From unknown Sat Aug 16 13:46:12 2025 X-Loop: help-debbugs@gnu.org Subject: bug#33497: Our CMake package has no documentation Resent-From: Maxim Cournoyer Original-Sender: "Debbugs-submit" Resent-CC: bug-guix@gnu.org Resent-Date: Sun, 25 Nov 2018 06:50:03 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: report 33497 X-GNU-PR-Package: guix X-GNU-PR-Keywords: To: 33497@debbugs.gnu.org X-Debbugs-Original-To: bug-guix Received: via spool by submit@debbugs.gnu.org id=B.15431285701796 (code B ref -1); Sun, 25 Nov 2018 06:50:03 +0000 Received: (at submit) by debbugs.gnu.org; 25 Nov 2018 06:49:30 +0000 Received: from localhost ([127.0.0.1]:46008 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gQoEU-0000Su-Iu for submit@debbugs.gnu.org; Sun, 25 Nov 2018 01:49:30 -0500 Received: from eggs.gnu.org ([208.118.235.92]:57009) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gQoES-0000Sg-EK for submit@debbugs.gnu.org; Sun, 25 Nov 2018 01:49:29 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gQoEM-0002GA-IW for submit@debbugs.gnu.org; Sun, 25 Nov 2018 01:49:23 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,FREEMAIL_FROM autolearn=disabled version=3.3.2 Received: from lists.gnu.org ([2001:4830:134:3::11]:55854) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1gQoEM-0002G2-Fx for submit@debbugs.gnu.org; Sun, 25 Nov 2018 01:49:22 -0500 Received: from eggs.gnu.org ([2001:4830:134:3::10]:38377) by lists.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1gQoEL-0004qe-Rg for bug-guix@gnu.org; Sun, 25 Nov 2018 01:49:22 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gQoEG-0002E4-Sv for bug-guix@gnu.org; Sun, 25 Nov 2018 01:49:21 -0500 Received: from mail-it1-x129.google.com ([2607:f8b0:4864:20::129]:36405) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_128_CBC_SHA1:16) (Exim 4.71) (envelope-from ) id 1gQoEG-0002Dk-OM for bug-guix@gnu.org; Sun, 25 Nov 2018 01:49:16 -0500 Received: by mail-it1-x129.google.com with SMTP id c9so23003433itj.1 for ; Sat, 24 Nov 2018 22:49:16 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:to:subject:date:message-id:user-agent:mime-version; bh=y3aqZ/DB712IjzDQ+TnxXO0APkgZXfZo9w1yTNK2K/U=; b=LFCHZr2JpFLVt4rEwdkcfyIt6Drwcx8LfgQoxe5+hUW1fk2XglxsridKKh4xeVhhFx vLvnw1Owb9jcTqgv1rGFIWC9mPWqE5jazXGLo1TRPvlCwxL7otpar6sUdzsXZrXltHXR Ots0xZSjasLHuyE8P+g7aiQBU8etrPVBK4Aw3MtkGzTUKoxIYEKUyBK4yQWgUWJV/ogF w90gIPYbe2TXdEGmHLiVLVv2DqhBEbE2SueVXzzXJfmm5nn6G45uMNOgT4HTECGFRD2x fiYm4+L/WHOYVUBMEgPdAeBkRJJTpKyQ0fYJPfjNFABC4Hj0ryIMuRUViPiIVLn701gl LANQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:to:subject:date:message-id:user-agent :mime-version; bh=y3aqZ/DB712IjzDQ+TnxXO0APkgZXfZo9w1yTNK2K/U=; b=DXv6LEQjMlXddSYPs431rJzrCjEh+jTP9dXaxg8uxRFeTlTeNLrInX7kFWdpapPy3w CWRlIyMvsCc6lmSckzku3j+G2kaZUoz5TxKOOl4tHLa5J8krTYg0EbP5jvak1TIYoSBg winasFru8ahZRSLWIIlhOgB2cFC9QXbLNsRx1PCzRrRI8QRgS+9YIwd5E5v4PjJ3vrW+ puvcqf+e0deZNyXl3NBt80sQO2j1SBMEhC4zHQSibYZcZUj2v+mqKcWIRm43FQ3pDjV1 xqF6weKb0rNNdZ8JsMsJUXfUmgTU43ysYIC1fkPu8v9RPtvwCQgj1coTZQhGVFobm/60 Or2w== X-Gm-Message-State: AA+aEWYxWpkYGxEP9lzzE8285v7LIxH0zdTD6vNLyQ+IChbki/jAWGXv 7SU8NTzjru9DiL7NUzw1FfzfFb/8ZuM= X-Google-Smtp-Source: AJdET5feOEEceVZmrudLlEViDT+9jiSNQkjmUyGUwhSxqZEbxRR5FzI56PlYX0mE6aSeimTq7M1yVQ== X-Received: by 2002:a24:5989:: with SMTP id p131-v6mr18006565itb.0.1543128555773; Sat, 24 Nov 2018 22:49:15 -0800 (PST) Received: from apteryx ([45.72.138.75]) by smtp.gmail.com with ESMTPSA id q197sm2844957itb.22.2018.11.24.22.49.14 for (version=TLS1_2 cipher=ECDHE-RSA-CHACHA20-POLY1305 bits=256/256); Sat, 24 Nov 2018 22:49:14 -0800 (PST) From: Maxim Cournoyer X-Google-Original-From: Maxim Cournoyer Date: Sun, 25 Nov 2018 01:49:10 -0500 Message-ID: <8736rp649l.fsf@apteryx.i-did-not-set--mail-host-address--so-tickle-me> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-detected-operating-system: by eggs.gnu.org: Genre and OS details not recognized. X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.6.x X-Received-From: 2001:4830:134:3::11 X-Spam-Score: -4.0 (----) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -5.0 (-----) Hello, Our CMake package lacks any documentation (manpage or other). Patch to follow. Maxim From unknown Sat Aug 16 13:46:12 2025 X-Loop: help-debbugs@gnu.org Subject: bug#33497: [PATCH] Re: bug#33497: Our CMake package has no documentation Resent-From: Maxim Cournoyer Original-Sender: "Debbugs-submit" Resent-CC: bug-guix@gnu.org Resent-Date: Sun, 25 Nov 2018 06:56:01 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 33497 X-GNU-PR-Package: guix X-GNU-PR-Keywords: To: 33497@debbugs.gnu.org Received: via spool by 33497-submit@debbugs.gnu.org id=B33497.15431289042936 (code B ref 33497); Sun, 25 Nov 2018 06:56:01 +0000 Received: (at 33497) by debbugs.gnu.org; 25 Nov 2018 06:55:04 +0000 Received: from localhost ([127.0.0.1]:46013 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gQoJs-0000lH-7m for submit@debbugs.gnu.org; Sun, 25 Nov 2018 01:55:04 -0500 Received: from mail-it1-f172.google.com ([209.85.166.172]:50648) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gQoJq-0000kh-F0 for 33497@debbugs.gnu.org; Sun, 25 Nov 2018 01:55:02 -0500 Received: by mail-it1-f172.google.com with SMTP id z7so6180441iti.0 for <33497@debbugs.gnu.org>; Sat, 24 Nov 2018 22:55:02 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:to:subject:references:date:in-reply-to:message-id:user-agent :mime-version; bh=F6Bb5PrMGXQ6xK3GV67MEIigrwuAeJDS6Fdzjw0uhnQ=; b=VAc6nkbCvHirBEAZ5nU6iYM1OXDr+dIk2a7DNEjfIUk917jTczD4BQSyihoU6hNKxV rgc2YhjKSZiGgRXmoKt5dwqcMcNKmQshYduxj35iGZEtQILrpePitPQzQ0W0+vToyKc7 wIzudSOXkVutiVECq1SMs4Fn3W7WBbELwzq8Xnhq+VYvdzlAkqtgbi0vuurRqvoizFnt KEoz06xtwAwYloZEBVYbPB0ztdPsYsYBA02E20lu5+zOmIHZfsn/daZaDdaYliPfYuSg o3cpSCp8aGLlFliGLYAIx5g3Tdd4/fWnkkrFsdT5yMm9PMjTS0vXyusnaSxwJywKfvoD +a5A== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:to:subject:references:date:in-reply-to :message-id:user-agent:mime-version; bh=F6Bb5PrMGXQ6xK3GV67MEIigrwuAeJDS6Fdzjw0uhnQ=; b=Dd8CUcsXVT0N7Oj1iEw8GWPKpL2DyEpFa1gm2tMnG6yjlkWIcRiUPnVG58VEltpkkW Y3XojEPcR6YUThTvYOAZUKbIIbYebK2sqv3TlZSFpyO0/AGIavhQUjqChFJAH9mq6beb X9uD1zF1IfK/6SGq9aFXwKax9f+uYGoUCxjoLctmtisrTSUwbAS4SS/Teei22YiJbSGF nQO+7PV2w94Ei7UnB9vuQmPqQRdfGmj2RWLNzHvSjDHB9N4y1BSgl2rjNR1SHHuzgfnm bQJCpcMpOQVyKYckXBnFNFqfUQf0OyWFj0UW0DqT9jfAJp7DpZkg7/bjXIHhxoz9pWE1 D9Qw== X-Gm-Message-State: AA+aEWYJ0cG8Dg6izFbaQw5KVM85HHIW2m+R4L2gUxAbRwhJu9DgK4mf /fobGpJhEE7/+O36qgFAGcbMaYkw574= X-Google-Smtp-Source: AFSGD/WZKhxpx2/CKih+P0QwD6i+A5c2pIQcQbKSsmr++xX5zutBJMMTFiSTq8QXEM0XDSLaQ8Qx7A== X-Received: by 2002:a02:9951:: with SMTP id d17mr18675063jak.134.1543128896470; Sat, 24 Nov 2018 22:54:56 -0800 (PST) Received: from apteryx ([45.72.138.75]) by smtp.gmail.com with ESMTPSA id q23sm9749577ioi.66.2018.11.24.22.54.55 for <33497@debbugs.gnu.org> (version=TLS1_2 cipher=ECDHE-RSA-CHACHA20-POLY1305 bits=256/256); Sat, 24 Nov 2018 22:54:55 -0800 (PST) From: Maxim Cournoyer References: <8736rp649l.fsf@apteryx.i-did-not-set--mail-host-address--so-tickle-me> Date: Sun, 25 Nov 2018 01:54:55 -0500 In-Reply-To: <8736rp649l.fsf@apteryx.i-did-not-set--mail-host-address--so-tickle-me> (Maxim Cournoyer's message of "Sun, 25 Nov 2018 01:49:10 -0500") Message-ID: <87y39h4pfk.fsf@gmail.com> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="=-=-=" X-Spam-Score: 0.0 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --=-=-= Content-Type: text/plain Maxim Cournoyer writes: > Hello, > > Our CMake package lacks any documentation (manpage or other). Patch to > follow. > > Maxim Here's the patch to be merged in core-updates (or core-updates-next). --=-=-= Content-Type: text/x-patch Content-Disposition: attachment; filename=0001-gnu-cmake-Generate-the-documentation.patch >From 07625983cd901c94e4ac25b157035c95e33a115e Mon Sep 17 00:00:00 2001 From: Maxim Cournoyer Date: Sun, 25 Nov 2018 01:39:54 -0500 Subject: [PATCH] gnu: cmake: Generate the documentation. This fixes https://bugs.gnu.org/33497. * gnu/packages/cmake.scm (gnu): Use the (gnu package python) and (gnu packages texinfo) modules. (cmake)[configure]: Add arguments to configure so that manual pages, info and HTML documentation is generated. [move-html-doc]: New phase. [native-inputs]: Add the native inputs required for building the documentation. [outputs]: Add a "doc" output. --- gnu/packages/cmake.scm | 22 +++++++++++++++++++++- 1 file changed, 21 insertions(+), 1 deletion(-) diff --git a/gnu/packages/cmake.scm b/gnu/packages/cmake.scm index 5abf08755..36e887c51 100644 --- a/gnu/packages/cmake.scm +++ b/gnu/packages/cmake.scm @@ -38,7 +38,9 @@ #:use-module (gnu packages curl) #:use-module (gnu packages file) #:use-module (gnu packages libevent) + #:use-module (gnu packages python) #:use-module (gnu packages ncurses) + #:use-module (gnu packages texinfo) #:use-module (gnu packages xml)) (define-public cmake @@ -136,7 +138,21 @@ "--mandir=share/man" ,(string-append "--docdir=share/doc/cmake-" - (version-major+minor version))))))))) + (version-major+minor version)) + "--sphinx-man" + "--sphinx-html" + "--sphinx-info")))) + (add-after 'install 'move-html-doc + (lambda* (#:key outputs #:allow-other-keys) + (let ((out (assoc-ref outputs "out")) + (doc (assoc-ref outputs "doc")) + (html (string-append "/share/doc/cmake-" + ,(version-major+minor version) + "/html"))) + (copy-recursively (string-append out html) + (string-append doc html)) + (delete-file-recursively (string-append out html)) + #t)))))) (inputs `(("bzip2" ,bzip2) ("curl" ,curl) @@ -147,6 +163,10 @@ ("ncurses" ,ncurses) ; required for ccmake ("rhash" ,rhash) ("zlib" ,zlib))) + (native-inputs + `(("python-sphinx" ,python-sphinx) + ("texinfo" ,texinfo))) + (outputs '("out" "doc")) (native-search-paths (list (search-path-specification (variable "CMAKE_PREFIX_PATH") -- 2.19.0 --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sun Jan 27 19:46:49 2019 Received: (at control) by debbugs.gnu.org; 28 Jan 2019 00:46:50 +0000 Received: from localhost ([127.0.0.1]:48086 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gnv4b-0006j9-MV for submit@debbugs.gnu.org; Sun, 27 Jan 2019 19:46:49 -0500 Received: from mail-io1-f54.google.com ([209.85.166.54]:36796) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gnv4Y-0006iv-AZ for control@debbugs.gnu.org; Sun, 27 Jan 2019 19:46:46 -0500 Received: by mail-io1-f54.google.com with SMTP id m19so12095910ioh.3 for ; Sun, 27 Jan 2019 16:46:46 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:date:message-id:to:subject; bh=pA6lH5t/vtfO1Bp+J7YPrjx2IiLZBxdGZl+8OiEKUK4=; b=nB7956JcCxO+3cgI97hI23dZVsf/7kLFQf4pXezhyNppYzCMt2j5sXeGDkMv5teYxS +Gldv9Y0ZKOUQJwAiMKbkyOQMuXbQqMikQGIRKUd7mfAheA7niQnDJ5VBm4ZapTZOoNf dS3t8D+i+XD6XRLIpSlfMLUrQVwCP/ka8mkDvTR90uBm+ZQw1RQwUyju+7KnyTy+fG02 jtQ7Pc/YrfizuhQNlRunXhGUOr9oPtXUxoxi4nT7UE23Xt9MARAk2egQoLjn0yBUcLhe 3XTDjpyZe6R7MJRp3JWdWw2XITw4TIWEzpzN1wDpP7O2UqoNXhlSnzAdrEuG9TfJbqWJ FNxA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:date:message-id:to:subject; bh=pA6lH5t/vtfO1Bp+J7YPrjx2IiLZBxdGZl+8OiEKUK4=; b=HMr47eR0fgQG3/XVgIgjt8y0DCd/mSkqD2/DY0Sw6++gA2XJW8SW7L3txT0yFmiClq C6Wn6mUZvvsswWpxgX836mgLVdh5Kt2ARvJKWb4sTzt0eDAqvyjhZ8fafpAmyvFyrCVh k5wTI48U6YMawn1/5bJCgJGMKcQRj/75NUfSCfLm8nKzTC9iFc6jTZBgYYT5V3qF0WQn d1DdgH642eIdCbXUPs9RFl6qhkodpuLvJUHUMGL03+d3+kwOpXBeWfZwpkyIyxopJzv8 3oN90NLZmUH8zmvVkNKPJ4l6h9XU3Tn1cu+3hKri7JeCtWitGtgm/m6iEymnfs8uflsu +OZg== X-Gm-Message-State: AJcUukfclNM3LDjPZr5DzKANSYwEw+3O/Q+NRp/PpIc9JAVJlm1sqhgN zcPwmk1C3s7RT8DigAsMGh3u6el1Tl4= X-Google-Smtp-Source: ALg8bN5n/QRGBdncv0GdNq13Rz6fcDZCNmOSB6xMCy5MpWJLM8zSRsDxgSHCvjRfhDawGj/P57otcg== X-Received: by 2002:a6b:900b:: with SMTP id s11mr11572023iod.159.1548636400432; Sun, 27 Jan 2019 16:46:40 -0800 (PST) Received: from kwak (104-195-232-20.cpe.teksavvy.com. [104.195.232.20]) by smtp.gmail.com with ESMTPSA id 125sm16784050itk.28.2019.01.27.16.46.39 for (version=TLS1_2 cipher=ECDHE-RSA-CHACHA20-POLY1305 bits=256/256); Sun, 27 Jan 2019 16:46:39 -0800 (PST) From: SFL laptop X-Google-Original-From: SFL laptop Date: Sun, 27 Jan 2019 19:46:36 -0500 Message-Id: <87zhrlzk0j.fsf@kwak.i-did-not-set--mail-host-address--so-tickle-me> To: control@debbugs.gnu.org Subject: control message for bug #33497 X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: control X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) retitle 33497 [PATCH] Add doc (including info manual) for cmake From unknown Sat Aug 16 13:46:12 2025 X-Loop: help-debbugs@gnu.org Subject: bug#33497: [PATCH] Re: bug#33497: Our CMake package has no documentation Resent-From: Marius Bakke Original-Sender: "Debbugs-submit" Resent-CC: bug-guix@gnu.org Resent-Date: Tue, 12 Feb 2019 20:18:02 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 33497 X-GNU-PR-Package: guix X-GNU-PR-Keywords: To: Maxim Cournoyer , 33497@debbugs.gnu.org Received: via spool by 33497-submit@debbugs.gnu.org id=B33497.155000267228824 (code B ref 33497); Tue, 12 Feb 2019 20:18:02 +0000 Received: (at 33497) by debbugs.gnu.org; 12 Feb 2019 20:17:52 +0000 Received: from localhost ([127.0.0.1]:45262 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gteV5-0007Uq-GZ for submit@debbugs.gnu.org; Tue, 12 Feb 2019 15:17:51 -0500 Received: from out2-smtp.messagingengine.com ([66.111.4.26]:33459) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gteV2-0007Ub-Su for 33497@debbugs.gnu.org; Tue, 12 Feb 2019 15:17:50 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 9FEA722037; Tue, 12 Feb 2019 15:17:43 -0500 (EST) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Tue, 12 Feb 2019 15:17:43 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=PD2dhrHB6xGLbZ7A3EQAxfs4sD c2/AxbJ9DaK22KYQ4=; b=yflhSYy0Amoc8p3btvTmWCsQHZXP0fe77ekeIW5FWz Gp/1cp2cfj94wGMKNPu9Drm+0VtAjBlDbxT7rEBhtO5LH5fr+7+t+2rI4fLGtGwc tVwWIjiPtTTYNcnfdgn/ccJgyjPlNdrC7zoOWRuCW+CQ3r9ncIqk150a8ti5xZ78 sELNzDfqkSCMEeeSoePzeLyUoo4byeejEzgOV5UW7Po/5l/36SBMse7c4AACXr5H Omxv7vCwtbl3c8VkXwM+F1z9o15PywFBV5fTbjrKNA93kokL0bV8nedTOJnjgzWd fxq5lWVfn/lIoNGi+uD+v8595QDRb+kr93oP+FNr2NYA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=PD2dhr HB6xGLbZ7A3EQAxfs4sDc2/AxbJ9DaK22KYQ4=; b=cjQOgGh9fx9h76iMD8yaxF sspItGbvJNpKdGpuZwa/W8HxpFQKOdvbHZZVVixlnnQ3gHI+rhdELfG9Bu4TQjik EWfMv/VhrsSu/NF1F3wHEsk+XkRvsR1b0SJ0/II3c8AE5aEeRWq3kF0aGoyEp5Cj 3+Nj+v4IDc+M4z2OVdIbQa6+pygCu/Q1FgLyowr51mB8vzA2xUhFjT9mrwgWzWHH tMKzGw6rDdG8gGk+84DDrZVdW9ai3VCqn+kKC23m/VLkUF3k/36B/UlUod4mtzBV jwd2FLgpx8LiWyUnI2V7AEaHJrTjBKGr9zcdyoZXvIfYeeKwXugQh7zVhIGcgb8A == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtledruddtuddgudefhecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpqfhuthenuceurghilhhouhhtmecu fedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvufgjfh gffffkgggtsehgtderredtredtnecuhfhrohhmpeforghrihhushcuuegrkhhkvgcuoehm sggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeenucffohhmrghinhepghhnuhdrohhrgh enucfkphepiedvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhep mhgsrghkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id F2A0310317; Tue, 12 Feb 2019 15:17:42 -0500 (EST) From: Marius Bakke In-Reply-To: <87y39h4pfk.fsf@gmail.com> References: <8736rp649l.fsf@apteryx.i-did-not-set--mail-host-address--so-tickle-me> <87y39h4pfk.fsf@gmail.com> User-Agent: Notmuch/0.28.1 (https://notmuchmail.org) Emacs/26.1 (x86_64-pc-linux-gnu) Date: Tue, 12 Feb 2019 21:17:41 +0100 Message-ID: <878sykiwwq.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain Hello! Now would be the time to get this in 'core-updates'. Maxim Cournoyer writes: > Maxim Cournoyer writes: > >> Hello, >> >> Our CMake package lacks any documentation (manpage or other). Patch to >> follow. >> >> Maxim > > Here's the patch to be merged in core-updates (or core-updates-next). > > From 07625983cd901c94e4ac25b157035c95e33a115e Mon Sep 17 00:00:00 2001 > From: Maxim Cournoyer > Date: Sun, 25 Nov 2018 01:39:54 -0500 > Subject: [PATCH] gnu: cmake: Generate the documentation. > > This fixes https://bugs.gnu.org/33497. > > * gnu/packages/cmake.scm (gnu): Use the (gnu package python) and > (gnu packages texinfo) modules. > (cmake)[configure]: Add arguments to configure so that manual pages, info and > HTML documentation is generated. > [move-html-doc]: New phase. > [native-inputs]: Add the native inputs required for building the > documentation. > [outputs]: Add a "doc" output. I'm not very comfortable with pulling python-sphinx into the dependency closure of CMake, because then we can't update it or its dependencies outside of the 'core-updates' cycle. It could also cause circular dependency issues down the road. Would it make sense to build the documentation as a separate package? In that case it can go on the master branch. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlxjKeUACgkQoqBt8qM6 VPoIyAf8Cvro/9lJfa9WLIww+gJI3kXIW6trgxoqPv4pWsJS1TnRf3F1uo/S0cul aKiFgETk4ANALM4maVccsS71HfFuZpJjG5I/tQTM5CWbQCm7bNTbyM7Gz6Et+HPD APUxPb7OK22bJobihCNQuqEzPOQugsmCcbRxAfQiuBtCOw/b/7Zfs576fq7F+0iJ uixTisb0WEnZSmGeJsJma1wJ2Kpb2RDqmxKp/vKrehtiuz6qygqzaC5/WWtiC8PM UBZ0BfxTb3b31HTryhfYEp+jGLwvoHD8Lv/AAjLwaXfUAttsO9GuYvQ7+AOuIvX0 2cXA9SLlkb7vcI47pLLIrUmwIX8wgQ== =cQIx -----END PGP SIGNATURE----- --=-=-=-- From unknown Sat Aug 16 13:46:12 2025 X-Loop: help-debbugs@gnu.org Subject: bug#33497: [PATCH] Re: bug#33497: Our CMake package has no documentation Resent-From: Maxim Cournoyer Original-Sender: "Debbugs-submit" Resent-CC: bug-guix@gnu.org Resent-Date: Tue, 12 Mar 2019 01:34:02 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 33497 X-GNU-PR-Package: guix X-GNU-PR-Keywords: To: Marius Bakke Cc: 33497@debbugs.gnu.org Received: via spool by 33497-submit@debbugs.gnu.org id=B33497.155235440711532 (code B ref 33497); Tue, 12 Mar 2019 01:34:02 +0000 Received: (at 33497) by debbugs.gnu.org; 12 Mar 2019 01:33:27 +0000 Received: from localhost ([127.0.0.1]:39638 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1h3WIJ-0002zw-8c for submit@debbugs.gnu.org; Mon, 11 Mar 2019 21:33:27 -0400 Received: from mail-it1-f196.google.com ([209.85.166.196]:54175) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1h3WIH-0002zk-Mb for 33497@debbugs.gnu.org; Mon, 11 Mar 2019 21:33:26 -0400 Received: by mail-it1-f196.google.com with SMTP id x189so1818330itd.3 for <33497@debbugs.gnu.org>; Mon, 11 Mar 2019 18:33:25 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:to:cc:subject:references:date:in-reply-to:message-id :user-agent:mime-version; bh=o+RbwxEnZLKjGTDb08cVl6uIL3qVte816U4Z8cq+SEY=; b=ufoO+zf31snVREaI7cHzdLn779AqMRsfVv7vtDkeTUHZ4XT0PnSKOvwDnuCJgvA9P2 gfi3kCSolLBdvkwJsxQWkukeQF8zJLJ1RxDW21HYgQl8Qlaau1zTDxdBImWQuc4GRnYH +2i9cFuURf+RIqLT6B8EmtBiVNg8YIm6Paus2oKPnVv3oRXzGnaKSNxBnb6kOrVYZ7GJ BkgVgcX8dWyKwZrF94jsBkelxCTfFxlFOjn9RnwJ2blNxBkH+JzBNc+wp+cC+MqZCdQP Rj0WcSGrwvmApB0sYHHnwdgh2qjK07LSYS3YG96tWO07ZTxQnkXIbhCz3kiYO/KGstwF esVQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:to:cc:subject:references:date:in-reply-to :message-id:user-agent:mime-version; bh=o+RbwxEnZLKjGTDb08cVl6uIL3qVte816U4Z8cq+SEY=; b=LTnzynnZivel41Ee0C3L6xUHfZbgZTlNPZuWSshuqsfkVKjegkcH4vcLnGYaCfsjE9 VbS+3u6E4ZRyzYltbkrAnCEJX4WALplZLUGpdTkQYpsK8EslFF9EoFu3Y34OYzkFKkFE +4DyiHOLbjQfXZiD48fR93/L4qe5sxHG9EQ86tQtJHJ07x/X4XtL1yw5EGzpea1J/m5v WslJXz7AyG16BdREj87MwNQc9uMr2Wix1Uk6pQ8Wjf9JwZreG9GcF24U6+dsppqj8J16 6/FbyqMPfX207OAsB640m1urOiwMmuLKYHQz/t0sP8MTyBiFlpVnqtIiSanTUuHWwype B2Ug== X-Gm-Message-State: APjAAAVxgw1lkxdhz5NZjs6gks3lQrkWSeZIan6reEoOxOOHEGqjplQH Nq3Ncg4RCzQj2tAqugHZcg2/+wUX X-Google-Smtp-Source: APXvYqwZ63vVdvoglhRXJCjSKTuyoQu2Y8XWMpYEwjbQZMwCIBhHj5iQs1jEnFRjADBk3x4IrdwjLg== X-Received: by 2002:a24:7f04:: with SMTP id r4mr648703itc.17.1552354399346; Mon, 11 Mar 2019 18:33:19 -0700 (PDT) Received: from apteryx ([216.154.27.64]) by smtp.gmail.com with ESMTPSA id i20sm545455iti.30.2019.03.11.18.33.18 (version=TLS1_2 cipher=ECDHE-RSA-CHACHA20-POLY1305 bits=256/256); Mon, 11 Mar 2019 18:33:18 -0700 (PDT) From: Maxim Cournoyer References: <8736rp649l.fsf@apteryx.i-did-not-set--mail-host-address--so-tickle-me> <87y39h4pfk.fsf@gmail.com> <878sykiwwq.fsf@fastmail.com> Date: Mon, 11 Mar 2019 21:33:17 -0400 In-Reply-To: <878sykiwwq.fsf@fastmail.com> (Marius Bakke's message of "Tue, 12 Feb 2019 21:17:41 +0100") Message-ID: <87o96glvvm.fsf@gmail.com> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: 0.0 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hello Marius! Sorry for the delay. Marius Bakke writes: > Hello! > > Now would be the time to get this in 'core-updates'. > > Maxim Cournoyer writes: > >> Maxim Cournoyer writes: >> >>> Hello, >>> >>> Our CMake package lacks any documentation (manpage or other). Patch to >>> follow. >>> >>> Maxim >> >> Here's the patch to be merged in core-updates (or core-updates-next). >> >> From 07625983cd901c94e4ac25b157035c95e33a115e Mon Sep 17 00:00:00 2001 >> From: Maxim Cournoyer >> Date: Sun, 25 Nov 2018 01:39:54 -0500 >> Subject: [PATCH] gnu: cmake: Generate the documentation. >> >> This fixes https://bugs.gnu.org/33497. >> >> * gnu/packages/cmake.scm (gnu): Use the (gnu package python) and >> (gnu packages texinfo) modules. >> (cmake)[configure]: Add arguments to configure so that manual pages, info and >> HTML documentation is generated. >> [move-html-doc]: New phase. >> [native-inputs]: Add the native inputs required for building the >> documentation. >> [outputs]: Add a "doc" output. > > I'm not very comfortable with pulling python-sphinx into the dependency > closure of CMake, because then we can't update it or its dependencies > outside of the 'core-updates' cycle. It could also cause circular > dependency issues down the road. > > Would it make sense to build the documentation as a separate package? > In that case it can go on the master branch. I don't like the idea of having a separate package for the documentation of cmake because it goes against the expectations of