyU1cQzLdVXLleAfuzxsADzw0SUM=; b=BVZ8KrvgUZn/vIChRfEgeNlRoIFyXFnRy6IY6ID4da+wRCVWCoE+OufnbuSmu+EcVbbSEZOXdwIQ1gD2ra2lhIXnDe/cf7IDnPNStaHMLBIc6g3EtOIB3ep5Se8i5Cr5Pl2BGDCP0FKmzY8PwAvlDfWo9wOFatXSccWjBuIt/Lw= ARC-Authentication-Results: i=1; mx.zoho.com; dkim=pass header.i=elephly.net; spf=pass smtp.mailfrom=rekado@elephly.net; dmarc=pass header.from= header.from= DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; t=1544290452; s=zoho; d=elephly.net; i=rekado@elephly.net; h=References:From:To:Cc:Subject:In-reply-to:Date:Message-ID:MIME-Version:Content-Type; l=522; bh=AABz+SN+Jf+Lr9WEyU1cQzLdVXLleAfuzxsADzw0SUM=; b=Zg7dmFv/5ZB4RCy0JlsSEzm1tAjrOXlSclxthwuRYxnW4xuxEVs/mKuNU4wJKT0r Bz1tbPAopkawb1g0aI6kyPjWZu0XW0dPI5LTZxBAhXpe4eLeHtY4knIwF2d8LaEzEYv 2pzsn2ysn+rF6LccanckBY2jXOvMwvfoiBHxtgKc= Received: from localhost (79.140.114.124 [79.140.114.124]) by mx.zohomail.com with SMTPS id 1544290449679632.3635771760767; Sat, 8 Dec 2018 09:34:09 -0800 (PST) References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> User-agent: mu4e 1.0; emacs 26.1 From: Ricardo Wurmus To: Danny Milosavljevic Subject: Re: bug#33676: GuixSD on eoma68-a20? In-reply-to: <20181208181214.2308472a@scratchpost.org> X-URL: https://elephly.net X-PGP-Key: https://elephly.net/rekado.pubkey X-PGP-Fingerprint: BCA6 89B6 3655 3801 C3C6 2150 197A 5888 235F ACAC Date: Sat, 08 Dec 2018 18:34:04 +0100 Message-ID: <87k1kjgbxv.fsf@elephly.net> MIME-Version: 1.0 Content-Type: text/plain X-ZohoMailClient: External X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 33676 Cc: swedebugia , guix-devel@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hi Danny, > Guix received one but we have so far be unable to get the GuixSD flash > image because something always breaks on Hydra before it's done (for > example lack of disk space - see https://hydra.gnu.org/build/3198097/log/raw . > Note: The latter thing counts as "successful" build. WTF?). Is this now better with ci.guix.info (berlin.guixsd.org)? > I have the device here in my hand (I tested it using u-boot only - works fine). Oh, so it works out of the box with GuixSD already? -- Ricardo From debbugs-submit-bounces@debbugs.gnu.org Sun Dec 09 06:48:09 2018 Received: (at 33676) by debbugs.gnu.org; 9 Dec 2018 11:48:09 +0000 Received: from localhost ([127.0.0.1]:39261 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVxZB-0002Rn-65 for submit@debbugs.gnu.org; Sun, 09 Dec 2018 06:48:09 -0500 Received: from dd26836.kasserver.com ([85.13.145.193]:42962) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gVxZ9-0002Re-7C for 33676@debbugs.gnu.org; Sun, 09 Dec 2018 06:48:07 -0500 Received: from localhost (178.113.145.90.wireless.dyn.drei.com [178.113.145.90]) by dd26836.kasserver.com (Postfix) with ESMTPSA id 523AF336013F; Sun, 9 Dec 2018 12:48:05 +0100 (CET) Date: Sun, 9 Dec 2018 12:48:00 +0100 From: Danny Milosavljevic To: Mark H Weaver Subject: Re: GuixSD on eoma68-a20? Message-ID: <20181209124800.495326cd@scratchpost.org> In-Reply-To: <87pnubn386.fsf@netris.org> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <87pnubn386.fsf@netris.org> X-Mailer: Claws Mail 3.17.1 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; boundary="Sig_/rK=cIOsxKZ1E6XU+fddxwRS"; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: swedebugia@riseup.net, guix-devel@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Sig_/rK=cIOsxKZ1E6XU+fddxwRS Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable After the change, I get the following on Hydra : --------------------------------------------------------------------------- @ build-started /gnu/store/scnqgfc3k4434h3gch22hnh0z8qdbvdb-disk-image.drv = - x86_64-linux /var/log/guix/drvs/sc//nqgfc3k4434h3gch22hnh0z8qdbvdb-disk-i= mage.drv.bz2 environment variable `PATH' set to `/gnu/store/5ka9gmcwcj2919q0cj0wkjng058l= wrgq-qemu-minimal-3.0.0/bin:/gnu/store/5s2nib1lrd2101bbrivcl17kjx1mspw6-cor= eutils-8.30/bin' creating raw image of 1024.00 MiB... Formatting '/gnu/store/4yp6s4jlq2frb2jqzd7q3kp99vzmnpm5-disk-image', fmt=3D= raw size=3D1073741824 Could not access KVM kernel module: Permission denied qemu-system-x86_64: failed to initialize KVM: Permission denied Backtrace: 2 (primitive-load "/gnu/store/c2phacd8p7x3g8ysnzrx09jmnxp?") In ./gnu/build/vm.scm: 152:2 1 (load-in-linux-vm _ #:output _ #:qemu _ #:memory-size _ ?) In ./guix/build/utils.scm: 616:6 0 (invoke _ . _) ./guix/build/utils.scm:616:6: In procedure invoke: Throw to key `srfi-34' with args `(#)'. builder for `/gnu/store/scnqgfc3k4434h3gch22hnh0z8qdbvdb-disk-image.drv' fa= iled with exit code 1 @ build-failed /gnu/store/scnqgfc3k4434h3gch22hnh0z8qdbvdb-disk-image.drv -= 1 builder for `/gnu/store/scnqgfc3k4434h3gch22hnh0z8qdbvdb-disk-image.drv'= failed with exit code 1 --------------------------------------------------------------------------- What does it mean? --Sig_/rK=cIOsxKZ1E6XU+fddxwRS Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEds7GsXJ0tGXALbPZ5xo1VCwwuqUFAlwNAPAACgkQ5xo1VCww uqVECQgAkzJ+s5NP4fcSC0h8WXKBJbFNEvAOrzs+eBknhrhAgkZ89u/k6OxMu15S urJqfvgyPYJj4Z8ZEjuxTh5kGOPgnV4oNaFgUF4O8MBS6OTsAGk0/Qby5YWPdY5X nVp+ZWkjmbUdstYoWKtBD3j6bqG1htEJL82X7BCod5WQ4ObvQicyPKYmOLXNoP+L dTNIpvLBY7J9AjOrCgZiO2NF+Qz3ndhNkKfP79cPOpQE4LqlVHTD05vLpRebwRdZ RzB3InI7RlempNtpuYAEG9CxXCj42TDLNmvTkwp0cIjoGFsF6rBWJ3i6oTWh42zx sHJhFLMRUCLm5h2j9Xgyej1u4VYdzw== =YRbv -----END PGP SIGNATURE----- --Sig_/rK=cIOsxKZ1E6XU+fddxwRS-- From debbugs-submit-bounces@debbugs.gnu.org Sun Dec 09 16:33:04 2018 Received: (at 33676) by debbugs.gnu.org; 9 Dec 2018 21:33:04 +0000 Received: from localhost ([127.0.0.1]:40293 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gW6hE-00061v-CX for submit@debbugs.gnu.org; Sun, 09 Dec 2018 16:33:04 -0500 Received: from world.peace.net ([64.112.178.59]:37682) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gW6hC-00061P-9L for 33676@debbugs.gnu.org; Sun, 09 Dec 2018 16:33:02 -0500 Received: from mhw by world.peace.net with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.89) (envelope-from ) id 1gW6h5-00087o-Uj; Sun, 09 Dec 2018 16:32:56 -0500 From: Mark H Weaver To: Danny Milosavljevic Subject: Re: GuixSD on eoma68-a20? References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <87pnubn386.fsf@netris.org> <20181209124800.495326cd@scratchpost.org> Date: Sun, 09 Dec 2018 16:32:00 -0500 In-Reply-To: <20181209124800.495326cd@scratchpost.org> (Danny Milosavljevic's message of "Sun, 9 Dec 2018 12:48:00 +0100") Message-ID: <87in0275ec.fsf@netris.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, ludo@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hi Danny and Ludovic, Danny Milosavljevic writes: > After the change, I get the following on Hydra : > > --------------------------------------------------------------------------- > @ build-started /gnu/store/scnqgfc3k4434h3gch22hnh0z8qdbvdb-disk-image.drv - x86_64-linux /var/log/guix/drvs/sc//nqgfc3k4434h3gch22hnh0z8qdbvdb-disk-image.drv.bz2 > environment variable `PATH' set to `/gnu/store/5ka9gmcwcj2919q0cj0wkjng058lwrgq-qemu-minimal-3.0.0/bin:/gnu/store/5s2nib1lrd2101bbrivcl17kjx1mspw6-coreutils-8.30/bin' > creating raw image of 1024.00 MiB... > Formatting '/gnu/store/4yp6s4jlq2frb2jqzd7q3kp99vzmnpm5-disk-image', fmt=raw size=1073741824 > Could not access KVM kernel module: Permission denied > qemu-system-x86_64: failed to initialize KVM: Permission denied This indicates that /dev/kvm on hydra.gnunet.org has permissions that prevent the guix build user from accessing it. I raised this issue long ago (2015) on the guix-sysadmin mailing list. In that message, I noted that on hydra.gnunet.org, /dev/kvm has mode 0600 and is owned by root, which caused our disk image derivations to fail. At the time, Ludovic chmod'd /dev/kvm, and mentioned that he had tried to make this persistent via /etc/udev/rules.d/70-persistent-net.rules, but that for some reason that didn't seem to work, possibly because it was being overridden by another rule or startup script. As far as I know, we never implemented a proper fix. Ludovic, for now, can you chmod it again? Thanks, Mark From debbugs-submit-bounces@debbugs.gnu.org Sun Dec 09 16:51:35 2018 Received: (at 33676) by debbugs.gnu.org; 9 Dec 2018 21:51:35 +0000 Received: from localhost ([127.0.0.1]:40307 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gW6z9-0006ZT-DR for submit@debbugs.gnu.org; Sun, 09 Dec 2018 16:51:35 -0500 Received: from hera.aquilenet.fr ([185.233.100.1]:58672) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gW6z4-0006ZF-FJ for 33676@debbugs.gnu.org; Sun, 09 Dec 2018 16:51:32 -0500 Received: from localhost (localhost [127.0.0.1]) by hera.aquilenet.fr (Postfix) with ESMTP id D94E82C74; Sun, 9 Dec 2018 22:51:28 +0100 (CET) X-Virus-Scanned: Debian amavisd-new at aquilenet.fr Received: from hera.aquilenet.fr ([127.0.0.1]) by localhost (hera.aquilenet.fr [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id vUnFXpOgwu21; Sun, 9 Dec 2018 22:51:28 +0100 (CET) Received: from jurong (unknown [IPv6:2001:910:103f::c1e]) by hera.aquilenet.fr (Postfix) with ESMTPSA id 0F6FF2BE7; Sun, 9 Dec 2018 22:51:27 +0100 (CET) Date: Sun, 9 Dec 2018 22:51:26 +0100 From: Andreas Enge To: Danny Milosavljevic Subject: Re: bug#33676: GuixSD on eoma68-a20? Message-ID: <20181209215126.GA10968@jurong> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <20181208181214.2308472a@scratchpost.org> User-Agent: Mutt/1.11.0 (2018-11-25) X-Spam-Score: 0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: swedebugia , guix-devel@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.3 (/) Hello Danny, On Sat, Dec 08, 2018 at 06:12:14PM +0100, Danny Milosavljevic wrote: > Guix received one but we have so far be unable to get the GuixSD flash > image because something always breaks on Hydra before it's done although the problem seems to lie somewhere else, I would just like to point out that you can use your account on bayfront to build things for arm as well - it offloads to the redhill machine. Notice, however, that this is a single machine building everything from source without using the hydra or berlin build farms for substitutes. I can also give you a direct login on redhill if you need it. Andreas From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 05:30:31 2018 Received: (at 33676) by debbugs.gnu.org; 10 Dec 2018 10:30:31 +0000 Received: from localhost ([127.0.0.1]:40753 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWIpa-0003FA-Ve for submit@debbugs.gnu.org; Mon, 10 Dec 2018 05:30:31 -0500 Received: from dd26836.kasserver.com ([85.13.145.193]:35784) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWIpa-0003DZ-5V for 33676@debbugs.gnu.org; Mon, 10 Dec 2018 05:30:30 -0500 Received: from localhost (178.113.145.90.wireless.dyn.drei.com [178.113.145.90]) by dd26836.kasserver.com (Postfix) with ESMTPSA id 114433366AD8; Mon, 10 Dec 2018 11:30:27 +0100 (CET) Date: Mon, 10 Dec 2018 11:30:14 +0100 From: Danny Milosavljevic To: Andreas Enge Subject: Re: bug#33676: GuixSD on eoma68-a20? Message-ID: <20181210113014.0e4e76eb@scratchpost.org> In-Reply-To: <20181209215126.GA10968@jurong> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> X-Mailer: Claws Mail 3.17.1 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; boundary="Sig_/LDmsgGrKrBVQY2ZD=ghK1CI"; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: swedebugia , guix-devel@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Sig_/LDmsgGrKrBVQY2ZD=ghK1CI Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable Hi Andreas, I've tried it now and I get: dannym@bayfront ~/src/guix$ ./pre-inst-env guix system disk-image --system= =3Darmhf-linux gnu/system/install.scm ... importing file or directory '/gnu/store/3qrkj5zqmhnkr953xznmy96fq8i55ia5-gl= ibc-b ootstrap-0'... found valid signature for '/gnu/store/3qrkj5zqmhnkr953xznmy96fq8i55ia5-glib= c-boo tstrap-0' guix offload: error: link: No space left on device cannot build derivation `/gnu/store/mdc6h56cg0a8i09rh0zbw5kgipwlnvln-binuti= ls-cr oss-boot0-2.31.1.drv': 1 dependencies couldn't be built --Sig_/LDmsgGrKrBVQY2ZD=ghK1CI Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEds7GsXJ0tGXALbPZ5xo1VCwwuqUFAlwOQDYACgkQ5xo1VCww uqVCyAgAhAvfQmCWdQKxCx98aFhr8vH2u1g/Fs51USCkFaNSEFNuC8pTsV99JkZ+ LhsJU0AiIiTRl/0ojey8e9ZOOHpos5eEg5KmePQxFqNWu+0CiMjwAhP8JqqdWmnP rlwzmvdTCSzc8Az14cy8e/3e+j54PHPVCwVmj5mmYDKN7t+mocSilZX+RoC9p94O aqpBVlzNP5rgEQVC97z9bWcbNoz8eUi98u7BTMDoWGIo3lKw2EJrrgHshGd1bcyU uWUMoT8LoiJg23EI6ZpqDtXDgf2ySm0xdMz/8liGC5wDLCBvdSGL4K4MrzsDbstu IZFnRkA0fZfndj4GyBtmW5bk/Zbn2Q== =GEeE -----END PGP SIGNATURE----- --Sig_/LDmsgGrKrBVQY2ZD=ghK1CI-- From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 16:12:29 2018 Received: (at 33676) by debbugs.gnu.org; 10 Dec 2018 21:12:29 +0000 Received: from localhost ([127.0.0.1]:42198 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWSqr-00088Y-EM for submit@debbugs.gnu.org; Mon, 10 Dec 2018 16:12:29 -0500 Received: from hera.aquilenet.fr ([185.233.100.1]:43494) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWSqp-00088Q-Us for 33676@debbugs.gnu.org; Mon, 10 Dec 2018 16:12:28 -0500 Received: from localhost (localhost [127.0.0.1]) by hera.aquilenet.fr (Postfix) with ESMTP id 1705A41DB; Mon, 10 Dec 2018 22:12:27 +0100 (CET) X-Virus-Scanned: Debian amavisd-new at aquilenet.fr Received: from hera.aquilenet.fr ([127.0.0.1]) by localhost (hera.aquilenet.fr [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id tTSbm8eqm1eN; Mon, 10 Dec 2018 22:12:26 +0100 (CET) Received: from jurong (unknown [IPv6:2001:910:103f::c1e]) by hera.aquilenet.fr (Postfix) with ESMTPSA id 2FF5141D5; Mon, 10 Dec 2018 22:12:26 +0100 (CET) Date: Mon, 10 Dec 2018 22:12:24 +0100 From: Andreas Enge To: Danny Milosavljevic Subject: Re: bug#33676: GuixSD on eoma68-a20? Message-ID: <20181210211224.GA7317@jurong> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> <20181210113014.0e4e76eb@scratchpost.org> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <20181210113014.0e4e76eb@scratchpost.org> User-Agent: Mutt/1.11.0 (2018-11-25) X-Spam-Score: 0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: swedebugia , guix-devel@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.3 (/) Hello Danny, On Mon, Dec 10, 2018 at 11:30:14AM +0100, Danny Milosavljevic wrote: > I've tried it now and I get: > dannym@bayfront ~/src/guix$ ./pre-inst-env guix system disk-image --system=armhf-linux gnu/system/install.scm > ... > importing file or directory '/gnu/store/3qrkj5zqmhnkr953xznmy96fq8i55ia5-glibc-b > ootstrap-0'... > found valid signature for '/gnu/store/3qrkj5zqmhnkr953xznmy96fq8i55ia5-glibc-boo > tstrap-0' > guix offload: error: link: No space left on device this is the mysterious error message we have seen before: There is still plenty of space on all the machines! I think it was related to an ext4 limitation on the number of files, or the number of files inside a single directory. I ran some garbage collection on bayfront, and it can now offload and retrieve builds again. Please give it another try! Andreas From debbugs-submit-bounces@debbugs.gnu.org Mon Dec 10 21:16:55 2018 Received: (at 33676) by debbugs.gnu.org; 11 Dec 2018 02:16:55 +0000 Received: from localhost ([127.0.0.1]:42556 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWXbQ-0003Bb-JJ for submit@debbugs.gnu.org; Mon, 10 Dec 2018 21:16:53 -0500 Received: from lkcl.net ([217.147.94.29]:42423) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWXQT-0002pN-D4 for 33676@debbugs.gnu.org; Mon, 10 Dec 2018 21:05:33 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=lkcl.net; s=201607131; h=Content-Type:To:Subject:Message-ID:Date:From:MIME-Version; bh=QFEceUDba6B6Ky3YvfHi9CxRvgmwJgDv0v/h5UrUN/U=; b=SySmf4QDhumVSJiGTT9gXJMUqlRlOKhqS2akDHFIip7PlliYWfT3sY1ZkeU/46bQqOLaQc7mLKxg9Rd2vFe+z8PJ4gz5kpQ1jW9kqWT/KjNgCu4+tOmzRWbq9daC/OuXT6Ew1YqSe7bi+iSboUTfn1SidijOlLKVHSbyOZW8m3k=; Received: from mail-lj1-f169.google.com ([209.85.208.169]) by lkcl.net with esmtpsa (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.84_2) (envelope-from ) id 1gWXQS-0004XN-9Z for 33676@debbugs.gnu.org; Tue, 11 Dec 2018 02:05:32 +0000 Received: by mail-lj1-f169.google.com with SMTP id k19-v6so11463911lji.11 for <33676@debbugs.gnu.org>; Mon, 10 Dec 2018 18:05:17 -0800 (PST) X-Gm-Message-State: AA+aEWYqKVm5nWfXVKcTJ2k6ETRsTxECBXBLhwocVdVxkwCUHI1/szcz WnP64VfDVW2TT+WLQRWOWWuCVU5IiQU0GlEO2HQ= X-Google-Smtp-Source: AFSGD/Uc/HhBMxYw9UgOlgGznB0TJSVny4eLnqM0JZmXNS/Zr1L6wEuP/4WStpOK5Yo5fT1CHRwuFjHooAG2YUHQNN4= X-Received: by 2002:a2e:85d3:: with SMTP id h19-v6mr8262886ljj.82.1544493911563; Mon, 10 Dec 2018 18:05:11 -0800 (PST) MIME-Version: 1.0 From: Luke Kenneth Casson Leighton Date: Tue, 11 Dec 2018 02:04:59 +0000 X-Gmail-Original-Message-ID: Message-ID: Subject: GuixSD on eoma68-a20? To: 33676@debbugs.gnu.org Content-Type: text/plain; charset="UTF-8" X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 33676 X-Mailman-Approved-At: Mon, 10 Dec 2018 21:16:51 -0500 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) hi folks, good to see there's progress on this. do make sure to use a UHC Class 10 micro-sd card (the ones that say they are 75-80mbytes/sec), they will happily run at 20-25mbytes/sec read/write speed, which is about the same speed as an SSD from around 2012. you should get a boot to xfce4 or lxde of around 20-25 seconds: again, comparable with a budget processor from around 5-8 years ago (which is what this is). for god's sake don't peddle gnome3 or kde4 at end-users. the performance will be absolutely atrocious, absolutely guaranteed. yes, the idea is to upgrade (and sell or repurpose the old one). this is the *first* in the series. for building can i recommend using "-Wl,--no-keep-memory" and report if it helps, here: https://sourceware.org/bugzilla/show_bug.cgi?id=22831 there is a slow-boil linker problem which is similar to the "640k should be enough for anybody" - all of the quotes historic quotes techniques which used to be implemented to make it possible to link programs where there is not enough virtual or physical memory have been ripped out because "4GB should be enough for anybody". firefox now requires a staggering SEVEN GIGABYTES to successfully link. this is insane. please do try that linker option because otherwise people will believe that 32-bit hardware needs to be destroyed, due to it being utterly useless. l. From debbugs-submit-bounces@debbugs.gnu.org Tue Dec 11 03:14:05 2018 Received: (at 33676) by debbugs.gnu.org; 11 Dec 2018 08:14:05 +0000 Received: from localhost ([127.0.0.1]:42743 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWdB5-0000gd-5v for submit@debbugs.gnu.org; Tue, 11 Dec 2018 03:14:03 -0500 Received: from flashner.co.il ([178.62.234.194]:42548) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWdB2-0000fo-Vg for 33676@debbugs.gnu.org; Tue, 11 Dec 2018 03:14:01 -0500 Received: from localhost (unknown [5.102.239.133]) by flashner.co.il (Postfix) with ESMTPSA id 34CB040119; Tue, 11 Dec 2018 08:13:55 +0000 (UTC) Date: Tue, 11 Dec 2018 10:13:53 +0200 From: Efraim Flashner To: Mark H Weaver Subject: Re: bug#33676: GuixSD on eoma68-a20? Message-ID: <20181211081353.GD1323@macbook41> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <87pnubn386.fsf@netris.org> <20181209124800.495326cd@scratchpost.org> <87in0275ec.fsf@netris.org> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="G6nVm6DDWH/FONJq" Content-Disposition: inline In-Reply-To: <87in0275ec.fsf@netris.org> User-Agent: Mutt/1.11.0 (2018-11-25) X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, Danny Milosavljevic , 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --G6nVm6DDWH/FONJq Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Sun, Dec 09, 2018 at 04:32:00PM -0500, Mark H Weaver wrote: > Hi Danny and Ludovic, >=20 > Danny Milosavljevic writes: >=20 > > After the change, I get the following on Hydra : > > > > -----------------------------------------------------------------------= ---- > > @ build-started /gnu/store/scnqgfc3k4434h3gch22hnh0z8qdbvdb-disk-image.= drv - x86_64-linux /var/log/guix/drvs/sc//nqgfc3k4434h3gch22hnh0z8qdbvdb-di= sk-image.drv.bz2 > > environment variable `PATH' set to `/gnu/store/5ka9gmcwcj2919q0cj0wkjng= 058lwrgq-qemu-minimal-3.0.0/bin:/gnu/store/5s2nib1lrd2101bbrivcl17kjx1mspw6= -coreutils-8.30/bin' > > creating raw image of 1024.00 MiB... > > Formatting '/gnu/store/4yp6s4jlq2frb2jqzd7q3kp99vzmnpm5-disk-image', fm= t=3Draw size=3D1073741824 > > Could not access KVM kernel module: Permission denied > > qemu-system-x86_64: failed to initialize KVM: Permission denied >=20 > This indicates that /dev/kvm on hydra.gnunet.org has permissions that > prevent the guix build user from accessing it. >=20 > I raised this issue long ago (2015) on the guix-sysadmin mailing list. > In that message, I noted that on hydra.gnunet.org, /dev/kvm has mode > 0600 and is owned by root, which caused our disk image derivations to > fail. >=20 > At the time, Ludovic chmod'd /dev/kvm, and mentioned that he had tried > to make this persistent via /etc/udev/rules.d/70-persistent-net.rules, > but that for some reason that didn't seem to work, possibly because it > was being overridden by another rule or startup script. As far as I > know, we never implemented a proper fix. >=20 > Ludovic, for now, can you chmod it again? >=20 > Thanks, > Mark time for a crontab hack job? --=20 Efraim Flashner =D7=90=D7=A4=D7=A8=D7=99=D7=9D = =D7=A4=D7=9C=D7=A9=D7=A0=D7=A8 GPG key =3D A28B F40C 3E55 1372 662D 14F7 41AA E7DC CA3D 8351 Confidentiality cannot be guaranteed on emails sent or received unencrypted --G6nVm6DDWH/FONJq Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEoov0DD5VE3JmLRT3Qarn3Mo9g1EFAlwPcbwACgkQQarn3Mo9 g1Ho5g//Zq6+no9PJnn7T3LHsrQPqouJ/dQDi8H9EH2qjdeDPXusPOsPlp1uENM0 67UFm/iD2qGMyeeVxZesWi9K9xGQ8v6MTf0IJ0iRy3jkreUhqXyOjJx3cvOJdXFU qVOUUGN0qss8HfJqbZr1Z/yh4GhDrdEFCaSCQ5fawFwkOURIXN1U0qRmTTxqCoM9 AUba5+DM0lW5oF8CSKIVouSlxoKkE3T9c8boffyQvWoYIeBjj53uxt9laF8RtEza QriEN7cViExX7GHPKneK/I/vwOyFIbNMnBeB9o4TmMdQtws+8NXptA/oMmuuos4z 0ksOLOxT3Q63yEiXUiDosaZzkl+HylfO9EimEgCDZ7R7F8AAJ9kCLCOK+Q7d2Lbv alf/zuGFJG9ttiujNZUFv4FM/qdRzqbK3Y6gXqxhBcW0+WDyDWI+Jm8XvPsKbWma OBVZewUGnEFvgPqopEg5Ej5+c/m8I9TtxGWeIlrCiREmE+EOcpcrMoaTrtmTlG5q PedVYVjRIpN5wgosJNqKGs+e07fwoZ9SjRnjohyXoFG/1u9uX+GG54qFJtwkpzHp FDx1s4Ia8WHn0/bdelxPTdytyIjW8+JvzHhZYVTVsMbqGuWlO6gJ1gl9AIO6eJmv yPjbuomrSL4urq+c4fBQbEriG1hw2mnmcDjxN9IbsPBVE3fjIsk= =O4JZ -----END PGP SIGNATURE----- --G6nVm6DDWH/FONJq-- From debbugs-submit-bounces@debbugs.gnu.org Tue Dec 11 12:34:34 2018 Received: (at 33676) by debbugs.gnu.org; 11 Dec 2018 17:34:35 +0000 Received: from localhost ([127.0.0.1]:44152 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWlvW-0001Wu-JN for submit@debbugs.gnu.org; Tue, 11 Dec 2018 12:34:34 -0500 Received: from eggs.gnu.org ([208.118.235.92]:51262) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWlvU-0001Wi-Ii for 33676@debbugs.gnu.org; Tue, 11 Dec 2018 12:34:32 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gWlvJ-0006rg-K9 for 33676@debbugs.gnu.org; Tue, 11 Dec 2018 12:34:25 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00 autolearn=disabled version=3.3.2 Received: from fencepost.gnu.org ([2001:4830:134:3::e]:41027) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1gWlvB-0006oa-Pa; Tue, 11 Dec 2018 12:34:16 -0500 Received: from [2a00:8c40:243:232:c715:68dd:7cd5:702b] (port=56758 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1gWlvB-0006h4-GF; Tue, 11 Dec 2018 12:34:13 -0500 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Mark H Weaver Subject: Re: GuixSD on eoma68-a20? References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <87pnubn386.fsf@netris.org> <20181209124800.495326cd@scratchpost.org> <87in0275ec.fsf@netris.org> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 21 Frimaire an 227 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Tue, 11 Dec 2018 18:34:11 +0100 In-Reply-To: <87in0275ec.fsf@netris.org> (Mark H. Weaver's message of "Sun, 09 Dec 2018 16:32:00 -0500") Message-ID: <87va40x90s.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Received-From: 2001:4830:134:3::e X-Spam-Score: -5.0 (-----) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, Danny Milosavljevic , 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -6.0 (------) Hi Mark, Mark H Weaver skribis: > Danny Milosavljevic writes: > >> After the change, I get the following on Hydra : >> >> ------------------------------------------------------------------------= --- >> @ build-started /gnu/store/scnqgfc3k4434h3gch22hnh0z8qdbvdb-disk-image.d= rv - x86_64-linux /var/log/guix/drvs/sc//nqgfc3k4434h3gch22hnh0z8qdbvdb-dis= k-image.drv.bz2 >> environment variable `PATH' set to `/gnu/store/5ka9gmcwcj2919q0cj0wkjng0= 58lwrgq-qemu-minimal-3.0.0/bin:/gnu/store/5s2nib1lrd2101bbrivcl17kjx1mspw6-= coreutils-8.30/bin' >> creating raw image of 1024.00 MiB... >> Formatting '/gnu/store/4yp6s4jlq2frb2jqzd7q3kp99vzmnpm5-disk-image', fmt= =3Draw size=3D1073741824 >> Could not access KVM kernel module: Permission denied >> qemu-system-x86_64: failed to initialize KVM: Permission denied > > This indicates that /dev/kvm on hydra.gnunet.org has permissions that > prevent the guix build user from accessing it. > > I raised this issue long ago (2015) on the guix-sysadmin mailing list. > In that message, I noted that on hydra.gnunet.org, /dev/kvm has mode > 0600 and is owned by root, which caused our disk image derivations to > fail. > > At the time, Ludovic chmod'd /dev/kvm, and mentioned that he had tried > to make this persistent via /etc/udev/rules.d/70-persistent-net.rules, > but that for some reason that didn't seem to work, possibly because it > was being overridden by another rule or startup script. As far as I > know, we never implemented a proper fix. > > Ludovic, for now, can you chmod it again? I did that again this morning. Apparently there was a typo in the udev rules I had written: =E2=80=9C=3D= =E2=80=9D instead of =E2=80=9C=3D=3D=E2=80=9D=E2=80=A6 Should be better now on the next rebo= ot. Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Wed Dec 12 03:12:21 2018 Received: (at 33676) by debbugs.gnu.org; 12 Dec 2018 08:12:22 +0000 Received: from localhost ([127.0.0.1]:44472 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWzcz-0003nO-La for submit@debbugs.gnu.org; Wed, 12 Dec 2018 03:12:21 -0500 Received: from dd26836.kasserver.com ([85.13.145.193]:60096) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gWzcx-0003nD-IR for 33676@debbugs.gnu.org; Wed, 12 Dec 2018 03:12:20 -0500 Received: from localhost (178.113.244.8.wireless.dyn.drei.com [178.113.244.8]) by dd26836.kasserver.com (Postfix) with ESMTPSA id D3C5C3366B2A; Wed, 12 Dec 2018 09:12:17 +0100 (CET) Date: Wed, 12 Dec 2018 09:12:11 +0100 From: Danny Milosavljevic To: Ludovic =?ISO-8859-1?Q?Court=E8s?= Subject: Re: GuixSD on eoma68-a20? Message-ID: <20181212091211.78d2e86d@scratchpost.org> In-Reply-To: <87va40x90s.fsf@gnu.org> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <87pnubn386.fsf@netris.org> <20181209124800.495326cd@scratchpost.org> <87in0275ec.fsf@netris.org> <87va40x90s.fsf@gnu.org> X-Mailer: Claws Mail 3.17.1 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; boundary="Sig_/eF5JSSZhK6awZnJOB=UT1Dv"; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, Mark H Weaver , 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Sig_/eF5JSSZhK6awZnJOB=UT1Dv Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable Yessss! flash-image just successfully built on Hydra. Can I have the resulting file please? See https://hydra.gnu.org/build/3255541/log/raw --Sig_/eF5JSSZhK6awZnJOB=UT1Dv Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEds7GsXJ0tGXALbPZ5xo1VCwwuqUFAlwQwtsACgkQ5xo1VCww uqWa2Af+Ll1C6Tvlt3cvDyWgu2jH4D8TsLLmuN512l0TP5Db+6V5zLCNv0m+u8LX T3UzdO5bUO30snf1JPNia/DQg5hXPYwCdLozPc84/z5JdE68q1Xm1fRBaBj90vpN mMSG49fa3J15BkPTcFAkFV8XG0c/xeF7sUfX9973/8SEl99+cGkdqTanMgXK0Mi4 ZtxjJKCuFav2WdaQ2Zgrve3BPv4Q2XXe8hAZEymve5FSV/6vrcJtLkDbHONKW7m9 fWN4aHR9nSzTZevcvkvu1w7j7a6P8XOHp3tfJ4rqfmMhUq4DeuMZLghrT8sLvneG B5/JGRmdY/gb4wGuDEN5g7m5H0BERQ== =nhHn -----END PGP SIGNATURE----- --Sig_/eF5JSSZhK6awZnJOB=UT1Dv-- From debbugs-submit-bounces@debbugs.gnu.org Fri Dec 14 05:49:07 2018 Received: (at 33676) by debbugs.gnu.org; 14 Dec 2018 10:49:07 +0000 Received: from localhost ([127.0.0.1]:47365 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gXl1n-0000X5-1x for submit@debbugs.gnu.org; Fri, 14 Dec 2018 05:49:07 -0500 Received: from eggs.gnu.org ([208.118.235.92]:55929) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gXl1j-0000Wa-L1 for 33676@debbugs.gnu.org; Fri, 14 Dec 2018 05:49:05 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gXl1c-00013E-AB for 33676@debbugs.gnu.org; Fri, 14 Dec 2018 05:48:58 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00 autolearn=disabled version=3.3.2 Received: from fencepost.gnu.org ([2001:4830:134:3::e]:60521) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1gXl1c-000133-5l; Fri, 14 Dec 2018 05:48:56 -0500 Received: from [2a01:e0a:1d:7270:af76:b9b:ca24:c465] (port=39702 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1gXl1a-0000WW-RU; Fri, 14 Dec 2018 05:48:55 -0500 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Danny Milosavljevic Subject: Re: GuixSD on eoma68-a20? References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <87pnubn386.fsf@netris.org> <20181209124800.495326cd@scratchpost.org> <87in0275ec.fsf@netris.org> <87va40x90s.fsf@gnu.org> <20181212091211.78d2e86d@scratchpost.org> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 24 Frimaire an 227 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Fri, 14 Dec 2018 11:48:52 +0100 In-Reply-To: <20181212091211.78d2e86d@scratchpost.org> (Danny Milosavljevic's message of "Wed, 12 Dec 2018 09:12:11 +0100") Message-ID: <87efak5qp7.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Received-From: 2001:4830:134:3::e X-Spam-Score: -5.0 (-----) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, Mark H Weaver , 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -6.0 (------) Hello! Danny Milosavljevic skribis: > Yessss! > > flash-image just successfully built on Hydra. > > Can I have the resulting file please? > > See https://hydra.gnu.org/build/3255541/log/raw I believe you can download it by running: guix build /gnu/store/ywrh286iqc3jlfhjqsvs22gmcr02i2bp-disk-image.drv If you don=E2=80=99t have this .drv, you should be able to build it from co= mmit cba7ddcf603455c6692eb50c8bbf203a6bf17ab1. See all the details at . Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Fri Dec 14 06:09:20 2018 Received: (at 33676) by debbugs.gnu.org; 14 Dec 2018 11:09:20 +0000 Received: from localhost ([127.0.0.1]:47386 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gXlLL-00014V-Qn for submit@debbugs.gnu.org; Fri, 14 Dec 2018 06:09:20 -0500 Received: from eggs.gnu.org ([208.118.235.92]:34774) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gXlLJ-00014D-Uh for 33676@debbugs.gnu.org; Fri, 14 Dec 2018 06:09:18 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gXlLE-0004Of-02 for 33676@debbugs.gnu.org; Fri, 14 Dec 2018 06:09:12 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00 autolearn=disabled version=3.3.2 Received: from fencepost.gnu.org ([2001:4830:134:3::e]:33753) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1gXlLB-0004Nn-Lm; Fri, 14 Dec 2018 06:09:09 -0500 Received: from [2a01:e0a:1d:7270:af76:b9b:ca24:c465] (port=40320 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1gXlL7-0007KD-JM; Fri, 14 Dec 2018 06:09:06 -0500 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Danny Milosavljevic Subject: ENOSPC upon offloading In-Reply-To: <20181210113014.0e4e76eb@scratchpost.org> (Danny Milosavljevic's message of "Mon, 10 Dec 2018 11:30:14 +0100") References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> <20181210113014.0e4e76eb@scratchpost.