Guix users (package comes with its manpage, and extra doc can be installed as extra output of the same package). Maybe we could have a "cmake-minimal" package we'd keep hidden and use by default as part of the cmake-build-system, which wouldn't include the doc, and the regular, user facing cmake would be the one in this patch? Maxim From unknown Sat Aug 16 13:46:12 2025 X-Loop: help-debbugs@gnu.org Subject: bug#33497: [PATCH] Re: bug#33497: Our CMake package has no documentation Resent-From: Marius Bakke Original-Sender: "Debbugs-submit" Resent-CC: bug-guix@gnu.org Resent-Date: Sun, 17 Mar 2019 16:37:01 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 33497 X-GNU-PR-Package: guix X-GNU-PR-Keywords: To: Maxim Cournoyer Cc: 33497@debbugs.gnu.org Received: via spool by 33497-submit@debbugs.gnu.org id=B33497.155284057019411 (code B ref 33497); Sun, 17 Mar 2019 16:37:01 +0000 Received: (at 33497) by debbugs.gnu.org; 17 Mar 2019 16:36:10 +0000 Received: from localhost ([127.0.0.1]:47686 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1h5Yld-000531-VU for submit@debbugs.gnu.org; Sun, 17 Mar 2019 12:36:10 -0400 Received: from out2-smtp.messagingengine.com ([66.111.4.26]:44363) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1h5Ylc-00052n-3X for 33497@debbugs.gnu.org; Sun, 17 Mar 2019 12:36:09 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id C9A3920ED2; Sun, 17 Mar 2019 12:36:02 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Sun, 17 Mar 2019 12:36:02 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=k6be9yInt801wyjxhIwYtLzcud Y/2rx/6dZxi/Sb0/k=; b=QB/F3PQVSBrRjZ1PB/Os2fJ8p3xalWQ8j6v7Vg7bVx thMrbTGRV2bsOW697PvkPRWGXg1ltvMWoEkOcFbpJ/VKqRbIeuSERUm48asUTmT/ 1lS0Y383E+5wHja4VOHxYX0C4qykCPGq3H8I5F13QZS5nhrDHrHWnPTl4BorYaNs kFWx4Xv+ahBjRNoqD84ZnsP1EcighwfxMLSrH3liXAh0YTvZ9brHj/VjVbxJvDgd R+0i2RJwutaYsqCMKuWLwWVTYP3eegur9kD0Y+TGZB6194NQDLHBSN2XeBF/MlM6 Lf+gxF1R3PYFcPOJViaP05JoHwsynopgTtCkqm6c/OXA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=k6be9y Int801wyjxhIwYtLzcudY/2rx/6dZxi/Sb0/k=; b=YAHdUMe1GXW38GFINpg8BR 4hWpzxl7W1ahTGIqVrSnLVd51Zl2IFWPBZb2fi8t1PcdmnOVk2nuiyacSHTmsrrq YMz/zy20i/dFQF/PzLHcy7OYRHTcTPNW+TMC9AJBXY53rwfUCyKAJ4ulPohIMVvH Le90TLh9IoErzAk+fsbyy3v/D4gYVMa5LKTVEo95aeD5qZV78OmZXcTrXJ4RyXEJ QcXe5h6oHlmw3LI2dEBpa+S9Q0y1VhnMXXR2JBgrtZD814V7PgK2MgxFFlH5Kucq 96PrlzBetGL4wwjVIdmH/5iuhrs8V1J9OjUwCKA9clO47i/i6eqCnLfjUGZKJFkw == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedutddrheelgdelvdcutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenuc fjughrpefhvffujghffgffkfggtgesghdtreertdertdenucfhrhhomhepofgrrhhiuhhs uceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheqnecuffhomhgrih hnpehgnhhurdhorhhgnecukfhppeeivddrudeirddvvdeirddugedtnecurfgrrhgrmhep mhgrihhlfhhrohhmpehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmnecuvehluhhsth gvrhfuihiivgeptd X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 1EE5D10311; Sun, 17 Mar 2019 12:36:02 -0400 (EDT) From: Marius Bakke In-Reply-To: <87o96glvvm.fsf@gmail.com> References: <8736rp649l.fsf@apteryx.i-did-not-set--mail-host-address--so-tickle-me> <87y39h4pfk.fsf@gmail.com> <878sykiwwq.fsf@fastmail.com> <87o96glvvm.fsf@gmail.com> User-Agent: Notmuch/0.28.2 (https://notmuchmail.org) Emacs/26.1 (x86_64-pc-linux-gnu) Date: Sun, 17 Mar 2019 17:36:00 +0100 Message-ID: <874l81a26n.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain Maxim Cournoyer writes: > Hello Marius! > > Sorry for the delay. > > Marius Bakke writes: > >> Hello! >> >> Now would be the time to get this in 'core-updates'. >> >> Maxim Cournoyer writes: >> >>> Maxim Cournoyer writes: >>> >>>> Hello, >>>> >>>> Our CMake package lacks any documentation (manpage or other). Patch to >>>> follow. >>>> >>>> Maxim >>> >>> Here's the patch to be merged in core-updates (or core-updates-next). >>> >>> From 07625983cd901c94e4ac25b157035c95e33a115e Mon Sep 17 00:00:00 2001 >>> From: Maxim Cournoyer >>> Date: Sun, 25 Nov 2018 01:39:54 -0500 >>> Subject: [PATCH] gnu: cmake: Generate the documentation. >>> >>> This fixes https://bugs.gnu.org/33497. >>> >>> * gnu/packages/cmake.scm (gnu): Use the (gnu package python) and >>> (gnu packages texinfo) modules. >>> (cmake)[configure]: Add arguments to configure so that manual pages, info and >>> HTML documentation is generated. >>> [move-html-doc]: New phase. >>> [native-inputs]: Add the native inputs required for building the >>> documentation. >>> [outputs]: Add a "doc" output. >> >> I'm not very comfortable with pulling python-sphinx into the dependency >> closure of CMake, because then we can't update it or its dependencies >> outside of the 'core-updates' cycle. It could also cause circular >> dependency issues down the road. >> >> Would it make sense to build the documentation as a separate package? >> In that case it can go on the master branch. > > I don't like the idea of having a separate package for the documentation > of cmake because it goes against the expectations of Guix users (package > comes with its manpage, and extra doc can be installed as extra output > of the same package). > > Maybe we could have a "cmake-minimal" package we'd keep hidden and use > by default as part of the cmake-build-system, which wouldn't include the > doc, and the regular, user facing cmake would be the one in this patch? This sounds reasonable to me. Can you send a patch? :-) --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlyOd3AACgkQoqBt8qM6 