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 24 Frimaire an 227 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Fri, 14 Dec 2018 12:09:04 +0100 Message-ID: <87h8fg4b73.fsf_-_@gnu.org> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Received-From: 2001:4830:134:3::e X-Spam-Score: -5.0 (-----) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, Andreas Enge , 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -6.0 (------) Hello, Danny Milosavljevic skribis: > I've tried it now and I get: > > dannym@bayfront ~/src/guix$ ./pre-inst-env guix system disk-image --syste= m=3Darmhf-linux gnu/system/install.scm > ... > importing file or directory '/gnu/store/3qrkj5zqmhnkr953xznmy96fq8i55ia5-= glibc-b > ootstrap-0'... > found valid signature for '/gnu/store/3qrkj5zqmhnkr953xznmy96fq8i55ia5-gl= ibc-boo > tstrap-0' > guix offload: error: link: No space left on device > cannot build derivation `/gnu/store/mdc6h56cg0a8i09rh0zbw5kgipwlnvln-binu= tils-cr > oss-boot0-2.31.1.drv': 1 dependencies couldn't be built I looked again at the code and found the issue, now fixed in adb158b7396cbdcda347fa298978408e531a03fd. We=E2=80=99ll have to update the =E2=80=98guix=E2=80=99 package and deploy = it to actually get the fix. Thanks, Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Fri Dec 14 15:50:36 2018 Received: (at 33676) by debbugs.gnu.org; 14 Dec 2018 20:50:36 +0000 Received: from localhost ([127.0.0.1]:48608 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gXuPr-0001VB-T3 for submit@debbugs.gnu.org; Fri, 14 Dec 2018 15:50:36 -0500 Received: from dd26836.kasserver.com ([85.13.145.193]:39800) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gXuPp-0001V1-Ol for 33676@debbugs.gnu.org; Fri, 14 Dec 2018 15:50:34 -0500 Received: from localhost (178.112.139.158.wireless.dyn.drei.com [178.112.139.158]) by dd26836.kasserver.com (Postfix) with ESMTPSA id 1BD75336010E; Fri, 14 Dec 2018 21:50:31 +0100 (CET) Date: Fri, 14 Dec 2018 21:50:26 +0100 From: Danny Milosavljevic To: Andreas Enge Subject: Re: bug#33676: GuixSD on eoma68-a20? Message-ID: <20181214215026.66ac1df2@scratchpost.org> In-Reply-To: <20181210211224.GA7317@jurong> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> <20181210113014.0e4e76eb@scratchpost.org> <20181210211224.GA7317@jurong> X-Mailer: Claws Mail 3.17.1 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; boundary="Sig_/G_f.0Y15ombuxPXufL.1iM2"; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: swedebugia , guix-devel@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Sig_/G_f.0Y15ombuxPXufL.1iM2 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable Hi Andreas, can you check whether dirindex (hashtables for directory) is enabled? # tune2fs -l /dev/... | grep -o dir_index See also https://blog.merovius.de/2013/10/20/ext4-mysterious-no-space-left-= on.html --Sig_/G_f.0Y15ombuxPXufL.1iM2 Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEds7GsXJ0tGXALbPZ5xo1VCwwuqUFAlwUF5IACgkQ5xo1VCww uqWi/QgAhLQz4I5takO4jjCBSVYkup2F1HcyzyqtyBu8sfF1SkilVHXv9FRKJpZP 0t7T3Bo3NP/oxVYELns8RQrEH7cR8InlrmPUGFEqhhDYDSDNT5ldMtiJ2VoPm+Y0 FYucyRoNmHaRcJ2hhadWWxx0lQUnoAscqRtcstM39r8DiGicoYDltq+mVa6Z7Nb0 9KckHtjWNypkuCzqbKouYH1fe71zOP+GnKUbKIqk9l6ocekN8W9ormTmKF5Md6Ci mihSAoTt79JuzBrdAS/fHTXRXbb1WZvtksVa577qCyD3MHjJ79o/EYxPb9cV1RLK UMVCUnEZ5Oz+wwi2uUh/106Sa6csCA== =OQig -----END PGP SIGNATURE----- --Sig_/G_f.0Y15ombuxPXufL.1iM2-- From debbugs-submit-bounces@debbugs.gnu.org Sat Dec 15 05:29:13 2018 Received: (at 33676) by debbugs.gnu.org; 15 Dec 2018 10:29:13 +0000 Received: from localhost ([127.0.0.1]:48967 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gY7C5-0006km-C9 for submit@debbugs.gnu.org; Sat, 15 Dec 2018 05:29:13 -0500 Received: from hera.aquilenet.fr ([185.233.100.1]:52496) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gY7C3-0006kd-8j for 33676@debbugs.gnu.org; Sat, 15 Dec 2018 05:29:11 -0500 Received: from localhost (localhost [127.0.0.1]) by hera.aquilenet.fr (Postfix) with ESMTP id 36E3B1A90; Sat, 15 Dec 2018 11:29:10 +0100 (CET) X-Virus-Scanned: Debian amavisd-new at aquilenet.fr Received: from hera.aquilenet.fr ([127.0.0.1]) by localhost (hera.aquilenet.fr [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id zGMp9dwF3l6V; Sat, 15 Dec 2018 11:29:09 +0100 (CET) Received: from jurong (unknown [109.190.253.15]) by hera.aquilenet.fr (Postfix) with ESMTPSA id 1B2F21818; Sat, 15 Dec 2018 11:29:08 +0100 (CET) Date: Sat, 15 Dec 2018 11:29:06 +0100 From: Andreas Enge To: Danny Milosavljevic Subject: Re: bug#33676: GuixSD on eoma68-a20? Message-ID: <20181215102906.GA4621@jurong> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> <20181210113014.0e4e76eb@scratchpost.org> <20181210211224.GA7317@jurong> <20181214215026.66ac1df2@scratchpost.org> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <20181214215026.66ac1df2@scratchpost.org> User-Agent: Mutt/1.11.0 (2018-11-25) X-Spam-Score: 0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.3 (/) On Fri, Dec 14, 2018 at 09:50:26PM +0100, Danny Milosavljevic wrote: > can you check whether dirindex (hashtables for directory) is enabled? > # tune2fs -l /dev/... | grep -o dir_index > See also https://blog.merovius.de/2013/10/20/ext4-mysterious-no-space-left-on.html It was, and I disabled it. Hopefully this does not break anything... But does this not mean a big performance hit on /gnu/store/.links? Andreas From debbugs-submit-bounces@debbugs.gnu.org Sat Dec 15 14:06:08 2018 Received: (at 33676) by debbugs.gnu.org; 15 Dec 2018 19:06:08 +0000 Received: from localhost ([127.0.0.1]:49634 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gYFGK-0007XT-CQ for submit@debbugs.gnu.org; Sat, 15 Dec 2018 14:06:08 -0500 Received: from world.peace.net ([64.112.178.59]:57214) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gYFGI-0007Wx-OX for 33676@debbugs.gnu.org; Sat, 15 Dec 2018 14:06:07 -0500 Received: from mhw by world.peace.net with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.89) (envelope-from ) id 1gYFGB-00018Y-RN; Sat, 15 Dec 2018 14:05:59 -0500 From: Mark H Weaver To: Andreas Enge Subject: Re: bug#33676: GuixSD on eoma68-a20? References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> <20181210113014.0e4e76eb@scratchpost.org> <20181210211224.GA7317@jurong> <20181214215026.66ac1df2@scratchpost.org> <20181215102906.GA4621@jurong> Date: Sat, 15 Dec 2018 14:04:58 -0500 In-Reply-To: <20181215102906.GA4621@jurong> (Andreas Enge's message of "Sat, 15 Dec 2018 11:29:06 +0100") Message-ID: <87lg4qa9vu.fsf@netris.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, Danny Milosavljevic , 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hi Andreas, Andreas Enge writes: > On Fri, Dec 14, 2018 at 09:50:26PM +0100, Danny Milosavljevic wrote: >> can you check whether dirindex (hashtables for directory) is enabled? >> # tune2fs -l /dev/... | grep -o dir_index >> See also https://blog.merovius.de/2013/10/20/ext4-mysterious-no-space-left-on.html > > It was, and I disabled it. Hopefully this does not break anything... Why did you disable it? > But does this not mean a big performance hit on /gnu/store/.links? I would expect disabling dir_index to be a big performance hit on Guix systems, and especially those with a large store, such a build farm master nodes. Mark From debbugs-submit-bounces@debbugs.gnu.org Sat Dec 15 14:19:14 2018 Received: (at 33676) by debbugs.gnu.org; 15 Dec 2018 19:19:14 +0000 Received: from localhost ([127.0.0.1]:49649 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gYFT0-0007rT-BS for submit@debbugs.gnu.org; Sat, 15 Dec 2018 14:19:14 -0500 Received: from dd26836.kasserver.com ([85.13.145.193]:32774) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gYFSy-0007rL-IY for 33676@debbugs.gnu.org; Sat, 15 Dec 2018 14:19:13 -0500 Received: from localhost (178.112.139.158.wireless.dyn.drei.com [178.112.139.158]) by dd26836.kasserver.com (Postfix) with ESMTPSA id 9C990336012B; Sat, 15 Dec 2018 20:19:10 +0100 (CET) Date: Sat, 15 Dec 2018 20:19:04 +0100 From: Danny Milosavljevic To: Andreas Enge Subject: Re: bug#33676: GuixSD on eoma68-a20? Message-ID: <20181215201904.62659d07@scratchpost.org> In-Reply-To: <20181215102906.GA4621@jurong> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> <20181210113014.0e4e76eb@scratchpost.org> <20181210211224.GA7317@jurong> <20181214215026.66ac1df2@scratchpost.org> <20181215102906.GA4621@jurong> X-Mailer: Claws Mail 3.17.1 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; boundary="Sig_/2qaKS_YJhEFpW4diPbxQZFZ"; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Sig_/2qaKS_YJhEFpW4diPbxQZFZ Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable Hi Andreas, On Sat, 15 Dec 2018 11:29:06 +0100 Andreas Enge wrote: > On Fri, Dec 14, 2018 at 09:50:26PM +0100, Danny Milosavljevic wrote: > > can you check whether dirindex (hashtables for directory) is enabled? > > # tune2fs -l /dev/... | grep -o dir_index > > See also https://blog.merovius.de/2013/10/20/ext4-mysterious-no-space-l= eft-on.html =20 >=20 > It was, and I disabled it. Hopefully this does not break anything... > But does this not mean a big performance hit on /gnu/store/.links? It does mean that because it uses a linear search to find the file names no= w. What ext filesystem is it? https://en.wikipedia.org/wiki/Ext4 says that ext4 supports B trees - which should have no problems with hash collisions (it uses operator< to construct a tree -- and not hashes to construct a list). --Sig_/2qaKS_YJhEFpW4diPbxQZFZ Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEds7GsXJ0tGXALbPZ5xo1VCwwuqUFAlwVU6gACgkQ5xo1VCww uqXPzAf+LHwmkROAgHY+KJMT7ZX2+yAuomP2qXnB5Yh+E+n25+c+R2gVWldL5yE7 6wmrQ09cgSiEZTJFIeiKiBVYnIDsJrnSFcPhqfMawkxr8SMibn0W5uCU0KcvnqPA G76lwJzkJjZAuNlrx0b0cP29dW7J7Qik7bWb1R+ozmACMcBElPyQr6QLY+DOYoEy 8Rr6OWzw/TehaZwDOxEC7gx+oFpAU2wnP21i1Op+dHGYXynPETmT/PX2dhM7Utmm A46tQQsEGhvu0/+c78SLcyrT8B5iu7ijyLHVOMV1fmgamH3QZ9OcLak10Gd3Ix6e woDhMhYgsdWWifuZYMIWu7XJUU5Jyg== =KOmW -----END PGP SIGNATURE----- --Sig_/2qaKS_YJhEFpW4diPbxQZFZ-- From debbugs-submit-bounces@debbugs.gnu.org Sat Dec 15 14:21:45 2018 Received: (at 33676) by debbugs.gnu.org; 15 Dec 2018 19:21:45 +0000 Received: from localhost ([127.0.0.1]:49653 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gYFVQ-0007vY-Sc for submit@debbugs.gnu.org; Sat, 15 Dec 2018 14:21:45 -0500 Received: from dd26836.kasserver.com ([85.13.145.193]:32954) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gYFVO-0007vP-BS for 33676@debbugs.gnu.org; Sat, 15 Dec 2018 14:21:42 -0500 Received: from localhost (178.112.139.158.wireless.dyn.drei.com [178.112.139.158]) by dd26836.kasserver.com (Postfix) with ESMTPSA id 2DF41336012B; Sat, 15 Dec 2018 20:21:41 +0100 (CET) Date: Sat, 15 Dec 2018 20:21:37 +0100 From: Danny Milosavljevic To: Ludovic =?ISO-8859-1?Q?Court=E8s?= Subject: Re: GuixSD on eoma68-a20? Message-ID: <20181215202137.4b3db598@scratchpost.org> In-Reply-To: <87efak5qp7.fsf@gnu.org> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <87pnubn386.fsf@netris.org> <20181209124800.495326cd@scratchpost.org> <87in0275ec.fsf@netris.org> <87va40x90s.fsf@gnu.org> <20181212091211.78d2e86d@scratchpost.org> <87efak5qp7.fsf@gnu.org> X-Mailer: Claws Mail 3.17.1 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; boundary="Sig_/c6dOMwqtoex4l+_mJGNnUVY"; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, Mark H Weaver , 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Sig_/c6dOMwqtoex4l+_mJGNnUVY Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Hi Ludo, On Fri, 14 Dec 2018 11:48:52 +0100 Ludovic Court=C3=A8s wrote: > I believe you can download it by running: >=20 > guix build /gnu/store/ywrh286iqc3jlfhjqsvs22gmcr02i2bp-disk-image.drv I don't have it. > If you don=E2=80=99t have this .drv, you should be able to build it from = commit > cba7ddcf603455c6692eb50c8bbf203a6bf17ab1. I tried ./pre-inst-env guix system disk-image --system=3Darmhf-linux -e '(begin (us= e-modules (gnu system) (gnu bootloader) (gnu bootloader u-boot) (gnu system= install)) (operating-system (inherit installation-os) (bootloader (bootloa= der-configuration (bootloader u-boot-bootloader) (target #f)))))' and I get: [...] The following package will be installed: guile-bootstrap 2.0 /tmp/guix-tests/store/1gd1z2r2a38bh3a4494jb= hyzcv5mi5hl-guile-bootstrap-2.0 The following derivation will be built: /tmp/guix-tests/store/dmmv0dnc8wvx9m12mln90w4b26sdxq5v-profile.drv building /tmp/guix-tests/store/dmmv0dnc8wvx9m12mln90w4b26sdxq5v-profile.drv= ... 1 package in profile The following environment variable definitions may be needed: export PATH=3D"t-profile-15269/bin${PATH:+:}$PATH" ++ guix package -A guile-bootstrap ++ cut -f 1-2 Backtrace: In guix/ui.scm: 1603:12 19 (run-guix-command _ . _) In ice-9/boot-9.scm: 829:9 18 (catch _ _ # =E2=80=A6) 829:9 17 (catch _ _ # =E2=80=A6) In guix/scripts/package.scm: 914:8 16 (_) 729:25 15 (process-query _) In guix/discovery.scm: 155:3 14 (fold-module-public-variables _ _ _) In guix/combinators.scm: 45:26 13 (fold2 # =E2=80=A6) 45:26 12 (fold2 # =E2=80=A6) In guix/discovery.scm: 158:33 11 (_ # =E2=80=A6) In guix/scripts/package.scm: 732:39 10 (_ # =E2=80=A6) In guix/packages.scm: 777:17 9 (supported-package? # =E2=80=A6) In guix/memoization.scm: 101:0 8 (_ # # =E2=80=A6) In srfi/srfi-1.scm: 466:18 7 (fold # =E2=80=A6) In guix/packages.scm: 768:33 6 (_ _ ("x86_64-linux" "i686-linux" "armhf-linux" "aar=E2=80=A6"= =E2=80=A6)) In guix/memoization.scm: 101:0 5 (_ # # =E2=80=A6) In guix/packages.scm: 980:46 1 (thunk) In gnu/packages/scheme.scm: 170:30 0 (inputs) gnu/packages/scheme.scm:170:30: In procedure inputs: Throw to key `match-error' with args `("match" "no matching pattern" "armhf= -linux")'. ++ guix package -p t-profile-15269 -I ++ cut -f 1-2 + test '' =3D 'guile-bootstrap 2.0' + rm -f t-profile-15269 t-profile-15269-1-link t-guix-package-file-15269 + rm -rf t-guix-package-15269 t-home-15269 ./test-env: line 1: 15250 Terminated "/tmp/guix-build-guix-0.1= 6.0-4.60b0402.drv-0/source/pre-inst-env" "/tmp/guix-build-guix-0.16.0-4.60b= 0402.drv-0/source/guix-daemon" --disable-chroot --substitute-urls=3D"$GUIX_= BINARY_SUBSTITUTE_URL" FAIL tests/guix-package.sh (exit status: 1) [...] /gnu/store/diwcb1v9lr156sg3q4ww1wvsniw4n6rf-module-import/guix/build/gnu-bu= ild-system.scm:369:6: In procedure check: Throw to key `srfi-34' with args `(#)'. builder for `/gnu/store/dbf84br9nxk0a6d50lsgpcjkl5r4cm1s-guix-0.16.0-4.60b0= 402.drv' failed with exit code 1 build of /gnu/store/dbf84br9nxk0a6d50lsgpcjkl5r4cm1s-guix-0.16.0-4.60b0402.