VPpzJAf/U3fobW6njfZG6CHx0lpNJqXlVLXH3UW/dojf8tAlLLKIMo1zB2cRRm1M kNarL9CljeQ4SXgVXwbnI9wepn4EDgTem//VNXWopyo88x5Q39B0aBtfxP5zkc01 SKcukakEiOv3zjd3+xrDmQ6vPQ2yR2jT1y2ymLGdjXLnLkvw9BeZ/9aDZxfhuJC6 ucmFqs41klJVfLJsxhIvB5wDSnvPRX3vhydPVbdc3hM8sgrRgSBt06mnAOF7tynz rToeN/C6w/tfcZf5DlUK2vtBZLBdrXlEp26fn78q0oKqfZJz6YnlrtJTlbLB+KW2 qPGLVoBq72InUrkGJmnp/qDkoPcyXQ== =rh9B -----END PGP SIGNATURE----- --=-=-=-- From unknown Sat Aug 16 13:46:12 2025 X-Loop: help-debbugs@gnu.org Subject: bug#33497: [PATCH] Re: bug#33497: Our CMake package has no documentation Resent-From: Maxim Cournoyer Original-Sender: "Debbugs-submit" Resent-CC: bug-guix@gnu.org Resent-Date: Wed, 20 Mar 2019 16:07:01 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 33497 X-GNU-PR-Package: guix X-GNU-PR-Keywords: To: Marius Bakke Cc: 33497@debbugs.gnu.org Received: via spool by 33497-submit@debbugs.gnu.org id=B33497.155309801316839 (code B ref 33497); Wed, 20 Mar 2019 16:07:01 +0000 Received: (at 33497) by debbugs.gnu.org; 20 Mar 2019 16:06:53 +0000 Received: from localhost ([127.0.0.1]:52105 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1h6djr-0004NP-A0 for submit@debbugs.gnu.org; Wed, 20 Mar 2019 12:06:53 -0400 Received: from mail-qk1-f194.google.com ([209.85.222.194]:36269) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1h6djo-0004NB-Vo for 33497@debbugs.gnu.org; Wed, 20 Mar 2019 12:06:45 -0400 Received: by mail-qk1-f194.google.com with SMTP id k130so14456070qke.3 for <33497@debbugs.gnu.org>; Wed, 20 Mar 2019 09:06:45 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:to:cc:subject:references:date:in-reply-to:message-id :user-agent:mime-version; bh=AEwFuPhYB/WPDyv0Wx2IJODKAJ1qi1YxGlkV21hvWW4=; b=oTh/1ZyOUN1ukokl/nF6v9ffbWFy9q7wlGzs4rBhqf1B8wf9pv+SFTIYTiioZu0p8i g3BxhvsI8t7wQDpSuiOU0kONLLov695aCAmA8/I2krMBdG8Crq0zolNngQ0ltLnAHILI a1UHMn8T3ZPRWmvZtj4mORAp0x43t0RMRbWzItg4hT/w8S5DVX0C8Ju0LgiXk+hjd3OB nMU0q/VeBN43hNvAX4qq01oLMSQMl0UOFno7alJJydTUjEJ+VsJvJQsAwswJuna8fUmD FrqEFaw837UaE3xbjOiXV6JpdfF2ksTszF596XrfbuTiFISHoqqo1oiuM8H6d2JJN5TD IGOA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:to:cc:subject:references:date:in-reply-to :message-id:user-agent:mime-version; bh=AEwFuPhYB/WPDyv0Wx2IJODKAJ1qi1YxGlkV21hvWW4=; b=Hg3Y0jA5EKfjODsR2/s5L/TcvfgXUGtwZQRKCQPk0d9unK1NhA6SXqUolpBB+wDODD mijrhDpdiXjrNKHFhWOK9IfHKopRPR9zqClgHZ18ioT3dzHt9dj5u40mcBxJP76oLmGh BjfRLCgb06XbyjizdohDQDTlTyLCbswqDw+zmY5nbUgJKlmKjRkYThawRNClG4CAgZ5t ungqlL6thyuvrR8Lq0JCvR4Ns/kxrrUXeqDowgAfKBXuEO423aEJQ8IqdrMuCgP2HRhJ 2bcAL3ShY9RUAIQBa5FhIotv9qHlFuMklBpsbtzaNQatpB1geQr7sAPL2SXs+xvgOhBw yXUw== X-Gm-Message-State: APjAAAWh8Usm1WwMV2Hw/tJYkeJUihFLi7tLzUMv84nW0YaT2eNM4WBN XwU7OJmD+W7cadXzpnr8BxyeHd8b X-Google-Smtp-Source: APXvYqxkTa51jwmh5Gqf8kiy6/b2B20AGl4/JNWRlnrTWNTKXXKzwAjH8Vy5kMqKaPUND2fOTFnFhg== X-Received: by 2002:a37:7381:: with SMTP id o123mr36662qkc.96.1553097999175; Wed, 20 Mar 2019 09:06:39 -0700 (PDT) Received: from kwak ([2607:fad8:4:6:afc9:fe0d:91fc:113b]) by smtp.gmail.com with ESMTPSA id j17sm1485802qtj.61.2019.03.20.09.06.37 (version=TLS1_2 cipher=ECDHE-RSA-CHACHA20-POLY1305 bits=256/256); Wed, 20 Mar 2019 09:06:37 -0700 (PDT) From: Maxim Cournoyer References: <8736rp649l.fsf@apteryx.i-did-not-set--mail-host-address--so-tickle-me> <87y39h4pfk.fsf@gmail.com> <878sykiwwq.fsf@fastmail.com> <87o96glvvm.fsf@gmail.com> <874l81a26n.fsf@fastmail.com> Date: Wed, 20 Mar 2019 12:06:36 -0400 In-Reply-To: <874l81a26n.fsf@fastmail.com> (Marius Bakke's message of "Sun, 17 Mar 2019 17:36:00 +0100") Message-ID: <875zsd7coj.fsf@gmail.com> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="=-=-=" X-Spam-Score: 0.0 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --=-=-= Content-Type: text/plain Marius Bakke writes: > Maxim Cournoyer writes: [...] >>> I'm not very comfortable with pulling python-sphinx into the dependency >>> closure of CMake, because then we can't update it or its dependencies >>> outside of the 'core-updates' cycle. It could also cause circular >>> dependency issues down the road. >>> >>> Would it make sense to build the documentation as a separate package? >>> In that case it can go on the master branch. >> >> I don't like the idea of having a separate package for the documentation >> of cmake because it goes against the expectations of Guix users (package >> comes with its manpage, and extra doc can be installed as extra output >> of the same package). >> >> Maybe we could have a "cmake-minimal" package we'd keep hidden and use >> by default as part of the cmake-build-system, which wouldn't include the >> doc, and the regular, user facing cmake would be the one in this patch? > > This sounds reasonable to me. Can you send a patch? :-) Here it comes, attached! Thanks to Ricardo on #guix for helping me resolve a quoting issue :-). To validate it works, I had to disable some failing test suites, using: --=-=-= Content-Type: text/x-patch Content-Disposition: inline; filename=disable-broken-tests.diff diff --git a/gnu/packages/libffi.scm b/gnu/packages/libffi.scm index f47f7623b4..259ea23a67 100644 --- a/gnu/packages/libffi.scm +++ b/gnu/packages/libffi.scm @@ -106,26 +106,26 @@ conversions for values passed between the two languages.") (guix build python-build-system)) #:phases (modify-phases %standard-phases - (replace 'check - (lambda _ - (setenv "PYTHONPATH" - (string-append - (getenv "PYTHONPATH") - ":" (getcwd) "/build/" - (car (scandir "build" (cut string-prefix? "lib." <>))))) + ;; (replace 