= drv failed View build log at '/var/log/guix/drvs/db/f84br9nxk0a6d50lsgpcjkl5r4cm1s-gui= x-0.16.0-4.60b0402.drv.bz2'. guix system: error: build failed: build of `/gnu/store/dbf84br9nxk0a6d50lsg= pcjkl5r4cm1s-guix-0.16.0-4.60b0402.drv' failed And no image... --Sig_/c6dOMwqtoex4l+_mJGNnUVY Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEds7GsXJ0tGXALbPZ5xo1VCwwuqUFAlwVVEEACgkQ5xo1VCww uqX4ygf7BPKCZOtmCt1Zy59pCxh4dX/a8E9aZ494FKMGdMpiETLF5DP5Z0TVb/bL JJaOdU1Tos5g+4lFE8/OIUWdZhKlaf2hifuHh4D8ruAoJPuqF9hqQ0z7PxJ9uN4a Nmf/mV86svYnIkbdw1f33IYEV/sYTV6MwgT5DEY7I5AqCzLm11w+G2W1E6aY7ir3 W2NZK74y479qtv7LYYuTbOGm8AqJWP99Zik/JiEmdYF36mGszZL8AR2ZdPVM+cY0 IHDMAeyDgowJUgUeCmtwtt/CKekYy2gMpTvDV/I9KijlxcUDIvQGRdpDZgbUC+DG rq02pyIvbCWytWNwuXMupLv/AtWqcQ== =pQOL -----END PGP SIGNATURE----- --Sig_/c6dOMwqtoex4l+_mJGNnUVY-- From debbugs-submit-bounces@debbugs.gnu.org Sun Dec 16 10:08:17 2018 Received: (at 33676) by debbugs.gnu.org; 16 Dec 2018 15:08:17 +0000 Received: from localhost ([127.0.0.1]:50479 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gYY1h-0005XO-GP for submit@debbugs.gnu.org; Sun, 16 Dec 2018 10:08:17 -0500 Received: from hera.aquilenet.fr ([185.233.100.1]:41294) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gYY1f-0005XF-2i for 33676@debbugs.gnu.org; Sun, 16 Dec 2018 10:08:15 -0500 Received: from localhost (localhost [127.0.0.1]) by hera.aquilenet.fr (Postfix) with ESMTP id 1A038A96; Sun, 16 Dec 2018 16:08:14 +0100 (CET) X-Virus-Scanned: Debian amavisd-new at aquilenet.fr Received: from hera.aquilenet.fr ([127.0.0.1]) by localhost (hera.aquilenet.fr [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id jkkVdMp2BBXM; Sun, 16 Dec 2018 16:08:13 +0100 (CET) Received: from jurong (unknown [IPv6:2001:910:103f::c1e]) by hera.aquilenet.fr (Postfix) with ESMTPSA id 472A451D; Sun, 16 Dec 2018 16:08:13 +0100 (CET) Date: Sun, 16 Dec 2018 16:08:11 +0100 From: Andreas Enge To: Mark H Weaver Subject: Re: bug#33676: GuixSD on eoma68-a20? Message-ID: <20181216150811.GA8664@jurong> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> <20181210113014.0e4e76eb@scratchpost.org> <20181210211224.GA7317@jurong> <20181214215026.66ac1df2@scratchpost.org> <20181215102906.GA4621@jurong> <87lg4qa9vu.fsf@netris.org> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <87lg4qa9vu.fsf@netris.org> User-Agent: Mutt/1.11.0 (2018-11-25) X-Spam-Score: 0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, Danny Milosavljevic , 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.3 (/) On Sat, Dec 15, 2018 at 02:04:58PM -0500, Mark H Weaver wrote: > >> See also https://blog.merovius.de/2013/10/20/ext4-mysterious-no-space-left-on.html > > It was, and I disabled it. Hopefully this does not break anything... > Why did you disable it? Because we get exactly these spurious ENOSPC mentioned in the blog post on bayfront when the disk is only one third full. Now I am happy to try out any other combination of flags that solves the problem. So should I add dir_index again (is this possible live?), and then add large_dir? Andreas From debbugs-submit-bounces@debbugs.gnu.org Sun Dec 16 10:59:57 2018 Received: (at 33676) by debbugs.gnu.org; 16 Dec 2018 15:59:57 +0000 Received: from localhost ([127.0.0.1]:50517 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gYYph-0006pe-Bf for submit@debbugs.gnu.org; Sun, 16 Dec 2018 10:59:57 -0500 Received: from eggs.gnu.org ([208.118.235.92]:46889) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gYYpg-0006pT-Gl for 33676@debbugs.gnu.org; Sun, 16 Dec 2018 10:59:56 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gYYpa-0002GQ-GO for 33676@debbugs.gnu.org; Sun, 16 Dec 2018 10:59:51 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00 autolearn=disabled version=3.3.2 Received: from fencepost.gnu.org ([2001:4830:134:3::e]:41877) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1gYYpa-0002GE-CU; Sun, 16 Dec 2018 10:59:50 -0500 Received: from [2a01:e0a:1d:7270:af76:b9b:ca24:c465] (port=60944 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1gYYpa-0000tE-30; Sun, 16 Dec 2018 10:59:50 -0500 From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: Danny Milosavljevic Subject: Re: GuixSD on eoma68-a20? References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <87pnubn386.fsf@netris.org> <20181209124800.495326cd@scratchpost.org> <87in0275ec.fsf@netris.org> <87va40x90s.fsf@gnu.org> <20181212091211.78d2e86d@scratchpost.org> <87efak5qp7.fsf@gnu.org> <20181215202137.4b3db598@scratchpost.org> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 26 Frimaire an 227 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Sun, 16 Dec 2018 16:59:48 +0100 In-Reply-To: <20181215202137.4b3db598@scratchpost.org> (Danny Milosavljevic's message of "Sat, 15 Dec 2018 20:21:37 +0100") Message-ID: <877eg9tqbv.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Received-From: 2001:4830:134:3::e X-Spam-Score: -5.0 (-----) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, Mark H Weaver , 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -6.0 (------) Hi Danny, Danny Milosavljevic skribis: > On Fri, 14 Dec 2018 11:48:52 +0100 > Ludovic Court=C3=A8s wrote: > >> I believe you can download it by running: >>=20 >> guix build /gnu/store/ywrh286iqc3jlfhjqsvs22gmcr02i2bp-disk-image.drv > > I don't have it. > >> If you don=E2=80=99t have this .drv, you should be able to build it from= commit >> cba7ddcf603455c6692eb50c8bbf203a6bf17ab1. > > I tried > > ./pre-inst-env guix system disk-image --system=3Darmhf-linux -e '(begin (= use-modules (gnu system) (gnu bootloader) (gnu bootloader u-boot) (gnu syst= em install)) (operating-system (inherit installation-os) (bootloader (bootl= oader-configuration (bootloader u-boot-bootloader) (target #f)))))' > > and I get: > > [...] > The following package will be installed: > guile-bootstrap 2.0 /tmp/guix-tests/store/1gd1z2r2a38bh3a4494= jbhyzcv5mi5hl-guile-bootstrap-2.0 The solution I proposed only works if you=E2=80=99re using /gnu/store as yo= ur store prefix. Otherwise you cannot get substitutes from the build farm. :-/ > gnu/packages/scheme.scm:170:30: In procedure inputs: > Throw to key `match-error' with args `("match" "no matching pattern" "arm= hf-linux")'. This looks like the issue fixed in 966629a114fd90153784dfdbe5e332e0ac94f1bc. HTH! Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Sun Dec 16 15:14:33 2018 Received: (at 33676) by debbugs.gnu.org; 16 Dec 2018 20:14:33 +0000 Received: from localhost ([127.0.0.1]:50609 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gYco5-0004vu-Fs for submit@debbugs.gnu.org; Sun, 16 Dec 2018 15:14:33 -0500 Received: from dd26836.kasserver.com ([85.13.145.193]:33910) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gYco3-0004vh-W4 for 33676@debbugs.gnu.org; Sun, 16 Dec 2018 15:14:32 -0500 Received: from localhost (178.112.139.158.wireless.dyn.drei.com [178.112.139.158]) by dd26836.kasserver.com (Postfix) with ESMTPSA id B82B33360320; Sun, 16 Dec 2018 21:14:30 +0100 (CET) Date: Sun, 16 Dec 2018 21:14:26 +0100 From: Danny Milosavljevic To: Ludovic =?ISO-8859-1?Q?Court=E8s?= Subject: Re: GuixSD on eoma68-a20? Message-ID: <20181216211426.09be476b@scratchpost.org> In-Reply-To: <877eg9tqbv.fsf@gnu.org> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <87pnubn386.fsf@netris.org> <20181209124800.495326cd@scratchpost.org> <87in0275ec.fsf@netris.org> <87va40x90s.fsf@gnu.org> <20181212091211.78d2e86d@scratchpost.org> <87efak5qp7.fsf@gnu.org> <20181215202137.4b3db598@scratchpost.org> <877eg9tqbv.fsf@gnu.org> X-Mailer: Claws Mail 3.17.1 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; boundary="Sig_/RigC1bCteAIcA40bARip_oY"; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, Mark H Weaver , 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Sig_/RigC1bCteAIcA40bARip_oY Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Hi Ludo, > > The following package will be installed: > > guile-bootstrap 2.0 /tmp/guix-tests/store/1gd1z2r2a38bh3a44= 94jbhyzcv5mi5hl-guile-bootstrap-2.0 =20 >=20 > The solution I proposed only works if you=E2=80=99re using /gnu/store as = your > store prefix. Otherwise you cannot get substitutes from the build > farm. :-/ I do use /gnu/store , but I think the above was from a "guix" package unit = test. > > gnu/packages/scheme.scm:170:30: In procedure inputs: > > Throw to key `match-error' with args `("match" "no matching pattern" "a= rmhf-linux")'. =20 >=20 > This looks like the issue fixed in > 966629a114fd90153784dfdbe5e332e0ac94f1bc. Indeed. Now po4a fails one of the tests. It's not easy to get the image :) I'll try some more... --Sig_/RigC1bCteAIcA40bARip_oY Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEds7GsXJ0tGXALbPZ5xo1VCwwuqUFAlwWsiIACgkQ5xo1VCww uqUrPgf6A4/gGSMbkp97NtZZ1Hl5mVtHd1qrybEV1LL36R6lxCa98wPXZLbuz5Dz lgHeaq1Db8nbeXWmMA1pjDGWTK5bsKXGUtAk3xoc0Z7gOfwR5r03m+bysPBcTr9h IMvRVUpYCjAloupUq1r/PQ6xTDvPIssvkUqoctPUZdJd6+mFE2AV8gpFXDtjNlpY JUZuK9r2zkoIOzvj6ga+ICMNNQQZvlZB9wef2TpzK1xw54dGrmCpKY3lZ7aEGXLk /hMNKD50BfYyqWa0ukefOh6694Ancx8qMjMuKeDzmX2pdyZRun8mQQbaRg88qUWt hDI6+66nDnmB/ICykFoSUqCLYxj94A== =9Jqc -----END PGP SIGNATURE----- --Sig_/RigC1bCteAIcA40bARip_oY-- From debbugs-submit-bounces@debbugs.gnu.org Fri Dec 21 18:06:02 2018 Received: (at 33676) by debbugs.gnu.org; 21 Dec 2018 23:06:02 +0000 Received: from localhost ([127.0.0.1]:58963 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gaTrm-00059k-Ly for submit@debbugs.gnu.org; Fri, 21 Dec 2018 18:06:02 -0500 Received: from dd26836.kasserver.com ([85.13.145.193]:60532) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gaTrl-00059M-EB for 33676@debbugs.gnu.org; Fri, 21 Dec 2018 18:06:01 -0500 Received: from localhost (77.117.128.10.wireless.dyn.drei.com [77.117.128.10]) by dd26836.kasserver.com (Postfix) with ESMTPSA id C177A3360156; Sat, 22 Dec 2018 00:05:59 +0100 (CET) Date: Sat, 22 Dec 2018 00:05:53 +0100 From: Danny Milosavljevic To: Luke Kenneth Casson Leighton Subject: Re: bug#33676: GuixSD on eoma68-a20? Message-ID: <20181222000553.06980837@scratchpost.org> In-Reply-To: References: <20181208181214.2308472a@scratchpost.org> X-Mailer: Claws Mail 3.17.1 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; boundary="Sig_/0F/6wsHWZ9U58_IgKkz3/U9"; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Sig_/0F/6wsHWZ9U58_IgKkz3/U9 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable Hi Luke, On Tue, 11 Dec 2018 02:04:59 +0000 Luke Kenneth Casson Leighton wrote: > good to see there's progress on this. do make sure to use a UHC Class > 10 micro-sd card (the ones that say they are 75-80mbytes/sec), they > will happily run at 20-25mbytes/sec read/write speed, which is about > the same speed as an SSD from around 2012. Yes, I got such a card now, seems to write (including sync) quite quickly on my laptop at least. > yes, the idea is to upgrade (and sell or repurpose the old one). this > is the *first* in the series. I understand. > for building can i recommend using "-Wl,--no-keep-memory" and report > if it helps, here: > https://sourceware.org/bugzilla/show_bug.cgi?id=3D22831 Yeah, we've now added the linker option to several packages. It improves the situation a lot. Thanks! --Sig_/0F/6wsHWZ9U58_IgKkz3/U9 Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEds7GsXJ0tGXALbPZ5xo1VCwwuqUFAlwdcdEACgkQ5xo1VCww uqUu3wf/UuuW3PEGcVYOq7fLwansmeZXKuwK8A8z8+mGWGY86jj9Fj2HE6C/z/Zr +aRuPmeevKCG7U3k0Z9p64FHFFok93RR5Ovid+w/ATFnekT3/eWJ97eg92ek0t0D huvYkWxxvkfli5fDjqxdKbTB1nXc8f0hG1s/yKg3mEhPzWBCGVFNhPYOVpx0IDKc y8bt1BgfmEmXdM4r9wt02useExIJAH4o8okvfeJ4Zz+7acvEHpH6DgFY8NyVjFBC YL0DSIGRTw8TsHRR2kO/LWRxhZxqH33TLiuzqipJRWfsYjdIIh52JytqcKFCP2Uf umbj+ag4Gu/6WTnYuFpZ79OZeJh4JA== =l1KT -----END PGP SIGNATURE----- --Sig_/0F/6wsHWZ9U58_IgKkz3/U9-- From debbugs-submit-bounces@debbugs.gnu.org Fri Dec 21 18:10:01 2018 Received: (at 33676) by debbugs.gnu.org; 21 Dec 2018 23:10:01 +0000 Received: from localhost ([127.0.0.1]:58968 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gaTvd-0005FI-6Y for submit@debbugs.gnu.org; Fri, 21 Dec 2018 18:10:01 -0500 Received: from dd26836.kasserver.com ([85.13.145.193]:60914) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gaTvb-0005FA-Jc for 33676@debbugs.gnu.org; Fri, 21 Dec 2018 18:10:00 -0500 Received: from localhost (77.117.128.10.wireless.dyn.drei.com [77.117.128.10]) by dd26836.kasserver.com (Postfix) with ESMTPSA id 4AAA3336038A; Sat, 22 Dec 2018 00:09:58 +0100 (CET) Date: Sat, 22 Dec 2018 00:09:57 +0100 From: Danny Milosavljevic To: Andreas Enge Subject: Re: bug#33676: GuixSD on eoma68-a20? Message-ID: <20181222000957.424e2213@scratchpost.org> In-Reply-To: <20181210211224.GA7317@jurong> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> <20181210113014.0e4e76eb@scratchpost.org> <20181210211224.GA7317@jurong> X-Mailer: Claws Mail 3.17.1 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; boundary="Sig_/dmSEbwSjac71/YsXiW1oP7."; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: swedebugia , guix-devel@gnu.org, ludo@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Sig_/dmSEbwSjac71/YsXiW1oP7. Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable Now I get: $ # commit 39c676c4a3507863f4edf20b225ace4cbf646ed6 $ ./pre-inst-env guix system disk-image --system=3Darmhf-linux -e '(begin (= use-modules (gnu system) (gnu bootloader) (gnu bootloader u-boot) (gnu syst= em install)) (operating-system (inherit installation-os) (bootloader (bootl= oader-configuration (bootloader u-boot-bootloader) (target #f)))))' >QQQ3 2= >&1 [...] The following derivation will be built: /gnu/store/shgfclh6yy1a03hl0c293s89y3qm9033-disk-image.drv building /gnu/store/shgfclh6yy1a03hl0c293s89y3qm9033-disk-image.drv... environment variable `PATH' set to `/gnu/store/cm3j1pzdqhw4s9bg1drwlm3lw3qx= zddj-qemu-minimal-3.1.0/bin:/gnu/store/hb2qj35yxmvxzcq99lbfcpija032wdzh-cor= eutils-8.30/bin' creating raw image of 1265.54 MiB... Formatting '/gnu/store/9wbw2vbpgg3pwlg9xr7jbniyca0nra2q-disk-image', fmt=3D= raw size=3D1327019190 [ 0.000000] Booting Linux on physical CPU 0x0 [ 0.000000] Linux version 4.19.11-gnu (nixbld@) (gcc version 5.5.0 (GCC)= ) #1 SMP 1 [ 0.000000] CPU: ARMv7 Processor [412fc0f1] revision 1 (ARMv7), cr=3D10c= 5387d [ 0.000000] CPU: div instructions available: patching division code [ 0.000000] CPU: PIPT / VIPT nonaliasing data cache, PIPT instruction ca= che [ 0.000000] OF: fdt: Machine model: linux,dummy-virt [ 0.000000] Memory policy: Data cache writealloc [ 0.000000] efi: Getting EFI parameters from FDT: [ 0.000000] efi: UEFI not found. [ 0.000000] cma: Reserved 16 MiB at 0x4f000000 [ 0.000000] psci: probing for conduit method from DT. [ 0.000000] psci: PSCIv0.2 detected in firmware. [ 0.000000] psci: Using standard PSCI v0.2 function IDs [ 0.000000] psci: Trusted OS migration not required [ 0.000000] random: get_random_bytes called from start_kernel+0xa0/0x50c= with crng_init=3D0 [ 0.000000] percpu: Embedded 17 pages/cpu @(ptrval) s38732 r8192 d22708 = u69632 [ 0.000000] Built 1 zonelists, mobility grouping on. Total pages: 64960 [ 0.000000] Kernel command line: panic=3D1 --load=3D/gnu/store/ip9p4q62f= bgm2r2xnnh8qi5p77k2igas-linux-vm-loader console=3DttyAMA0 [ 0.000000] Dentry cache hash table entries: 32768 (order: 5, 131072 byt= es) [ 0.000000] Inode-cache hash table entries: 16384 (order: 4, 65536 bytes) [ 0.000000] Memory: 214952K/262144K available (9216K kernel code, 1133K = rwdata, 2612K rodata, 2048K init, 310K bss, 30808K reserved, 16384K cma-res= erved, 0K highmem) [ 0.000000] Virtual kernel memory layout: [ 0.000000] vector : 0xffff0000 - 0xffff1000 ( 4 kB) [ 0.000000] fixmap : 0xffc00000 - 0xfff00000 (3072 kB) [ 0.000000] vmalloc : 0xd0800000 - 0xff800000 ( 752 MB) [ 0.000000] lowmem : 0xc0000000 - 0xd0000000 ( 256 MB) [ 0.000000] pkmap : 0xbfe00000 - 0xc0000000 ( 2 MB) [ 0.000000] modules : 0xbf000000 - 0xbfe00000 ( 14 MB) [ 0.000000] .text : 0x(ptrval) - 0x(ptrval) (10208 kB) [ 0.000000] .init : 0x(ptrval) - 0x(ptrval) (2048 kB) [ 0.000000] .data : 0x(ptrval) - 0x(ptrval) (1134 kB) [ 0.000000] .bss : 0x(ptrval) - 0x(ptrval) ( 311 kB) [ 0.000000] ftrace: allocating 33359 entries in 98 pages [ 0.000000] rcu: Hierarchical RCU implementation. [ 0.000000] rcu: RCU restricting CPUs from NR_CPUS=3D8 to nr_cpu_ids= =3D1. [ 0.000000] rcu: Adjusting geometry for rcu_fanout_leaf=3D16, nr_cpu_ids= =3D1 [ 0.000000] NR_IRQS: 16, nr_irqs: 16, preallocated irqs: 16 [ 0.000000] GICv2m: range[mem 0x08020000-0x08020fff], SPI[80:143] [ 0.000000] arch_timer: cp15 timer(s) running at 62.50MHz (virt). [ 0.000000] clocksource: arch_sys_counter: mask: 0xffffffffffffff max_cy= cles: 0x1cd42e208c, max_idle_ns: 881590405314 ns [ 0.003589] sched_clock: 56 bits at 62MHz, resolution 16ns, wraps every = 4398046511096ns [ 0.006045] Switching to timer-based delay loop, resolution 16ns [ 0.308537] Console: colour dummy device 80x30 [ 0.365555] Calibrating delay loop (skipped), value calculated using tim= er frequency.. 125.00 BogoMIPS (lpj=3D250000) [ 0.373670] pid_max: default: 32768 minimum: 301 [ 0.426475] Security Framework initialized [ 0.431096] Yama: becoming mindful. [ 0.506448] AppArmor: AppArmor initialized [ 0.535772] Mount-cache hash table entries: 1024 (order: 0, 4096 bytes) [ 0.543395] Mountpoint-cache hash table entries: 1024 (order: 0, 4096 by= tes) [ 0.965208] CPU: Testing write buffer coherency: ok [ 0.998104] CPU0: Spectre v2: firmware did not set auxiliary control reg= ister IBE bit, system vulnerable [ 1.411470] /cpus/cpu@0 missing clock-frequency property [ 1.428729] CPU0: thread -1, cpu 0, socket 0, mpidr 80000000 [ 1.698318] Setting up static identity map for 0x40100000 - 0x401000a0 [ 1.748454] rcu: Hierarchical SRCU implementation. [ 1.926086] EFI services will not be available. [ 1.993192] smp: Bringing up secondary CPUs ... [ 1.994874] smp: Brought up 1 node, 1 CPU [ 1.997851] SMP: Total of 1 processors activated (125.00 BogoMIPS). [ 1.998883] CPU: All CPU(s) started in SVC mode. [ 2.503281] devtmpfs: initialized [ 3.198070] VFP support v0.3: implementor 41 architecture 4 part 30 vari= ant f rev 0 [ 3.746420] clocksource: jiffies: mask: 0xffffffff max_cycles: 0xfffffff= f, max_idle_ns: 7645041785100000 ns [ 3.775416] futex hash table entries: 256 (order: 2, 16384 bytes) [ 4.121161] pinctrl core: initialized pinctrl subsystem [ 4.513079] DMI not present or invalid. [ 4.901725] NET: Registered protocol family 16 [ 5.171532] DMA: preallocated 256 KiB pool for atomic coherent allocatio= ns [ 5.247930] audit: initializing netlink subsys (disabled) [ 5.429698] audit: type=3D2000 audit(3.640:1): state=3Dinitialized audit= _enabled=3D0 res=3D1 [ 5.571864] No ATAGs? [ 5.603824] hw-breakpoint: found 5 (+1 reserved) breakpoint and 4 watchp= oint registers. [ 5.605465] hw-breakpoint: maximum watchpoint size is 8 bytes. [ 5.716942] Serial: AMBA PL011 UART driver [ 6.689400] 9000000.pl011: ttyAMA0 at MMIO 0x9000000 (irq =3D 54, base_b= aud =3D 0) is a PL011 rev1 [ 6.818013] console [ttyAMA0] enabled [...] [ 73.272363] pl061_gpio 9030000.pl061: PL061 GPIO chip @0x09030000 regist= ered [ 73.354536] pci-host-generic 4010000000.pcie: host bridge /pcie@10000000= ranges: [ 73.383612] pci-host-generic 4010000000.pcie: IO 0x3eff0000..0x3effff= ff -> 0x00000000 [ 73.405201] pci-host-generic 4010000000.pcie: MEM 0x10000000..0x3efeff= ff -> 0x10000000 [ 73.413035] pci-host-generic 4010000000.pcie: MEM 0x8000000000..0xffff= ffffff -> 0x8000000000 [ 73.449129] pci-host-generic 4010000000.pcie: can't claim ECAM area [mem= 0x10000000-0x1fffffff]: address conflict with pcie@10000000 [mem 0x1000000= 0-0x3efeffff] [ 73.511869] pci-host-generic: probe of 4010000000.pcie failed with error= -16 [ 74.049180] Serial: 8250/16550 driver, 4 ports, IRQ sharing disabled [ 74.184595] Serial: AMBA driver [...] [ 78.969555] Run /init as init process [ 80.062608] hrtimer: interrupt took 110418352 ns GC Warning: pthread_getattr_np or pthread_attr_getstack failed for main thr= ead GC Warning: Couldn't read /proc/stat Welcome, this is GNU's early boot Guile. Use '--repl' for an initrd REPL. loading kernel modules... [ 135.306635] SCSI subsystem initialized [ 136.419610] Unable to handle kernel paging request at virtual address ea= 0003ff [ 136.432562] pgd =3D (ptrval) [ 136.434175] [ea0003ff] *pgd=3D00000000 [ 136.443714] Internal error: Oops: 5 [#1] SMP ARM [ 136.448388] Modules linked in: libata(+) scsi_mod [ 136.459458] CPU: 0 PID: 1 Comm: init Not tainted 4.19.11-gnu #1 [ 136.461282] Hardware name: Generic DT based system [ 136.477596] PC is at ata_attach_transport+0xd8/0x274 [libata] [ 136.483380] LR is at 0x124 [ 136.484240] pc : [] lr : [<00000124>] psr: 60000013 [ 136.485268] sp : ce0fdcf0 ip : ea0003ff fp : ce0fdd1c [ 136.486473] r10: 00000000 r9 : ea00041f r8 : ea00040f [ 136.487498] r7 : ce3fc8bc r6 : ce3fc8dc r5 : ce3fc8cc r4 : ce3fc800 [ 136.488614] r3 : ce0ed040 r2 : 00000000 r1 : c10d3b14 r0 : 00000000 [ 136.490476] Flags: nZCv IRQs on FIQs on Mode SVC_32 ISA ARM Segment= none [ 136.492057] Control: 10c5387d Table: 4e34406a DAC: 00000051 [ 136.494159] Process init (pid: 1, stack limit =3D 0x(ptrval)) [ 136.495663] Stack: (0xce0fdcf0 to 0xce0fe000) [ 136.499157] dce0: 00000001 00000000 = bf0778c8 c1005dcc [ 136.501950] dd00: bf079000 ffffffff bf078000 00000000 ce0fdd9c ce0fdd20 = bf077c10 bf05c0c4 [ 136.504080] dd20: c0f1e6b0 bf06f140 c1005dcc ce0fdd38 c01ceb30 bf078000 = ce0fdd54 ffffffff [ 136.506036] dd40: c0155458 c01ceb24 ce0fdd7c ce0fdd58 c01bbaac c01553d0 = c10067b4 d082000c [ 136.508122] dd60: ce0fdda8 d0820000 d0821000 f28f9aeb ce0fdda4 bf06ef40 = bf0778c8 c1005dcc [ 136.510236] dd80: 00000000 bf06ef4c bf06ef40 c1005dcc ce0fde14 ce0fdda0 = c01035d8 bf0778d4 [ 136.512143] dda0: c0101a0c f28f9aeb ce327600 c0979f74 ce000600 ce000600 = ce0fddd4 ce0fddc8 [ 136.514144] ddc0: c0979f74 c01ce7d0 ce0fde14 ce0fddd8 c0308ab4 c0979f50 = ce0fde04 ce0fdde8 [ 136.516233] dde0: c0309c5c c03090e4 00000052 f28f9aeb ce0fdf38 bf06ef40 = ce0fdf38 ce3321c0 [ 136.518293] de00: bf06f070 bf06ef4c ce0fde3c ce0fde18 c01fb75c c0103594 = ce0fde3c ce0fde28 [ 136.520436] de20: c02f3410 00000000 ce0fdf38 bf06f040 ce0fdf14 ce0fde40 = c01fa210 c01fb6f4 [ 136.522398] de40: ffff8000 00007fff bf06ef40 c01f778c ce0fde98 d0820000 = c1005dcc c0a08334 [ 136.524853] de60: bf06f054 bf06ef44 00000a2c bf071000 014f9cf8 c0c3d374 = ffffffff c0c5b674 [ 136.526866] de80: c0101204 ce0fc000 ce0fdf14 ce0fde98 bf062024 00000006 = bf062054 000000bf [ 136.528885] dea0: 00000000 00000000 6e72656b 00006c65 00000000 00000000 = 00000000 00000000 [ 136.531078] dec0: 00000000 00000000 00000000 00000000 00000000 00000000 = 00000000 00000000 [ 136.533045] dee0: 00000000 f28f9aeb 7fffffff c1005dcc 00000000 0000000a = 014f9cf8 c0101204 [ 136.534976] df00: ce0fc000 0000017b ce0fdfa4 ce0fdf18 c01fa9c4 c01f84e4 = 7fffffff 00000000 [ 136.537150] df20: 00000003 ce0fc000 ce0fdf5c d08cf000 00051ca8 00000000 = d08f06f3 d08fefc0 [ 136.539224] df40: d08cf000 00051ca8 d09201e0 d091ff38 d0909544 0002d000 = 0002f250 00000000 [ 136.541281] df60: 00000000 00000000 0001490c 00000042 00000043 0000003c = 0000002a 0000001b [ 136.543248] df80: 00000000 f28f9aeb 00000004 b58dac90 00053e77 0000017b = 00000000 ce0fdfa8 [ 136.545223] dfa0: c0101000 c01fa8f4 00000004 b58dac90 0000000a 014f9cf8 = 00000000 015bbf78 [ 136.548002] dfc0: 00000004 b58dac90 00053e77 0000017b 002b39d0 0029b25c = 00161fec 00000002 [ 136.550771] dfe0: bec661d0 bec661c0 0005c7a9 0011d1e2 60000030 0000000a = 00000000 00000000 [ 136.578059] [] (ata_attach_transport [libata]) from [] (ata_init+0x348/0x39c [libata]) [ 136.589371] [] (ata_init [libata]) from [] (do_one_i= nitcall+0x50/0x214) [ 136.596083] [] (do_one_initcall) from [] (do_init_mo= dule+0x74/0x224) [ 136.598342] [] (do_init_module) from [] (load_module= +0x1d38/0x2228) [ 136.599851] [] (load_module) from [] (sys_finit_modu= le+0xdc/0x110) [ 136.601640] [] (sys_finit_module) from [] (ret_fast_= syscall+0x0/0x54) [ 136.603227] Exception stack(0xce0fdfa8 to 0xce0fdff0) [ 136.605053] dfa0: 00000004 b58dac90 0000000a 014f9cf8 = 00000000 015bbf78 [ 136.607122] dfc0: 00000004 b58dac90 00053e77 0000017b 002b39d0 0029b25c = 00161fec 00000002 [ 136.608630] dfe0: bec661d0 bec661c0 0005c7a9 0011d1e2 [ 136.616749] Code: e59fc1a0 e3a0ef49 e28c8010 e28c9020 (e89c000f)=20 [ 136.631449] ---[ end trace c34b1e9ba28742f3 ]--- And then it hangs seemingly indefinitely. --Sig_/dmSEbwSjac71/YsXiW1oP7. Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEds7GsXJ0tGXALbPZ5xo1VCwwuqUFAlwdcsUACgkQ5xo1VCww uqUTfgf6AvkoJWaLLPchOqDrCBL3OCq+IzGcykqkBiqkZvTUMR+AeQuiHrQzxzQD WgkDbsiNtUOVjgzglpLwJLRXSJejHm3vnGK28N2iDk23deWKKDBJ/I6J7MhfF5l1 mQZRL675T/ABR55Ex/XOb6KNAXXvD0Jn3FG3SMGZUIviJiUXlX2N8Ov3H6j2p7Xa dFxPMQ4wc8lolyBOiQDNLLmZI0P+o0SS7kMOw1ovA3DlB1x0akuDYaVGze0I30v7 fxdC8UX/Yk2B4dYwYJZ0qUgaex8FRcjc4s3MRPMbKYV46CLALc0r3ZROR4Gv7mQ2 auIx0v7TBWJRRr7rPxxaytQmDU7ctA== =VMrK -----END PGP SIGNATURE----- --Sig_/dmSEbwSjac71/YsXiW1oP7.-- From debbugs-submit-bounces@debbugs.gnu.org Fri Dec 21 18:50:23 2018 Received: (at 33676) by debbugs.gnu.org; 21 Dec 2018 23:50:23 +0000 Received: from localhost ([127.0.0.1]:58994 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gaUYh-0006EW-3Z for submit@debbugs.gnu.org; Fri, 21 Dec 2018 18:50:23 -0500 Received: from lkcl.net ([217.147.94.29]:34326) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gaUYf-0006EO-NJ for 33676@debbugs.gnu.org; Fri, 21 Dec 2018 18:50:22 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=lkcl.net; s=201607131; h=Content-Type:Cc:To:Subject:Message-ID:Date:From:In-Reply-To:References:MIME-Version; bh=IViriWHEtRyzMpD3Gr9rq/hZPJhycZZBeJsJ0Wg1J+c=; b=R7+7PBbhiQZPHpxoi99mKD3lilB+TCG4Mq5afZh8hpR6xjv6wdm4IRT6tegtiKNu4L0g6Ux8wiBhcbxwQbeUaLz1lJx8eyeaXflluMML6kE960EgvtNcS7hCGQO2S3ORkqEViDOBpJs3MQYWdaFXANVWb/Z5qh0EKVktqSpddOA=; Received: from mail-lf1-f45.google.com ([209.85.167.45]) by lkcl.net with esmtpsa (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.84_2) (envelope-from ) id 1gaUYe-0000lq-DL for 33676@debbugs.gnu.org; Fri, 21 Dec 2018 23:50:20 +0000 Received: by mail-lf1-f45.google.com with SMTP id y11so5027044lfj.4 for <33676@debbugs.gnu.org>; Fri, 21 Dec 2018 15:50:05 -0800 (PST) X-Gm-Message-State: AA+aEWYMBFdRgFrdEHs2b20ic/45Zr2o3pfZ5XEhOq3EbrpiqmofyUR5 nPc6aKBffkRil/yZxiyKsoQ86CtVOSgW9NE4U/c= X-Google-Smtp-Source: AFSGD/Usr8P8xm997nFBCk0vgTM5c1+baQMmmkRed6ujsWG5RYqMQAJfsyQSOs+i09fEiY9DVReAsEo0SUoM8gBxB0w= X-Received: by 2002:a19:280f:: with SMTP id o15mr2401508lfo.0.1545436199581; Fri, 21 Dec 2018 15:49:59 -0800 (PST) MIME-Version: 1.0 References: <20181208181214.2308472a@scratchpost.org> <20181222000553.06980837@scratchpost.org> In-Reply-To: <20181222000553.06980837@scratchpost.org> From: Luke Kenneth Casson Leighton Date: Fri, 21 Dec 2018 23:49:48 +0000 X-Gmail-Original-Message-ID: Message-ID: Subject: Re: bug#33676: GuixSD on eoma68-a20? To: Danny Milosavljevic Content-Type: text/plain; charset="UTF-8" X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 33676 Cc: 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) On Fri, Dec 21, 2018 at 11:11 PM Danny Milosavljevic wrote: > Yeah, we've now added the linker option to several packages. > It improves the situation a lot. GREAT! i'll cross-reference to the sourceware bug, that's really good to hear. it's not perfect: really, ld needs to be massively improved, bringing back techniques that were deleted from the source code at least 15 years ago. l. From debbugs-submit-bounces@debbugs.gnu.org Sat Dec 22 03:33:38 2018 Received: (at 33676) by debbugs.gnu.org; 22 Dec 2018 08:33:38 +0000 Received: from localhost ([127.0.0.1]:59102 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gacj4-0002X1-Eh for submit@debbugs.gnu.org; Sat, 22 Dec 2018 03:33:38 -0500 Received: from mx1.riseup.net ([198.252.153.129]:45002) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gacj2-0002Wt-Iz for 33676@debbugs.gnu.org; Sat, 22 Dec 2018 03:33:37 -0500 Received: from piha.riseup.net (piha-pn.riseup.net [10.0.1.163]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "COMODO RSA Domain Validation Secure Server CA" (verified OK)) by mx1.riseup.net (Postfix) with ESMTPS id 9E4081A041A; Sat, 22 Dec 2018 00:33:34 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1545467615; bh=p8Qg61d00WzsPdQGCAqZX1F82LWkoP+rcSfaG5HeA7Y=; h=Date:From:To:Cc:Subject:In-Reply-To:References:From; b=CjcKCJQcLVv/9CRuYgS4WWYVSb51F57aKTrMIPssxrn9yScZbizQBz3AdNAHsfY/Z XsD169Ftb4vCUAxAy0hJ63kNprSI9OdLQQ8ZmwOCpGv/oq2SiBPybImY314DrRnocs WgNyU2k/aTvWJqJIJagtO1F3goCoeTeuF4XBHdfk= X-Riseup-User-ID: CFCF927066CE1CEE373EDCEC2FB0AAA5B28409EE993AC014E4274DB8C69A69B1 Received: from [127.0.0.1] (localhost [127.0.0.1]) by piha.riseup.net with ESMTPSA id 4D91F6C64C; Sat, 22 Dec 2018 00:33:34 -0800 (PST) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit Date: Sat, 22 Dec 2018 00:33:33 -0800 From: swedebugia@riseup.net To: Danny Milosavljevic Subject: Re: bug#33676: GuixSD on eoma68-a20? In-Reply-To: <20181222000957.424e2213@scratchpost.org> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> <20181210113014.0e4e76eb@scratchpost.org> <20181210211224.GA7317@jurong>; <20181222000957.424e2213@scratchpost.org> Message-ID: X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, Andreas Enge , 33676@debbugs.gnu.org, ludo@gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) On 2018-12-22 00:09, Danny Milosavljevic wrote: > Now I get: > > $ # commit 39c676c4a3507863f4edf20b225ace4cbf646ed6 > $ ./pre-inst-env guix system disk-image --system=armhf-linux -e > '(begin (use-modules (gnu system) (gnu bootloader) (gnu bootloader > u-boot) (gnu system install)) (operating-system (inherit > installation-os) (bootloader (bootloader-configuration (bootloader > u-boot-bootloader) (target #f)))))' >QQQ3 2>&1 > [...] > The following derivation will be built: > /gnu/store/shgfclh6yy1a03hl0c293s89y3qm9033-disk-image.drv > building /gnu/store/shgfclh6yy1a03hl0c293s89y3qm9033-disk-image.drv... > environment variable `PATH' set to > `/gnu/store/cm3j1pzdqhw4s9bg1drwlm3lw3qxzddj-qemu-minimal-3.1.0/bin:/gnu/store/hb2qj35yxmvxzcq99lbfcpija032wdzh-coreutils-8.30/bin' > creating raw image of 1265.54 MiB... > Formatting '/gnu/store/9wbw2vbpgg3pwlg9xr7jbniyca0nra2q-disk-image', > fmt=raw size=1327019190 > [ 0.000000] Booting Linux on physical CPU 0x0 > [ 0.000000] Linux version 4.19.11-gnu (nixbld@) (gcc version 5.5.0 > (GCC)) #1 SMP 1 > [ 0.000000] CPU: ARMv7 Processor [412fc0f1] revision 1 (ARMv7), cr=10c5387d > [ 0.000000] CPU: div instructions available: patching division code > [ 0.000000] CPU: PIPT / VIPT nonaliasing data cache, PIPT instruction cache > [ 0.000000] OF: fdt: Machine model: linux,dummy-virt > [ 0.000000] Memory policy: Data cache writealloc > [ 0.000000] efi: Getting EFI parameters from FDT: > [ 0.000000] efi: UEFI not found. > [ 0.000000] cma: Reserved 16 MiB at 0x4f000000 > [ 0.000000] psci: probing for conduit method from DT. > [ 0.000000] psci: PSCIv0.2 detected in firmware. > [ 0.000000] psci: Using standard PSCI v0.2 function IDs > [ 0.000000] psci: Trusted OS migration not required > [ 0.000000] random: get_random_bytes called from > start_kernel+0xa0/0x50c with crng_init=0 > [ 0.000000] percpu: Embedded 17 pages/cpu @(ptrval) s38732 r8192 > d22708 u69632 > [ 0.000000] Built 1 zonelists, mobility grouping on. Total pages: 64960 > [ 0.000000] Kernel command line: panic=1 > --load=/gnu/store/ip9p4q62fbgm2r2xnnh8qi5p77k2igas-linux-vm-loader > console=ttyAMA0 > [ 0.000000] Dentry cache hash table entries: 32768 (order: 5, 131072 bytes) > [ 0.000000] Inode-cache hash table entries: 16384 (order: 4, 65536 bytes) > [ 0.000000] Memory: 214952K/262144K available (9216K kernel code, > 1133K rwdata, 2612K rodata, 2048K init, 310K bss, 30808K reserved, > 16384K cma-reserved, 0K highmem) > [ 0.000000] Virtual kernel memory layout: > [ 0.000000] vector : 0xffff0000 - 0xffff1000 ( 4 kB) > [ 0.000000] fixmap : 0xffc00000 - 0xfff00000 (3072 kB) > [ 0.000000] vmalloc : 0xd0800000 - 0xff800000 ( 752 MB) > [ 0.000000] lowmem : 0xc0000000 - 0xd0000000 ( 256 MB) > [ 0.000000] pkmap : 0xbfe00000 - 0xc0000000 ( 2 MB) > [ 0.000000] modules : 0xbf000000 - 0xbfe00000 ( 14 MB) > [ 0.000000] .text : 0x(ptrval) - 0x(ptrval) (10208 kB) > [ 0.000000] .init : 0x(ptrval) - 0x(ptrval) (2048 kB) > [ 0.000000] .data : 0x(ptrval) - 0x(ptrval) (1134 kB) > [ 0.000000] .bss : 0x(ptrval) - 0x(ptrval) ( 311 kB) > [ 0.000000] ftrace: allocating 33359 entries in 98 pages > [ 0.000000] rcu: Hierarchical RCU implementation. > [ 0.000000] rcu: RCU restricting CPUs from NR_CPUS=8 to nr_cpu_ids=1. > [ 0.000000] rcu: Adjusting geometry for rcu_fanout_leaf=16, nr_cpu_ids=1 > [ 0.000000] NR_IRQS: 16, nr_irqs: 16, preallocated irqs: 16 > [ 0.000000] GICv2m: range[mem 0x08020000-0x08020fff], SPI[80:143] > [ 0.000000] arch_timer: cp15 timer(s) running at 62.50MHz (virt). > [ 0.000000] clocksource: arch_sys_counter: mask: 0xffffffffffffff > max_cycles: 0x1cd42e208c, max_idle_ns: 881590405314 ns > [ 0.003589] sched_clock: 56 bits at 62MHz, resolution 16ns, wraps > every 4398046511096ns > [ 0.006045] Switching to timer-based delay loop, resolution 16ns > [ 0.308537] Console: colour dummy device 80x30 > [ 0.365555] Calibrating delay loop (skipped), value calculated > using timer frequency.. 125.00 BogoMIPS (lpj=250000) > [ 0.373670] pid_max: default: 32768 minimum: 301 > [ 0.426475] Security Framework initialized > [ 0.431096] Yama: becoming mindful. > [ 0.506448] AppArmor: AppArmor initialized > [ 0.535772] Mount-cache hash table entries: 1024 (order: 0, 4096 bytes) > [ 0.543395] Mountpoint-cache hash table entries: 1024 (order: 0, 4096 bytes) > [ 0.965208] CPU: Testing write buffer coherency: ok > [ 0.998104] CPU0: Spectre v2: firmware did not set auxiliary > control register IBE bit, system vulnerable > [ 1.411470] /cpus/cpu@0 missing clock-frequency property > [ 1.428729] CPU0: thread -1, cpu 0, socket 0, mpidr 80000000 > [ 1.698318] Setting up static identity map for 0x40100000 - 0x401000a0 > [ 1.748454] rcu: Hierarchical SRCU implementation. > [ 1.926086] EFI services will not be available. > [ 1.993192] smp: Bringing up secondary CPUs ... > [ 1.994874] smp: Brought up 1 node, 1 CPU > [ 1.997851] SMP: Total of 1 processors activated (125.00 BogoMIPS). > [ 1.998883] CPU: All CPU(s) started in SVC mode. > [ 2.503281] devtmpfs: initialized > [ 3.198070] VFP support v0.3: implementor 41 architecture 4 part 30 > variant f rev 0 > [ 3.746420] clocksource: jiffies: mask: 0xffffffff max_cycles: > 0xffffffff, max_idle_ns: 7645041785100000 ns > [ 3.775416] futex hash table entries: 256 (order: 2, 16384 bytes) > [ 4.121161] pinctrl core: initialized pinctrl subsystem > [ 4.513079] DMI not present or invalid. > [ 4.901725] NET: Registered protocol family 16 > [ 5.171532] DMA: preallocated 256 KiB pool for atomic coherent allocations > [ 5.247930] audit: initializing netlink subsys (disabled) > [ 5.429698] audit: type=2000 audit(3.640:1): state=initialized > audit_enabled=0 res=1 > [ 5.571864] No ATAGs? > [ 5.603824] hw-breakpoint: found 5 (+1 reserved) breakpoint and 4 > watchpoint registers. > [ 5.605465] hw-breakpoint: maximum watchpoint size is 8 bytes. > [ 5.716942] Serial: AMBA PL011 UART driver > [ 6.689400] 9000000.pl011: ttyAMA0 at MMIO 0x9000000 (irq = 54, > base_baud = 0) is a PL011 rev1 > [ 6.818013] console [ttyAMA0] enabled > [...] > [ 73.272363] pl061_gpio 9030000.pl061: PL061 GPIO chip @0x09030000 registered > [ 73.354536] pci-host-generic 4010000000.pcie: host bridge > /pcie@10000000 ranges: > [ 73.383612] pci-host-generic 4010000000.pcie: IO > 0x3eff0000..0x3effffff -> 0x00000000 > [ 73.405201] pci-host-generic 4010000000.pcie: MEM > 0x10000000..0x3efeffff -> 0x10000000 > [ 73.413035] pci-host-generic 4010000000.pcie: MEM > 0x8000000000..0xffffffffff -> 0x8000000000 > [ 73.449129] pci-host-generic 4010000000.pcie: can't claim ECAM area > [mem 0x10000000-0x1fffffff]: address conflict with pcie@10000000 [mem > 0x10000000-0x3efeffff] > [ 73.511869] pci-host-generic: probe of 4010000000.pcie failed with error -16 > [ 74.049180] Serial: 8250/16550 driver, 4 ports, IRQ sharing disabled > [ 74.184595] Serial: AMBA driver > [...] > [ 78.969555] Run /init as init process > [ 80.062608] hrtimer: interrupt took 110418352 ns > GC Warning: pthread_getattr_np or pthread_attr_getstack failed for main thread > GC Warning: Couldn't read /proc/stat > Welcome, this is GNU's early boot Guile. > Use '--repl' for an initrd REPL. > > loading kernel modules... > [ 135.306635] SCSI subsystem initialized > [ 136.419610] Unable to handle kernel paging request at virtual > address ea0003ff > [ 136.432562] pgd = (ptrval) > [ 136.434175] [ea0003ff] *pgd=00000000 > [ 136.443714] Internal error: Oops: 5 [#1] SMP ARM > [ 136.448388] Modules linked in: libata(+) scsi_mod > [ 136.459458] CPU: 0 PID: 1 Comm: init Not tainted 4.19.11-gnu #1 > [ 136.461282] Hardware name: Generic DT based system > [ 136.477596] PC is at ata_attach_transport+0xd8/0x274 [libata] > [ 136.483380] LR is at 0x124 > [ 136.484240] pc : [] lr : [<00000124>] psr: 60000013 > [ 136.485268] sp : ce0fdcf0 ip : ea0003ff fp : ce0fdd1c > [ 136.486473] r10: 00000000 r9 : ea00041f r8 : ea00040f > [ 136.487498] r7 : ce3fc8bc r6 : ce3fc8dc r5 : ce3fc8cc r4 : ce3fc800 > [ 136.488614] r3 : ce0ed040 r2 : 00000000 r1 : c10d3b14 r0 : 00000000 > [ 136.490476] Flags: nZCv IRQs on FIQs on Mode SVC_32 ISA ARM Segment none > [ 136.492057] Control: 10c5387d Table: 4e34406a DAC: 00000051 > [ 136.494159] Process init (pid: 1, stack limit = 0x(ptrval)) > [ 136.495663] Stack: (0xce0fdcf0 to 0xce0fe000) > [ 136.499157] dce0: 00000001 > 00000000 bf0778c8 c1005dcc > [ 136.501950] dd00: bf079000 ffffffff bf078000 00000000 ce0fdd9c > ce0fdd20 bf077c10 bf05c0c4 > [ 136.504080] dd20: c0f1e6b0 bf06f140 c1005dcc ce0fdd38 c01ceb30 > bf078000 ce0fdd54 ffffffff > [ 136.506036] dd40: c0155458 c01ceb24 ce0fdd7c ce0fdd58 c01bbaac > c01553d0 c10067b4 d082000c > [ 136.508122] dd60: ce0fdda8 d0820000 d0821000 f28f9aeb ce0fdda4 > bf06ef40 bf0778c8 c1005dcc > [ 136.510236] dd80: 00000000 bf06ef4c bf06ef40 c1005dcc ce0fde14 > ce0fdda0 c01035d8 bf0778d4 > [ 136.512143] dda0: c0101a0c f28f9aeb ce327600 c0979f74 ce000600 > ce000600 ce0fddd4 ce0fddc8 > [ 136.514144] ddc0: c0979f74 c01ce7d0 ce0fde14 ce0fddd8 c0308ab4 > c0979f50 ce0fde04 ce0fdde8 > [ 136.516233] dde0: c0309c5c c03090e4 00000052 f28f9aeb ce0fdf38 > bf06ef40 ce0fdf38 ce3321c0 > [ 136.518293] de00: bf06f070 bf06ef4c ce0fde3c ce0fde18 c01fb75c > c0103594 ce0fde3c ce0fde28 > [ 136.520436] de20: c02f3410 00000000 ce0fdf38 bf06f040 ce0fdf14 > ce0fde40 c01fa210 c01fb6f4 > [ 136.522398] de40: ffff8000 00007fff bf06ef40 c01f778c ce0fde98 > d0820000 c1005dcc c0a08334 > [ 136.524853] de60: bf06f054 bf06ef44 00000a2c bf071000 014f9cf8 > c0c3d374 ffffffff c0c5b674 > [ 136.526866] de80: c0101204 ce0fc000 ce0fdf14 ce0fde98 bf062024 > 00000006 bf062054 000000bf > [ 136.528885] dea0: 00000000 00000000 6e72656b 00006c65 00000000 > 00000000 00000000 00000000 > [ 136.531078] dec0: 00000000 00000000 00000000 00000000 00000000 > 00000000 00000000 00000000 > [ 136.533045] dee0: 00000000 f28f9aeb 7fffffff c1005dcc 00000000 > 0000000a 014f9cf8 c0101204 > [ 136.534976] df00: ce0fc000 0000017b ce0fdfa4 ce0fdf18 c01fa9c4 > c01f84e4 7fffffff 00000000 > [ 136.537150] df20: 00000003 ce0fc000 ce0fdf5c d08cf000 00051ca8 > 00000000 d08f06f3 d08fefc0 > [ 136.539224] df40: d08cf000 00051ca8 d09201e0 d091ff38 d0909544 > 0002d000 0002f250 00000000 > [ 136.541281] df60: 00000000 00000000 0001490c 00000042 00000043 > 0000003c 0000002a 0000001b > [ 136.543248] df80: 00000000 f28f9aeb 00000004 b58dac90 00053e77 > 0000017b 00000000 ce0fdfa8 > [ 136.545223] dfa0: c0101000 c01fa8f4 00000004 b58dac90 0000000a > 014f9cf8 00000000 015bbf78 > [ 136.548002] dfc0: 00000004 b58dac90 00053e77 0000017b 002b39d0 > 0029b25c 00161fec 00000002 > [ 136.550771] dfe0: bec661d0 bec661c0 0005c7a9 0011d1e2 60000030 > 0000000a 00000000 00000000 > [ 136.578059] [] (ata_attach_transport [libata]) from > [] (ata_init+0x348/0x39c [libata]) > [ 136.589371] [] (ata_init [libata]) from [] > (do_one_initcall+0x50/0x214) > [ 136.596083] [] (do_one_initcall) from [] > (do_init_module+0x74/0x224) > [ 136.598342] [] (do_init_module) from [] > (load_module+0x1d38/0x2228) > [ 136.599851] [] (load_module) from [] > (sys_finit_module+0xdc/0x110) > [ 136.601640] [] (sys_finit_module) from [] > (ret_fast_syscall+0x0/0x54) > [ 136.603227] Exception stack(0xce0fdfa8 to 0xce0fdff0) > [ 136.605053] dfa0: 00000004 b58dac90 0000000a > 014f9cf8 00000000 015bbf78 > [ 136.607122] dfc0: 00000004 b58dac90 00053e77 0000017b 002b39d0 > 0029b25c 00161fec 00000002 > [ 136.608630] dfe0: bec661d0 bec661c0 0005c7a9 0011d1e2 > [ 136.616749] Code: e59fc1a0 e3a0ef49 e28c8010 e28c9020 (e89c000f) > [ 136.631449] ---[ end trace c34b1e9ba28742f3 ]--- > > And then it hangs seemingly indefinitely. I just tried on Git checkout: repository: /home/sdb/src/guix branch: HEAD commit: d15211c9b5b46b96c5b658329624942b6ff5c917 and got: building /gnu/store/ngyvqxnj2yndvncpfrkmpc6irfz6k09q-gmp-6.1.2.drv... @ unsupported-platform /gnu/store/ngyvqxnj2yndvncpfrkmpc6irfz6k09q-gmp-6.1.2.drv armhf-linux while setting up the build environment: a `armhf-linux' is required to build `/gnu/store/ngyvqxnj2yndvncpfrkmpc6irfz6k09q-gmp-6.1.2.drv', but I am a `i686-linux' builder for `/gnu/store/ngyvqxnj2yndvncpfrkmpc6irfz6k09q-gmp-6.1.2.drv' failed with exit code 1 build of /gnu/store/ngyvqxnj2yndvncpfrkmpc6irfz6k09q-gmp-6.1.2.drv failed View build log at '/var/log/guix/drvs/ng/yvqxnj2yndvncpfrkmpc6irfz6k09q-gmp-6.1.2.drv.bz2'. substituting /gnu/store/1aclmh7jy2j5084kdpbcz5xgmdzvjzzj-fontconfig-2.13.1... cannot build derivation `/gnu/store/hr975r813adrn92f2g7f14z39086hnbx-coreutils-8.30.drv': 1 dependencies couldn't be built killing process 2725 cannot build derivation `/gnu/store/c56fwipfpdpii95420xcwf3vamy3n2pa-python-3.7.0.drv': 1 dependencies couldn't be built cannot build derivation `/gnu/store/3v425ipvhz4w2rll3phfzhq5kpaczwg4-python-wrapper-3.7.0.drv': 1 dependencies couldn't be built guix system: error: build failed: build of `/gnu/store/3v425ipvhz4w2rll3phfzhq5kpaczwg4-python-wrapper-3.7.0.drv' failed -- Cheers Swedebugia From debbugs-submit-bounces@debbugs.gnu.org Sat Dec 22 03:44:19 2018 Received: (at 33676) by debbugs.gnu.org; 22 Dec 2018 08:44:19 +0000 Received: from localhost ([127.0.0.1]:59107 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gactP-0002m8-KO for submit@debbugs.gnu.org; Sat, 22 Dec 2018 03:44:19 -0500 Received: from dd26836.kasserver.com ([85.13.145.193]:46056) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gactM-0002ly-Ub for 33676@debbugs.gnu.org; Sat, 22 Dec 2018 03:44:17 -0500 Received: from localhost (77.117.128.10.wireless.dyn.drei.com [77.117.128.10]) by dd26836.kasserver.com (Postfix) with ESMTPSA id 43BF83360727; Sat, 22 Dec 2018 09:44:15 +0100 (CET) Date: Sat, 22 Dec 2018 09:44:11 +0100 From: Danny Milosavljevic To: swedebugia@riseup.net Subject: Re: bug#33676: GuixSD on eoma68-a20? Message-ID: <20181222094411.3e8fd6cd@scratchpost.org> In-Reply-To: References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> <20181210113014.0e4e76eb@scratchpost.org> <20181210211224.GA7317@jurong> <20181222000957.424e2213@scratchpost.org> X-Mailer: Claws Mail 3.17.1 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; boundary="Sig_/nMpC4AB3SIL3iG+bRAkjSfI"; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, Andreas Enge , 33676@debbugs.gnu.org, ludo@gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Sig_/nMpC4AB3SIL3iG+bRAkjSfI Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable Please add to your /etc/config.scm to the "services" section: (service qemu-binfmt-service-type (qemu-binfmt-configuration (platforms (lookup-qemu-platforms "arm")) (guix-support? #t))) --Sig_/nMpC4AB3SIL3iG+bRAkjSfI Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEds7GsXJ0tGXALbPZ5xo1VCwwuqUFAlwd+VsACgkQ5xo1VCww uqUbRAf/WJiETaeIA6PHC3qBPEjOKAuwgL7fSJPbR26Wlv/WDP+tMZomn5OH0FH4 VHHnAEHonzzYUni88HZa9Vt8N0SMLo+XhDibwpuGKYfiRc4QHfR7nKWH57r47xcm m7NSK9lKU8Aih7b/h08Mq9dBq7kWHEv2N2lMVgnZF3oar+jsjEXPmdEy2C+bB8ql 2vtDhoh95KA4OSAw96vMRwWTUk7AD1XtMDNE/g5fOHkJftf9Ij21+Q+shJEEOSvS seJE2uhtkUl3LHL0aG8JPQQpvB+Keyxlyq48Qg3eBNHAUAXNOmVdQ4VmcFCf9PNz X5tQV5NsedBNQlR01cJlCS47OkzHXw== =KJ8p -----END PGP SIGNATURE----- --Sig_/nMpC4AB3SIL3iG+bRAkjSfI-- From debbugs-submit-bounces@debbugs.gnu.org Sat Dec 22 03:47:16 2018 Received: (at 33676) by debbugs.gnu.org; 22 Dec 2018 08:47:16 +0000 Received: from localhost ([127.0.0.1]:59111 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gacwF-0002qy-1u for submit@debbugs.gnu.org; Sat, 22 Dec 2018 03:47:15 -0500 Received: from mx1.riseup.net ([198.252.153.129]:46215) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gacwC-0002qp-Ke for 33676@debbugs.gnu.org; Sat, 22 Dec 2018 03:47:13 -0500 Received: from piha.riseup.net (piha-pn.riseup.net [10.0.1.163]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "COMODO RSA Domain Validation Secure Server CA" (verified OK)) by mx1.riseup.net (Postfix) with ESMTPS id 67E1B1A0169; Sat, 22 Dec 2018 00:47:11 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1545468431; bh=xjtkLkd5zSn0FnG9VTF3L7boQ/Vg/lLqrfBaxSP7AvA=; h=Date:From:To:Cc:Subject:In-Reply-To:References:From; b=T5GKwTcToJrYTfN7Ad0pOYbj9DhBd6/qYBUOcSjHkEOIyB+D3ahfdif7zY/TVjvF0 7n3CxELCp0OG2fJ2UlAYKON9qXTQfJMpGiPwWQujcW+9oAXc51BPpdGKsMiHKj9BGL 0HINKns+Wgu1i/xWpbgj10q4xitMEXQYJSX3tQSU= X-Riseup-User-ID: F21BC71D9C0AF0C263D35939488DA89220176BE68B5A7B236A56AFEBBDE5BD57 Received: from [127.0.0.1] (localhost [127.0.0.1]) by piha.riseup.net with ESMTPSA id 0FFDD6BBED; Sat, 22 Dec 2018 00:47:11 -0800 (PST) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit Date: Sat, 22 Dec 2018 00:47:10 -0800 From: swedebugia@riseup.net To: Danny Milosavljevic Subject: Re: bug#33676: GuixSD on eoma68-a20? In-Reply-To: References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> <20181210113014.0e4e76eb@scratchpost.org> <20181210211224.GA7317@jurong>; <20181222000957.424e2213@scratchpost.org> Message-ID: X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, bug-Guix , 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) On 2018-12-22 09:33, swedebugia@riseup.net wrote: > On 2018-12-22 00:09, Danny Milosavljevic wrote: >> Now I get: >> >> $ # commit 39c676c4a3507863f4edf20b225ace4cbf646ed6 >> $ ./pre-inst-env guix system disk-image --system=armhf-linux -e >> '(begin (use-modules (gnu system) (gnu bootloader) (gnu bootloader >> u-boot) (gnu system install)) (operating-system (inherit >> installation-os) (bootloader (bootloader-configuration (bootloader >> u-boot-bootloader) (target #f)))))' >QQQ3 2>&1 >> [...] >> The following derivation will be built: >> /gnu/store/shgfclh6yy1a03hl0c293s89y3qm9033-disk-image.drv >> building /gnu/store/shgfclh6yy1a03hl0c293s89y3qm9033-disk-image.drv... >> environment variable `PATH' set to >> `/gnu/store/cm3j1pzdqhw4s9bg1drwlm3lw3qxzddj-qemu-minimal-3.1.0/bin:/gnu/store/hb2qj35yxmvxzcq99lbfcpija032wdzh-coreutils-8.30/bin' >> creating raw image of 1265.54 MiB... >> Formatting '/gnu/store/9wbw2vbpgg3pwlg9xr7jbniyca0nra2q-disk-image', >> fmt=raw size=1327019190 >> [ 0.000000] Booting Linux on physical CPU 0x0 >> [ 0.000000] Linux version 4.19.11-gnu (nixbld@) (gcc version 5.5.0 >> (GCC)) #1 SMP 1 >> [ 0.000000] CPU: ARMv7 Processor [412fc0f1] revision 1 (ARMv7), cr=10c5387d >> [ 0.000000] CPU: div instructions available: patching division code >> [ 0.000000] CPU: PIPT / VIPT nonaliasing data cache, PIPT instruction cache >> [ 0.000000] OF: fdt: Machine model: linux,dummy-virt >> [ 0.000000] Memory policy: Data cache writealloc >> [ 0.000000] efi: Getting EFI parameters from FDT: >> [ 0.000000] efi: UEFI not found. >> [ 0.000000] cma: Reserved 16 MiB at 0x4f000000 >> [ 0.000000] psci: probing for conduit method from DT. >> [ 0.000000] psci: PSCIv0.2 detected in firmware. >> [ 0.000000] psci: Using standard PSCI v0.2 function IDs >> [ 0.000000] psci: Trusted OS migration not required >> [ 0.000000] random: get_random_bytes called from >> start_kernel+0xa0/0x50c with crng_init=0 >> [ 0.000000] percpu: Embedded 17 pages/cpu @(ptrval) s38732 r8192 >> d22708 u69632 >> [ 0.000000] Built 1 zonelists, mobility grouping on. Total pages: 64960 >> [ 0.000000] Kernel command line: panic=1 >> --load=/gnu/store/ip9p4q62fbgm2r2xnnh8qi5p77k2igas-linux-vm-loader >> console=ttyAMA0 >> [ 0.000000] Dentry cache hash table entries: 32768 (order: 5, 131072 bytes) >> [ 0.000000] Inode-cache hash table entries: 16384 (order: 4, 65536 bytes) >> [ 0.000000] Memory: 214952K/262144K available (9216K kernel code, >> 1133K rwdata, 2612K rodata, 2048K init, 310K bss, 30808K reserved, >> 16384K cma-reserved, 0K highmem) >> [ 0.000000] Virtual kernel memory layout: >> [ 0.000000] vector : 0xffff0000 - 0xffff1000 ( 4 kB) >> [ 0.000000] fixmap : 0xffc00000 - 0xfff00000 (3072 kB) >> [ 0.000000] vmalloc : 0xd0800000 - 0xff800000 ( 752 MB) >> [ 0.000000] lowmem : 0xc0000000 - 0xd0000000 ( 256 MB) >> [ 0.000000] pkmap : 0xbfe00000 - 0xc0000000 ( 2 MB) >> [ 0.000000] modules : 0xbf000000 - 0xbfe00000 ( 14 MB) >> [ 0.000000] .text : 0x(ptrval) - 0x(ptrval) (10208 kB) >> [ 0.000000] .init : 0x(ptrval) - 0x(ptrval) (2048 kB) >> [ 0.000000] .data : 0x(ptrval) - 0x(ptrval) (1134 kB) >> [ 0.000000] .bss : 0x(ptrval) - 0x(ptrval) ( 311 kB) >> [ 0.000000] ftrace: allocating 33359 entries in 98 pages >> [ 0.000000] rcu: Hierarchical RCU implementation. >> [ 0.000000] rcu: RCU restricting CPUs from NR_CPUS=8 to nr_cpu_ids=1. >> [ 0.000000] rcu: Adjusting geometry for rcu_fanout_leaf=16, nr_cpu_ids=1 >> [ 0.000000] NR_IRQS: 16, nr_irqs: 16, preallocated irqs: 16 >> [ 0.000000] GICv2m: range[mem 0x08020000-0x08020fff], SPI[80:143] >> [ 0.000000] arch_timer: cp15 timer(s) running at 62.50MHz (virt). >> [ 0.000000] clocksource: arch_sys_counter: mask: 0xffffffffffffff >> max_cycles: 0x1cd42e208c, max_idle_ns: 881590405314 ns >> [ 0.003589] sched_clock: 56 bits at 62MHz, resolution 16ns, wraps >> every 4398046511096ns >> [ 0.006045] Switching to timer-based delay loop, resolution 16ns >> [ 0.308537] Console: colour dummy device 80x30 >> [ 0.365555] Calibrating delay loop (skipped), value calculated >> using timer frequency.. 125.00 BogoMIPS (lpj=250000) >> [ 0.373670] pid_max: default: 32768 minimum: 301 >> [ 0.426475] Security Framework initialized >> [ 0.431096] Yama: becoming mindful. >> [ 0.506448] AppArmor: AppArmor initialized >> [ 0.535772] Mount-cache hash table entries: 1024 (order: 0, 4096 bytes) >> [ 0.543395] Mountpoint-cache hash table entries: 1024 (order: 0, 4096 bytes) >> [ 0.965208] CPU: Testing write buffer coherency: ok >> [ 0.998104] CPU0: Spectre v2: firmware did not set auxiliary >> control register IBE bit, system vulnerable >> [ 1.411470] /cpus/cpu@0 missing clock-frequency property >> [ 1.428729] CPU0: thread -1, cpu 0, socket 0, mpidr 80000000 >> [ 1.698318] Setting up static identity map for 0x40100000 - 0x401000a0 >> [ 1.748454] rcu: Hierarchical SRCU implementation. >> [ 1.926086] EFI services will not be available. >> [ 1.993192] smp: Bringing up secondary CPUs ... >> [ 1.994874] smp: Brought up 1 node, 1 CPU >> [ 1.997851] SMP: Total of 1 processors activated (125.00 BogoMIPS). >> [ 1.998883] CPU: All CPU(s) started in SVC mode. >> [ 2.503281] devtmpfs: initialized >> [ 3.198070] VFP support v0.3: implementor 41 architecture 4 part 30 >> variant f rev 0 >> [ 3.746420] clocksource: jiffies: mask: 0xffffffff max_cycles: >> 0xffffffff, max_idle_ns: 7645041785100000 ns >> [ 3.775416] futex hash table entries: 256 (order: 2, 16384 bytes) >> [ 4.121161] pinctrl core: initialized pinctrl subsystem >> [ 4.513079] DMI not present or invalid. >> [ 4.901725] NET: Registered protocol family 16 >> [ 5.171532] DMA: preallocated 256 KiB pool for atomic coherent allocations >> [ 5.247930] audit: initializing netlink subsys (disabled) >> [ 5.429698] audit: type=2000 audit(3.640:1): state=initialized >> audit_enabled=0 res=1 >> [ 5.571864] No ATAGs? >> [ 5.603824] hw-breakpoint: found 5 (+1 reserved) breakpoint and 4 >> watchpoint registers. >> [ 5.605465] hw-breakpoint: maximum watchpoint size is 8 bytes. >> [ 5.716942] Serial: AMBA PL011 UART driver >> [ 6.689400] 9000000.pl011: ttyAMA0 at MMIO 0x9000000 (irq = 54, >> base_baud = 0) is a PL011 rev1 >> [ 6.818013] console [ttyAMA0] enabled >> [...] >> [ 73.272363] pl061_gpio 9030000.pl061: PL061 GPIO chip @0x09030000 registered >> [ 73.354536] pci-host-generic 4010000000.pcie: host bridge >> /pcie@10000000 ranges: >> [ 73.383612] pci-host-generic 4010000000.pcie: IO >> 0x3eff0000..0x3effffff -> 0x00000000 >> [ 73.405201] pci-host-generic 4010000000.pcie: MEM >> 0x10000000..0x3efeffff -> 0x10000000 >> [ 73.413035] pci-host-generic 4010000000.pcie: MEM >> 0x8000000000..0xffffffffff -> 0x8000000000 >> [ 73.449129] pci-host-generic 4010000000.pcie: can't claim ECAM area >> [mem 0x10000000-0x1fffffff]: address conflict with pcie@10000000 [mem >> 0x10000000-0x3efeffff] >> [ 73.511869] pci-host-generic: probe of 4010000000.pcie failed with error -16 >> [ 74.049180] Serial: 8250/16550 driver, 4 ports, IRQ sharing disabled >> [ 74.184595] Serial: AMBA driver >> [...] >> [ 78.969555] Run /init as init process >> [ 80.062608] hrtimer: interrupt took 110418352 ns >> GC Warning: pthread_getattr_np or pthread_attr_getstack failed for main thread >> GC Warning: Couldn't read /proc/stat >> Welcome, this is GNU's early boot Guile. >> Use '--repl' for an initrd REPL. >> >> loading kernel modules... >> [ 135.306635] SCSI subsystem initialized >> [ 136.419610] Unable to handle kernel paging request at virtual >> address ea0003ff >> [ 136.432562] pgd = (ptrval) >> [ 136.434175] [ea0003ff] *pgd=00000000 >> [ 136.443714] Internal error: Oops: 5 [#1] SMP ARM >> [ 136.448388] Modules linked in: libata(+) scsi_mod >> [ 136.459458] CPU: 0 PID: 1 Comm: init Not tainted 4.19.11-gnu #1 >> [ 136.461282] Hardware name: Generic DT based system >> [ 136.477596] PC is at ata_attach_transport+0xd8/0x274 [libata] >> [ 136.483380] LR is at 0x124 >> [ 136.484240] pc : [] lr : [<00000124>] psr: 60000013 >> [ 136.485268] sp : ce0fdcf0 ip : ea0003ff fp : ce0fdd1c >> [ 136.486473] r10: 00000000 r9 : ea00041f r8 : ea00040f >> [ 136.487498] r7 : ce3fc8bc r6 : ce3fc8dc r5 : ce3fc8cc r4 : ce3fc800 >> [ 136.488614] r3 : ce0ed040 r2 : 00000000 r1 : c10d3b14 r0 : 00000000 >> [ 136.490476] Flags: nZCv IRQs on FIQs on Mode SVC_32 ISA ARM Segment none >> [ 136.492057] Control: 10c5387d Table: 4e34406a DAC: 00000051 >> [ 136.494159] Process init (pid: 1, stack limit = 0x(ptrval)) >> [ 136.495663] Stack: (0xce0fdcf0 to 0xce0fe000) >> [ 136.499157] dce0: 00000001 >> 00000000 bf0778c8 c1005dcc >> [ 136.501950] dd00: bf079000 ffffffff bf078000 00000000 ce0fdd9c >> ce0fdd20 bf077c10 bf05c0c4 >> [ 136.504080] dd20: c0f1e6b0 bf06f140 c1005dcc ce0fdd38 c01ceb30 >> bf078000 ce0fdd54 ffffffff >> [ 136.506036] dd40: c0155458 c01ceb24 ce0fdd7c ce0fdd58 c01bbaac >> c01553d0 c10067b4 d082000c >> [ 136.508122] dd60: ce0fdda8 d0820000 d0821000 f28f9aeb ce0fdda4 >> bf06ef40 bf0778c8 c1005dcc >> [ 136.510236] dd80: 00000000 bf06ef4c bf06ef40 c1005dcc ce0fde14 >> ce0fdda0 c01035d8 bf0778d4 >> [ 136.512143] dda0: c0101a0c f28f9aeb ce327600 c0979f74 ce000600 >> ce000600 ce0fddd4 ce0fddc8 >> [ 136.514144] ddc0: c0979f74 c01ce7d0 ce0fde14 ce0fddd8 c0308ab4 >> c0979f50 ce0fde04 ce0fdde8 >> [ 136.516233] dde0: c0309c5c c03090e4 00000052 f28f9aeb ce0fdf38 >> bf06ef40 ce0fdf38 ce3321c0 >> [ 136.518293] de00: bf06f070 bf06ef4c ce0fde3c ce0fde18 c01fb75c >> c0103594 ce0fde3c ce0fde28 >> [ 136.520436] de20: c02f3410 00000000 ce0fdf38 bf06f040 ce0fdf14 >> ce0fde40 c01fa210 c01fb6f4 >> [ 136.522398] de40: ffff8000 00007fff bf06ef40 c01f778c ce0fde98 >> d0820000 c1005dcc c0a08334 >> [ 136.524853] de60: bf06f054 bf06ef44 00000a2c bf071000 014f9cf8 >> c0c3d374 ffffffff c0c5b674 >> [ 136.526866] de80: c0101204 ce0fc000 ce0fdf14 ce0fde98 bf062024 >> 00000006 bf062054 000000bf >> [ 136.528885] dea0: 00000000 00000000 6e72656b 00006c65 00000000 >> 00000000 00000000 00000000 >> [ 136.531078] dec0: 00000000 00000000 00000000 00000000 00000000 >> 00000000 00000000 00000000 >> [ 136.533045] dee0: 00000000 f28f9aeb 7fffffff c1005dcc 00000000 >> 0000000a 014f9cf8 c0101204 >> [ 136.534976] df00: ce0fc000 0000017b ce0fdfa4 ce0fdf18 c01fa9c4 >> c01f84e4 7fffffff 00000000 >> [ 136.537150] df20: 00000003 ce0fc000 ce0fdf5c d08cf000 00051ca8 >> 00000000 d08f06f3 d08fefc0 >> [ 136.539224] df40: d08cf000 00051ca8 d09201e0 d091ff38 d0909544 >> 0002d000 0002f250 00000000 >> [ 136.541281] df60: 00000000 00000000 0001490c 00000042 00000043 >> 0000003c 0000002a 0000001b >> [ 136.543248] df80: 00000000 f28f9aeb 00000004 b58dac90 00053e77 >> 0000017b 00000000 ce0fdfa8 >> [ 136.545223] dfa0: c0101000 c01fa8f4 00000004 b58dac90 0000000a >> 014f9cf8 00000000 015bbf78 >> [ 136.548002] dfc0: 00000004 b58dac90 00053e77 0000017b 002b39d0 >> 0029b25c 00161fec 00000002 >> [ 136.550771] dfe0: bec661d0 bec661c0 0005c7a9 0011d1e2 60000030 >> 0000000a 00000000 00000000 >> [ 136.578059] [] (ata_attach_transport [libata]) from >> [] (ata_init+0x348/0x39c [libata]) >> [ 136.589371] [] (ata_init [libata]) from [] >> (do_one_initcall+0x50/0x214) >> [ 136.596083] [] (do_one_initcall) from [] >> (do_init_module+0x74/0x224) >> [ 136.598342] [] (do_init_module) from [] >> (load_module+0x1d38/0x2228) >> [ 136.599851] [] (load_module) from [] >> (sys_finit_module+0xdc/0x110) >> [ 136.601640] [] (sys_finit_module) from [] >> (ret_fast_syscall+0x0/0x54) >> [ 136.603227] Exception stack(0xce0fdfa8 to 0xce0fdff0) >> [ 136.605053] dfa0: 00000004 b58dac90 0000000a >> 014f9cf8 00000000 015bbf78 >> [ 136.607122] dfc0: 00000004 b58dac90 00053e77 0000017b 002b39d0 >> 0029b25c 00161fec 00000002 >> [ 136.608630] dfe0: bec661d0 bec661c0 0005c7a9 0011d1e2 >> [ 136.616749] Code: e59fc1a0 e3a0ef49 e28c8010 e28c9020 (e89c000f) >> [ 136.631449] ---[ end trace c34b1e9ba28742f3 ]--- >> >> And then it hangs seemingly indefinitely. > > I just tried on > > Git checkout: > repository: /home/sdb/src/guix > branch: HEAD > commit: d15211c9b5b46b96c5b658329624942b6ff5c917 > > and got: > > building /gnu/store/ngyvqxnj2yndvncpfrkmpc6irfz6k09q-gmp-6.1.2.drv... > @ unsupported-platform > /gnu/store/ngyvqxnj2yndvncpfrkmpc6irfz6k09q-gmp-6.1.2.drv armhf-linux > while setting up the build environment: a `armhf-linux' is required to > build `/gnu/store/ngyvqxnj2yndvncpfrkmpc6irfz6k09q-gmp-6.1.2.drv', but I > am a `i686-linux' > builder for `/gnu/store/ngyvqxnj2yndvncpfrkmpc6irfz6k09q-gmp-6.1.2.drv' > failed with exit code 1 > build of /gnu/store/ngyvqxnj2yndvncpfrkmpc6irfz6k09q-gmp-6.1.2.drv > failed > View build log at > '/var/log/guix/drvs/ng/yvqxnj2yndvncpfrkmpc6irfz6k09q-gmp-6.1.2.drv.bz2'. > substituting > /gnu/store/1aclmh7jy2j5084kdpbcz5xgmdzvjzzj-fontconfig-2.13.1... > cannot build derivation > `/gnu/store/hr975r813adrn92f2g7f14z39086hnbx-coreutils-8.30.drv': 1 > dependencies couldn't be built > killing process 2725 > cannot build derivation > `/gnu/store/c56fwipfpdpii95420xcwf3vamy3n2pa-python-3.7.0.drv': 1 > dependencies couldn't be built > cannot build derivation > `/gnu/store/3v425ipvhz4w2rll3phfzhq5kpaczwg4-python-wrapper-3.7.0.drv': > 1 dependencies couldn't be built > guix system: error: build failed: build of > `/gnu/store/3v425ipvhz4w2rll3phfzhq5kpaczwg4-python-wrapper-3.7.0.drv' > failed I'm on x86_64 hardware running a i686 guix Tried again and got this: building /gnu/store/c9d3ga47xx8izflj9r1xgf1y6y39yskq-python2-2.7.15.drv... @ unsupported-platform /gnu/store/c9d3ga47xx8izflj9r1xgf1y6y39yskq-python2-2.7.15.drv armhf-linux while setting up the build environment: a `armhf-linux' is required to build `/gnu/store/c9d3ga47xx8izflj9r1xgf1y6y39yskq-python2-2.7.15.drv', but I am a `i686-linux' builder for `/gnu/store/c9d3ga47xx8izflj9r1xgf1y6y39yskq-python2-2.7.15.drv' failed with exit code 1 build of /gnu/store/c9d3ga47xx8izflj9r1xgf1y6y39yskq-python2-2.7.15.drv failed View build log at '/var/log/guix/drvs/c9/d3ga47xx8izflj9r1xgf1y6y39yskq-python2-2.7.15.drv.bz2'. guix system: error: build failed: build of `/gnu/store/c9d3ga47xx8izflj9r1xgf1y6y39yskq-python2-2.7.15.drv' failed -- Cheers Swedebugia From debbugs-submit-bounces@debbugs.gnu.org Sat Dec 22 04:11:22 2018 Received: (at 33676) by debbugs.gnu.org; 22 Dec 2018 09:11:22 +0000 Received: from localhost ([127.0.0.1]:59132 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gadJa-0003S2-0a for submit@debbugs.gnu.org; Sat, 22 Dec 2018 04:11:22 -0500 Received: from dd26836.kasserver.com ([85.13.145.193]:48066) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gadJY-0003Rv-PN for 33676@debbugs.gnu.org; Sat, 22 Dec 2018 04:11:21 -0500 Received: from localhost (77.117.128.10.wireless.dyn.drei.com [77.117.128.10]) by dd26836.kasserver.com (Postfix) with ESMTPSA id C35E233606B0; Sat, 22 Dec 2018 10:11:14 +0100 (CET) Date: Sat, 22 Dec 2018 10:11:06 +0100 From: Danny Milosavljevic To: swedebugia@riseup.net Subject: Re: bug#33676: GuixSD on eoma68-a20? Message-ID: <20181222101106.07da06e4@scratchpost.org> In-Reply-To: References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> <20181210113014.0e4e76eb@scratchpost.org> <20181210211224.GA7317@jurong> <20181222000957.424e2213@scratchpost.org> X-Mailer: Claws Mail 3.17.1 (GTK+ 2.24.32; x86_64-unknown-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; boundary="Sig_/8Qx.aIs1CIlsmoFOc3cOlsh"; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --Sig_/8Qx.aIs1CIlsmoFOc3cOlsh Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable Did you reconfigure? # guix system reconfigure /etc/config.scm If so, that's weird. >I'm on x86_64 hardware running a i686 guix Yeah, "--system" is using qemu to emulate the target architecture and the b= uild job then runs in there. --Sig_/8Qx.aIs1CIlsmoFOc3cOlsh Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEds7GsXJ0tGXALbPZ5xo1VCwwuqUFAlwd/6oACgkQ5xo1VCww uqUx1gf9Gyfvt4+Nj9wGfEFbfbTTlTJrMX66VOMisLdcA+JVXFszroOh0yo9tiUu DXPPbX0eOF/u2GqSFDOTLHunBaWTnyfViZjISAhHAO0/MZPXydGLSDEhpHli2Su0 /9722Lv7h7VuMHYr921ShfV2oZ50x2qm8IRK+Od4v6QWgIyVinUDIoaOxWxItfIY +wrRSfvtHLHKZL6SYaxmr6iCmD2VKELEsUO7AVkNSQKaYp1MJW1jKhmXyJxJRaTN MLXkiLcos7n1fXnel1JqvRbR586BpKvlj0zXo0xj2zZYrzFiwiik8YOciC17qreA 6vWO9whQluMNGIGYsonxLbj8JWj5Ow== =QO8g -----END PGP SIGNATURE----- --Sig_/8Qx.aIs1CIlsmoFOc3cOlsh-- From debbugs-submit-bounces@debbugs.gnu.org Sun Dec 23 00:09:30 2018 Received: (at 33676) by debbugs.gnu.org; 23 Dec 2018 05:09:30 +0000 Received: from localhost ([127.0.0.1]:60409 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gaw14-0002aZ-Ms for submit@debbugs.gnu.org; Sun, 23 Dec 2018 00:09:30 -0500 Received: from mx1.riseup.net ([198.252.153.129]:51092) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gaw13-0002aR-Fw for 33676@debbugs.gnu.org; Sun, 23 Dec 2018 00:09:29 -0500 Received: from piha.riseup.net (piha-pn.riseup.net [10.0.1.163]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "COMODO RSA Domain Validation Secure Server CA" (verified OK)) by mx1.riseup.net (Postfix) with ESMTPS id 8C9B41A01A4; Sat, 22 Dec 2018 21:09:27 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1545541769; bh=0UFcalryB+/xj+A+HJ0GtRhLTnv539TJyzJW+mAR2+E=; h=Date:From:To:Cc:Subject:In-Reply-To:References:From; b=TnTDTVr8CB5eEOX0nvt0p33u/yQZq0C26mROm6UYtN/vMP858eZp7RzQ5v81nvCJB gyb+AEuFiCVNHNsnbwCfVzPEgJ7H5H4OzChpjOP+2Tqe3H+HJUcVoW65pGqsbcTmx6 g7hRtSrl7lXizDmYuB0jPq8Aw638IISKkmoOF27I= X-Riseup-User-ID: B9993DAFA297C5D215EA87DEF223797C0975636D37996AB5D252080FE5CA87C1 Received: from [127.0.0.1] (localhost [127.0.0.1]) by piha.riseup.net with ESMTPSA id 2BC182F86D; Sat, 22 Dec 2018 21:09:27 -0800 (PST) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit Date: Sat, 22 Dec 2018 21:09:26 -0800 From: swedebugia@riseup.net To: Danny Milosavljevic Subject: Re: bug#33676: GuixSD on eoma68-a20? In-Reply-To: <20181222094411.3e8fd6cd@scratchpost.org> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> <20181210113014.0e4e76eb@scratchpost.org> <20181210211224.GA7317@jurong> <20181222000957.424e2213@scratchpost.org> ; <20181222094411.3e8fd6cd@scratchpost.org> Message-ID: <139d0a5a952f3b4c59c0d6534643f9ce@riseup.net> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, Andreas Enge , 33676@debbugs.gnu.org, ludo@gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) On 2018-12-22 09:44, Danny Milosavljevic wrote: > Please add to your /etc/config.scm to the "services" section: > > (service qemu-binfmt-service-type > (qemu-binfmt-configuration > (platforms (lookup-qemu-platforms "arm")) > (guix-support? #t))) Thanks. Added, reconfigured and now it is building away happily. Will report back how it goes... -- Cheers Swedebugia From debbugs-submit-bounces@debbugs.gnu.org Sun Dec 23 03:54:43 2018 Received: (at 33676) by debbugs.gnu.org; 23 Dec 2018 08:54:43 +0000 Received: from localhost ([127.0.0.1]:60505 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gazX0-00088I-Qv for submit@debbugs.gnu.org; Sun, 23 Dec 2018 03:54:43 -0500 Received: from mx1.riseup.net ([198.252.153.129]:38145) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gazWz-00088A-5g for 33676@debbugs.gnu.org; Sun, 23 Dec 2018 03:54:41 -0500 Received: from cotinga.riseup.net (cotinga-pn.riseup.net [10.0.1.164]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "COMODO RSA Domain Validation Secure Server CA" (verified OK)) by mx1.riseup.net (Postfix) with ESMTPS id 07FF31A04BF; Sun, 23 Dec 2018 00:54:39 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1545555280; bh=+Gj5aZExjpG9jyJbu8jBDJlGIIWbKzqhKlOwp71R+4c=; h=Date:From:To:Cc:Subject:In-Reply-To:References:From; b=npJR5e/3nV3YA3L8BDFjbPPIGoeQ7EQE7CSI0GolVAevmpsvOEOP5HicgZcTM921f gNmiH0aH4UQfb2DULELhUQ+pOAA/GDB0yYc5toUp4Zuh/OJiwUw0HRMJ+xioNVc9NP PHTiu1N2Nzabq/voLRyomXd6FT+CKuwVTgGSfl7M= X-Riseup-User-ID: BEE32ED6FB08265FE822869FA147E3081EA4F591D9761F38BA11310472D794BF Received: from [127.0.0.1] (localhost [127.0.0.1]) by cotinga.riseup.net with ESMTPSA id AFED6105621; Sun, 23 Dec 2018 00:54:39 -0800 (PST) MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Date: Sun, 23 Dec 2018 00:54:39 -0800 From: swedebugia@riseup.net To: Danny Milosavljevic Subject: Re: bug#33676: GuixSD on eoma68-a20? In-Reply-To: <139d0a5a952f3b4c59c0d6534643f9ce@riseup.net> References: <68f9fc17-94f5-dcc2-f54d-61d6e2bf384d@riseup.net> <20181208181214.2308472a@scratchpost.org> <20181209215126.GA10968@jurong> <20181210113014.0e4e76eb@scratchpost.org> <20181210211224.GA7317@jurong> <20181222000957.424e2213@scratchpost.org> ; <20181222094411.3e8fd6cd@scratchpost.org> <139d0a5a952f3b4c59c0d6534643f9ce@riseup.net> Message-ID: X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: guix-devel@gnu.org, Guix-devel , 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) On 2018-12-23 06:09, swedebugia@riseup.net wrote: > On 2018-12-22 09:44, Danny Milosavljevic wrote: >> Please add to your /etc/config.scm to the "services" section: >> >> (service qemu-binfmt-service-type >> (qemu-binfmt-configuration >> (platforms (lookup-qemu-platforms "arm")) >> (guix-support? #t))) > > Thanks. > > Added, reconfigured and now it is building away happily. Will report > back how it goes... It took a long long time to compile python2.7 and failed a 1 test in the end. 356 tests OK. 1 test failed: test_mmap 39 tests skipped: test_aepack test_al test_applesingle test_bsddb test_bsddb185 test_bsddb3 test_cd test_cl test_codecmaps_cn test_codecmaps_hk test_codecmaps_jp test_codecmaps_kr test_codecmaps_tw test_curses test_dl test_gdb test_gl test_imgfile test_ioctl test_kqueue test_linuxaudiodev test_macos test_macostools test_msilib test_nis test_ossaudiodev test_scriptpackages test_smtpnet test_socketserver test_startfile test_sunaudiodev test_timeout test_tk test_ttk_guionly test_urllib2net test_urllibnet test_winreg test_winsound test_zipfile64 4 skips unexpected on linux2: test_bsddb test_bsddb3 test_gdb test_ioctl Total duration: 55 min 1 sec Tests result: FAILURE make: *** [Makefile:878: test] Error 2 Test suite failed, dumping logs. Backtrace: 4 (primitive-load "/gnu/store/dbh5r09sm7hw8jjmxvgmjks9h2q…") In ice-9/eval.scm: 191:35 3 (_ _) In srfi/srfi-1.scm: 863:16 2 (every1 # …) In /gnu/store/diwcb1v9lr156sg3q4ww1wvsniw4n6rf-module-import/guix/build/gnu-build-system.scm: 799:28 1 (_ _) 369:6 0 (check #:target _ #:make-flags _ #:tests? _ # _ # _ # _) /gnu/store/diwcb1v9lr156sg3q4ww1wvsniw4n6rf-module-import/guix/build/gnu-build-system.scm:369:6: In procedure check: Throw to key `srfi-34' with args `(#)'. builder for `/gnu/store/c9d3ga47xx8izflj9r1xgf1y6y39yskq-python2-2.7.15.drv' failed with exit code 1 build of /gnu/store/c9d3ga47xx8izflj9r1xgf1y6y39yskq-python2-2.7.15.drv failed View build log at '/var/log/guix/drvs/c9/d3ga47xx8izflj9r1xgf1y6y39yskq-python2-2.7.15.drv.bz2'. guix system: error: build failed: build of `/gnu/store/c9d3ga47xx8izflj9r1xgf1y6y39yskq-python2-2.7.15.drv' failed ------------- fail details: 0:27:38 load avg: 1.19 [216/396] test_mmap test test_mmap failed -- Traceback (most recent call last): File "/tmp/guix-build-python2-2.7.15.drv-0/Python-2.7.15/Lib/test/test_mmap.py", line 696, in test_large_offset self.assertEqual(m[0xFFFFFFF], b" ") AssertionError: '\x00' != ' ' 0:27:40 load avg: 1.18 [217/396/1] test_module -- test_mmap failed I'm on i386. Will try again when I succeded in disabling the test. -- Cheers Swedebugia From debbugs-submit-bounces@debbugs.gnu.org Tue Apr 07 09:45:39 2020 Received: (at 33676) by debbugs.gnu.org; 7 Apr 2020 13:45:39 +0000 Received: from localhost ([127.0.0.1]:49746 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jLoXq-0004Bk-SJ for submit@debbugs.gnu.org; Tue, 07 Apr 2020 09:45:39 -0400 Received: from wout5-smtp.messagingengine.com ([64.147.123.21]:38333) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jLoXq-0004BG-1s for 33676@debbugs.gnu.org; Tue, 07 Apr 2020 09:45:38 -0400 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.west.internal (Postfix) with ESMTP id 2AB3A60F; Tue, 7 Apr 2020 09:45:32 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute4.internal (MEProxy); Tue, 07 Apr 2020 09:45:32 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=oFlBzow8vlQarbfp7HH9NvEeDD 8HM772KkzpgXY/MoY=; b=n7hWQ8s0xitJS781iVhA/BPAIdTksoM/wlQiFGdhNH VovI7SUKy9dAWaJcmw0md51CXCtZ+6WjgpJMQ6JPIqtTdUSlmrvNh/Cm47xRLN62 2um6oRG/Tn+IAOxf6nIdDxrK31+0COITE1vrC+yArLZkvyCkwTGOF+WczIL2sqSh tzSay689triVouRAYlSW1rRGrQFv/IPBhF6S4DDDPmHVDwntYiCNUEkKf+5ajumW 62/VnjqNnfq4imiL7AsTq49/9BsvUbV0hjduX/Qr+0HAEkV8Ux3t4OUaR9M5yIj6 MqxIipfG6WgusJW4sTEskMYCodQkjmXDgKqyplbztVSg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=oFlBzo w8vlQarbfp7HH9NvEeDD8HM772KkzpgXY/MoY=; b=EVtx1091FGTFYIjS1I1Ysa q4fXHB10Q+mGYJmD2Ik6cwYi7LjVD0JUCrUpbrO1JPHUzw/wiaZumgmFPX2zS/+A XpBUQH/0/Gvwx+TLTfL0izuG9ZeGfdt8qXlijQF7+9zXlxtQEPbEuErGnoBchB2Y r0yq5LWDQ8wPWzx2Rl/RVyNtXkzL0GFIE+QLLVL2qCXfUNoYiAwjJepq3tPOo6od cPm3QXQY/o53yJDdPPTXk5jVZ70V1vSSCieuJFKX+eERlWvn8mXRWUamCGJMVTX9 ZVyk/cPXdsrWl/GPwUS2edGkhaCL94XR5iI1hU6V8c4o7Nwr+uwRrHaYZkEAMeQg == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduhedrudehgdeijecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenuc fjughrpefhvffujghffgffkfggtgesthdtredttdertdenucfhrhhomhepofgrrhhiuhhs uceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheqnecukfhppeekge drvddtvddrieekrdejheenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgr ihhlfhhrohhmpehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhm X-ME-Proxy: Received: from localhost (ti0006q161-2604.bb.online.no [84.202.68.75]) by mail.messagingengine.com (Postfix) with ESMTPA id 3957B3280064; Tue, 7 Apr 2020 09:45:31 -0400 (EDT) From: Marius Bakke To: Danny Milosavljevic Subject: Re: bug#33676: GuixSD on eoma68-a20? In-Reply-To: <20181222000553.06980837@scratchpost.org> References: <20181208181214.2308472a@scratchpost.org> <20181222000553.06980837@scratchpost.org> User-Agent: Notmuch/0.29.3 (https://notmuchmail.org) Emacs/26.3 (x86_64-pc-linux-gnu) Date: Tue, 07 Apr 2020 15:45:29 +0200 Message-ID: <87zhbnmmti.fsf@devup.no> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676 Cc: 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Is this bug report still relevant? From debbugs-submit-bounces@debbugs.gnu.org Tue Apr 07 11:18:14 2020 Received: (at 33676) by debbugs.gnu.org; 7 Apr 2020 15:18:14 +0000 Received: from localhost ([127.0.0.1]:50690 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jLpzS-0002Pc-9l for submit@debbugs.gnu.org; Tue, 07 Apr 2020 11:18:14 -0400 Received: from sender4-of-o53.zoho.com ([136.143.188.53]:21357) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jLpzP-0002PN-GQ for 33676@debbugs.gnu.org; Tue, 07 Apr 2020 11:18:13 -0400 ARC-Seal: i=1; a=rsa-sha256; t=1586272687; cv=none; d=zohomail.com; s=zohoarc; b=hD3q4FB66/FKzPC56iQsRYKY2XJVQd/k4WjAb3NpC+SwXHzTChzJGx6uLVofA+nuPrPCTQLgv6IdC65f8GCiX1mzJxhX0zivh2b2LKBTME7EtqMMRbjABoYJ4WAFfHO6NoBxp+l65EnkroXADGdPLXNRDhz6LtNUHcZQUjtgbpo= ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=zohomail.com; s=zohoarc; t=1586272687; h=Content-Type:Content-Transfer-Encoding:Cc:Date:From:In-Reply-To:MIME-Version:Message-ID:References:Subject:To; bh=5OT+RZp+rOjE0d1lNLLGoop1t8izg/qUMAYx9y69eZU=; b=mCr0xjhUwV0EFPKKf41dloo1qEBrN8eplaZvF1wk6cc8TYFtiuhXSb0vl5CWIpLjtE0davp4TE26arEcDCS6qJFb5LvfYikyFz/Lbevvei2pnF/slAcCl4RHfuN9HMBb5sv3iaYKSAzm3P4eyI38UX9JMa8ab/j4UnnKmoN5GWY= ARC-Authentication-Results: i=1; mx.zohomail.com; dkim=pass header.i=elephly.net; spf=pass smtp.mailfrom=rekado@elephly.net; dmarc=pass header.from= header.from= DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; t=1586272687; s=zoho; d=elephly.net; i=rekado@elephly.net; h=References:From:To:Cc:Subject:In-reply-to:Date:Message-ID:MIME-Version:Content-Type:Content-Transfer-Encoding; bh=5OT+RZp+rOjE0d1lNLLGoop1t8izg/qUMAYx9y69eZU=; b=XJ6lUHfvJg1uav5DWSx6ro1kUfZ8ppUNYnAYlYoiu5S/lLbiIGS/N+7DE+BQpjtW snrw0mXnxYa6Wq7UDkOlWloDJh1cREhDXUYNhxtpsGZ7gSkvYrtnbtIokuZ4hAv/Zft K+eadziFju4gqFUHENrwe5kdDDGnesQEU9iy0eQk= Received: from localhost (p54AD4DB3.dip0.t-ipconnect.de [84.173.77.179]) by mx.zohomail.com with SMTPS id 1586272682710594.0589128331032; Tue, 7 Apr 2020 08:18:02 -0700 (PDT) References: <20181208181214.2308472a@scratchpost.org> <20181222000553.06980837@scratchpost.org> <87zhbnmmti.fsf@devup.no> User-agent: mu4e 1.2.0; emacs 26.3 From: Ricardo Wurmus To: Marius Bakke Subject: Re: bug#33676: GuixSD on eoma68-a20? In-reply-to: <87zhbnmmti.fsf@devup.no> X-URL: https://elephly.net X-PGP-Key: https://elephly.net/rekado.pubkey X-PGP-Fingerprint: BCA6 89B6 3655 3801 C3C6 2150 197A 5888 235F ACAC Date: Tue, 07 Apr 2020 17:17:58 +0200 Message-ID: <871rozwcih.fsf@elephly.net> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-ZohoMailClient: External X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 33676 Cc: Danny Milosavljevic , 33676@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Marius Bakke writes: > Is this bug report still relevant? The EOMA68-A20 board still hasn=E2=80=99t been completed, so I think it=E2= =80=99s fine to close this bug report. --=20 Ricardo From debbugs-submit-bounces@debbugs.gnu.org Tue Apr 07 11:33:18 2020 Received: (at 33676-close) by debbugs.gnu.org; 7 Apr 2020 15:33:18 +0000 Received: from localhost ([127.0.0.1]:50712 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jLqE2-0003HV-ER for submit@debbugs.gnu.org; Tue, 07 Apr 2020 11:33:18 -0400 Received: from wout2-smtp.messagingengine.com ([64.147.123.25]:51185) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jLqDz-0003Gx-Ng for 33676-close@debbugs.gnu.org; Tue, 07 Apr 2020 11:33:16 -0400 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.west.internal (Postfix) with ESMTP id DA5415E1; Tue, 7 Apr 2020 11:33:09 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute4.internal (MEProxy); Tue, 07 Apr 2020 11:33:10 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=o+IcPfy0dkNd/fwz3c1Mm+kxdP FXbGjUV9Jcddz9TxQ=; b=txGzFdDznKdsmsEgCAiXdqG/CxFTwqRuyoPsHlkDiP Yxicsh8dqTVMOaDqd/Du5LDiIT1h1nABHwqHGxoAPkWwavjTyJv3UUgAOBtav+Yc wEYZ/o3AeuekbLQmAF6ukXDLf+gn4Rev5FOia0J4JxM2UmtwCQAfIf1/D6/EWLGK PGr62KylPMIqCSQ1hZ+LDjaIS+lL583pFmyBg9k42yxgIH/36SoNzjZaS7u1AZVy Vm6qR50dNf8PPwqi4pOmrDIoaD19tTnQpEatvSmFch2khFprrFsOgJvWisdhuhqK Iu7XBx2kF9giHlrg9UNrG1jnEIs5DaI8xrQmQ9DRMYbQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=o+IcPf y0dkNd/fwz3c1Mm+kxdPFXbGjUV9Jcddz9TxQ=; b=el/yyjINaT6NwxdrdMTXjE rV8n31G7GLk/9kdAtZRLy/4fqGVXd6Tf4vohNd7HcyVKzYQhdUcXcmFQ6LRwcGlT ULAN1IrG74mpVKlQ9vPm+AgRoFQHgqFqqua+K+QPMptN0AHlujB1r7Bnr9OU7qb+ UEO2qpMUormjQvHZHHo4SLzF0HSrtgaa7040BRpJ4UCG0Yt0H493LBs96eZqu8Tv zROT1U5wxBLgCWgrVCOnnfw/IYJbGVhikUPfBDLvTAYhGXdKqkjAyxV/tBAeaASB sEDOXwIImZ+jcpLzMq0bAxzEHEc6sKeAc+dCtZTy7/5GaXVwGuQDoiaRaEuRhBIw == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduhedrudehgdekkecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenuc fjughrpefhvffujghffgffkfggtgesghdtreertderjeenucfhrhhomhepofgrrhhiuhhs uceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheqnecukfhppeekge drvddtvddrieekrdejheenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgr ihhlfhhrohhmpehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhm X-ME-Proxy: Received: from localhost (ti0006q161-2604.bb.online.no [84.202.68.75]) by mail.messagingengine.com (Postfix) with ESMTPA id C21193280059; Tue, 7 Apr 2020 11:33:08 -0400 (EDT) From: Marius Bakke To: Ricardo Wurmus Subject: Re: bug#33676: GuixSD on eoma68-a20? In-Reply-To: <871rozwcih.fsf@elephly.net> References: <20181208181214.2308472a@scratchpost.org> <20181222000553.06980837@scratchpost.org> <87zhbnmmti.fsf@devup.no> <871rozwcih.fsf@elephly.net> User-Agent: Notmuch/0.29.3 (https://notmuchmail.org) Emacs/26.3 (x86_64-pc-linux-gnu) Date: Tue, 07 Apr 2020 17:33:07 +0200 Message-ID: <87r1wzmhu4.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 33676-close Cc: Danny Milosavljevic , 33676-close@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Ricardo Wurmus writes: > Marius Bakke writes: > >> Is this bug report still relevant? > > The EOMA68-A20 board still hasn=E2=80=99t been completed, so I think it= =E2=80=99s fine > to close this bug report. OK. There has been quite a lot of work getting Guix System running on various boards since this was opened, so I don't expect porting to EOMA68-A20 to be particularily problematic. Closing for now. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl6MnTMACgkQoqBt8qM6 VPoiLQgAtPAX45+rCs0jThXM3YF4WaZ6aGUz30+KCy1ks9Z3UlgMGj06sbieMJlO osaxlLEERifBTVGbpgCgTHoTcMiEuB/oD6KFd6/piayDRJBpiLrjs0YTuU/gP6YE n1QGAKc6Z5NhKcBYaYc/tiChpjun8qP3Z6zI3LJTri2d3pN3yyCpTdyqPO9E20Nt GVOtx6k/kQfZ18SStNQuK67NmHLvIEWNCtayJ1u/8cXLXVPrIi7K/cOfk5IgcDH0 FXuLTaS0UUvnAhSJiprVnfgNpaXOfe6bYAuSSwbX2NR+OQY/gZTEN1/0/Lek+VFZ KIHnWuTijv97kPbz/V4FpxHtYrIM8g== =PzK6 -----END PGP SIGNATURE----- --=-=-=-- From unknown Thu Aug 14 12:21:02 2025 Received: (at fakecontrol) by fakecontrolmessage; To: internal_control@debbugs.gnu.org From: Debbugs Internal Request Subject: Internal Control Message-Id: bug archived. Date: Wed, 06 May 2020 11:24:07 +0000 User-Agent: Fakemail v42.6.9 # This is a fake control message. # # The action: # bug archived. thanks # This fakemail brought to you by your local debbugs # administrator