'check + ;; (lambda _ + ;; (setenv "PYTHONPATH" + ;; (string-append + ;; (getenv "PYTHONPATH") + ;; ":" (getcwd) "/build/" + ;; (car (scandir "build" (cut string-prefix? "lib." <>))))) - ;; XXX The "normal" approach of setting CC and friends does - ;; not work here. Is this the correct way of doing things? - (substitute* "testing/embedding/test_basic.py" - (("c = distutils\\.ccompiler\\.new_compiler\\(\\)") - (string-append "c = distutils.ccompiler.new_compiler();" - "c.set_executables(compiler='gcc'," - "compiler_so='gcc',linker_exe='gcc'," - "linker_so='gcc -shared')"))) - (substitute* "testing/cffi0/test_ownlib.py" - (("'cc testownlib") "'gcc testownlib")) - (invoke "py.test" "-v" "c/" "testing/") - #t)) + ;; ;; XXX The "normal" approach of setting CC and friends does + ;; ;; not work here. Is this the correct way of doing things? + ;; (substitute* "testing/embedding/test_basic.py" + ;; (("c = distutils\\.ccompiler\\.new_compiler\\(\\)") + ;; (string-append "c = distutils.ccompiler.new_compiler();" + ;; "c.set_executables(compiler='gcc'," + ;; "compiler_so='gcc',linker_exe='gcc'," + ;; "linker_so='gcc -shared')"))) + ;; (substitute* "testing/cffi0/test_ownlib.py" + ;; (("'cc testownlib") "'gcc testownlib")) + ;; (invoke "py.test" "-v" "c/" "testing/") + ;; #t)) (add-before 'check 'disable-failing-test ;; This is assumed to be a libffi issue: ;; https://bitbucket.org/cffi/cffi/issues/312/tests-failed-with-armv8 diff --git a/gnu/packages/python.scm b/gnu/packages/python.scm index 0a483fb1db..67de01573e 100644 --- a/gnu/packages/python.scm +++ b/gnu/packages/python.scm @@ -127,7 +127,8 @@ "tk")) ;tkinter; adds 50 MiB to the closure (build-system gnu-build-system) (arguments - `(#:test-target "test" + `(#:tests? #f + #:test-target "test" #:configure-flags (list "--enable-shared" ;allow embedding "--with-system-ffi" ;build ctypes --=-=-= Content-Type: text/x-patch; charset=utf-8 Content-Disposition: attachment; filename=0001-cmake-Generate-documentation.patch Content-Transfer-Encoding: quoted-printable >From 61046db1d2087c8bf9d67480d881fa449157ffdb Mon Sep 17 00:00:00 2001 From: Maxim Cournoyer Date: Wed, 20 Mar 2019 12:04:29 -0400 Subject: [PATCH] cmake: Generate documentation. To prevent complicating the dependencies of a core tool, a new variant, CMAKE-MINIMAL is introduced and the CMake build system is configured to use= it by default. The regular CMAKE package gains a manpage, info manual as well as HTML documentation. Fixes issue #33497 (https://bugs.gnu.org/33497). * gnu/packages/cmake.scm (gnu): Use modules (gnu packages python-xyz), (gnu packages texinfo) and (srfi srfi-1). (cmake-minimal): Rename the original cmake variable to this. [phases]{configure}: Refactor the configure script arguments into ARGS, and allow passing CONFIGURE-FLAGS to the phase. [properties]: Set the HIDDEN? property to #t. (cmake): New variable, which inherits from CMAKE-MINIMAL. [phases]{move-html-doc}: Add phase. [native-inputs]: Add PYTHON-SPHINX and TEXINFO. [outputs]: Add the "doc" output. [properties]: Clear the inherited HIDDEN? property. * guix/build-system/cmake.scm (default-cmake): Use CMAKE-MINIMAL instead of CMAKE. --- gnu/packages/cmake.scm | 95 +++++++++++++++++++++++++++---------- guix/build-system/cmake.scm | 2 +- 2 files changed, 71 insertions(+), 26 deletions(-) diff --git a/gnu/packages/cmake.scm b/gnu/packages/cmake.scm index 7772fbedb1..ed57cf0fee 100644 --- a/gnu/packages/cmake.scm +++ b/gnu/packages/cmake.scm @@ -8,6 +8,8 @@ ;;; Copyright =C2=A9 2017, 2018 Marius Bakke ;;; Copyright =C2=A9 2018 Arun Isaac ;;; Copyright =C2=A9 2018 Tobias Geerinckx-Rice +;;; Copyright =C2=A9 2019 Maxim Cournoyer + ;;; ;;; This file is part of GNU Guix. ;;; @@ -39,11 +41,16 @@ #:use-module (gnu packages file) #:use-module (gnu packages libevent) #:use-module (gnu packages ncurses) - #:use-module (gnu packages xml)) + #:use-module (gnu packages python-xyz) + #:use-module (gnu packages texinfo) + #:use-module (gnu packages xml) + #:use-module (srfi srfi-1)) =20 -(define-public cmake +;;; This minimal variant of CMake does not include the documentation. It is +;;; used by the cmake-build-system. +(define-public cmake-minimal (package - (name "cmake") + (name "cmake-minimal") (version "3.14.0") (source (origin (method url-fetch) @@ -119,25 +126,28 @@ (setenv "CMAKE_INCLUDE_PATH" (or (getenv "CPATH") (getenv "C_INCLUDE_PATH"))) #t))) + ;; CMake uses its own configure script. (replace 'configure - (lambda* (#:key outputs #:allow-other-keys) - (let ((out (assoc-ref outputs "out"))) - (invoke - "./configure" "--verbose" - (string-append "--parallel=3D" (number->string (parallel-j= ob-count))) - (string-append "--prefix=3D" out) - "--system-libs" - "--no-system-jsoncpp" ; FIXME: Circular dependency. - ;; By default, the man pages and other docs land - ;; in PREFIX/man and PREFIX/doc, but we want them - ;; in share/{man,doc}. Note that unlike - ;; autoconf-generated configure scripts, cmake's - ;; configure prepends "PREFIX/" to what we pass - ;; to --mandir and --docdir. - "--mandir=3Dshare/man" - ,(string-append - "--docdir=3Dshare/doc/cmake-" - (version-major+minor version))))))))) + (lambda* (#:key outputs (configure-flags '()) #:allow-other-key= s) + (let* ((out (assoc-ref outputs "out")) + (args `("--verbose" + ,(string-append "--parallel=3D" + (number->string (parallel-job-= count))) + ,(string-append "--prefix=3D" out) + "--system-libs" + "--no-system-jsoncpp" ; FIXME: Circular depend= ency. + ;; By default, the man pages and other docs la= nd in + ;; PREFIX/man and PREFIX/doc, but we want them= in + ;; share/{man,doc}. Note that unlike + ;; autoconf-generated configure scripts, cmake= 's + ;; configure prepends "PREFIX/" to what we pas= s to + ;; --mandir and --docdir. + "--mandir=3Dshare/man" + ,,(string-append + "--docdir=3Dshare/doc/cmake-" + (version-major+minor version)) + ,@configure-flags))) + (apply invoke "./configure" args))))))) (inputs `(("bzip2" ,bzip2) ("curl" ,curl) @@ -159,12 +169,47 @@ CMake is used to control the software compilation process using simple pla= tform and compiler independent configuration files. CMake generates native make= files and workspaces that can be used in the compiler environment of your choice= .") - (license (list license:bsd-3 ; cmake - license:bsd-4 ; cmcompress - license:bsd-2 ; cmlibarchive - license:expat ; cmjsoncpp is dual MIT/publi= c domain + (properties '((hidden? . #t))) + (license (list license:bsd-3 ; cmake + license:bsd-4 ; cmcompress + license:bsd-2 ; cmlibarchive + license:expat ; cmjsoncpp is dual MIT/public dom= ain license:public-domain)))) ; cmlibarchive/archive_getdat= e.c =20 +(define-public cmake + (package + (inherit cmake-minimal) + (name "cmake") + (arguments + (substitute-keyword-arguments (package-arguments cmake-minimal) + ((#:configure-flags configure-flags ''()) + `(append ,configure-flags + ;; Extra configure flags used to generate the documentatio= n. + '("--sphinx-info" + "--sphinx-man" + "--sphinx-html"))) + ((#:phases phases) + `(modify-phases ,phases + (add-after 'install 'move-html-doc + (lambda* (#:key outputs #:allow-other-keys) + (let ((out (assoc-ref outputs "out")) + (doc (assoc-ref outputs "doc")) + (html (string-append "/share/doc/cmake-" + ,(version-major+minor + (package-version cmake-minimal= )) + "/html"))) + (copy-recursively (string-append out html) + (string-append doc html)) + (delete-file-recursively (string-append out html)) + #t))))))) + ;; Extra inputs required to build the documentation. + (native-inputs + `(,@(package-native-inputs cmake-minimal) + ("python-sphinx" ,python-sphinx) + ("texinfo" ,texinfo))) + (outputs '("out" "doc")) + (properties (alist-delete 'hidden? (package-properties cmake-minimal))= ))) + (define-public emacs-cmake-mode (package (inherit cmake) diff --git a/guix/build-system/cmake.scm b/guix/build-system/cmake.scm index ee116c5a4c..ca88fadddf 100644 --- a/guix/build-system/cmake.scm +++ b/guix/build-system/cmake.scm @@ -48,7 +48,7 @@ =20 ;; Do not use `@' to avoid introducing circular dependencies. (let ((module (resolve-interface '(gnu packages cmake)))) - (module-ref module 'cmake))) + (module-ref module 'cmake-minimal))) =20 (define* (lower name #:key source inputs native-inputs outputs system target --=20 2.20.1 --=-=-= Content-Type: text/plain Thanks! Maxim --=-=-=-- From unknown Sat Aug 16 13:46:12 2025 X-Loop: help-debbugs@gnu.org Subject: bug#33497: [PATCHv2] Re: bug#33497: Our CMake package has no documentation Resent-From: Maxim Cournoyer Original-Sender: "Debbugs-submit" Resent-CC: bug-guix@gnu.org Resent-Date: Thu, 21 Mar 2019 02:09:01 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 33497 X-GNU-PR-Package: guix X-GNU-PR-Keywords: To: Marius Bakke Cc: 33497@debbugs.gnu.org Received: via spool by 33497-submit@debbugs.gnu.org id=B33497.15531341347511 (code B ref 33497); Thu, 21 Mar 2019 02:09:01 +0000 Received: (at 33497) by debbugs.gnu.org; 21 Mar 2019 02:08:54 +0000 Received: from localhost ([127.0.0.1]:52556 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1h6n8W-0001x4-PJ for submit@debbugs.gnu.org; Wed, 20 Mar 2019 22:08:53 -0400 Received: from mail-qt1-f177.google.com ([209.85.160.177]:33653) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1h6n8T-0001wn-TW for 33497@debbugs.gnu.org; Wed, 20 Mar 2019 22:08:50 -0400 Received: by mail-qt1-f177.google.com with SMTP id k14so5076053qtb.0 for <33497@debbugs.gnu.org>; Wed, 20 Mar 2019 19:08:49 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:to:cc:subject:references:date:in-reply-to:message-id :user-agent:mime-version; bh=PDGRqNXFdOIFdQ2p8ZXR/Yar7tvDAByYQtuzQfj+A2M=; b=ZsxOmE7rpqR033WMxkiTOHB1CS5rdybPY54pKDf02qiZbFtTKNjV8U2TsxRd80qDrC +27Fk9vOJbB50YhKcNUbupWH6lB/sicdGPGVIC4DyXoT1TzyshNRk4M7qA/KHqxhnP4a BjQSYd7TPDj7/pc4E8Zyp204j/YTdGKBLRwYDD17vz0A7QyZol1K8s+4/KlH4iaD2eC0 vKOaNE3GvgrzelTz8joE7GQAD4hzjFLptEJhBeHVcrr7HgFIKnCjIqiuv/RbrpdcDRmv nDpdHBKoVWE2nwEaUQXIRVj6KNfTy1p/iJ656rH1rhhJLMCsGPH2/hMkwIxgDyB0krEm 6wRg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:to:cc:subject:references:date:in-reply-to :message-id:user-agent:mime-version; bh=PDGRqNXFdOIFdQ2p8ZXR/Yar7tvDAByYQtuzQfj+A2M=; b=FaEuPhPeEgXXEdsRl+b+LZFauAl2tr0RZHJMkPB0Xb3fjKDnsrxLksXgozuuh7VKy3 TMnnuZhICvpe1HpY0YyrJbXGCYuPjHyIcTzBy+mzmj4fzpqA3Ro8ckfbFQYNi+Yfriy9 OjXKCN6No5UCNueKMCBLncNV6lf1s7D5DWq8e36MR+W9xQnUkFmBb3IaWpZevBgnA0AR mxk8OOOUCLy+s2/LWJVfHjdRYePiaVTOWFoqALE4aLhgkaZwEXsHTjBxTuXrGIGNlCOs dNa3SAlUMMhT4AG0BQh/S6wxuhLA4HWgL1GZkqUrVZQHQqjI2cLQ4jxXow2pJdbxntRF SRLA== X-Gm-Message-State: APjAAAXrq5yBhPN7sqeMgj+LuP8P52vXZYWytq8uMB1lTc12flkNylz4 aiT+xkmtgA1f5n0bN4EER6X8lhb2 X-Google-Smtp-Source: APXvYqwUMJiPqxFOKF6pe4meeP+MzhYCZt+rdUmiJOa2/X9loprxPyWXBZnlMFYvpwCfoHu5amzE8A== X-Received: by 2002:ac8:3957:: with SMTP id t23mr892757qtb.331.1553134123862; Wed, 20 Mar 2019 19:08:43 -0700 (PDT) Received: from kwak ([2607:f2c0:94b4:fa00::235]) by smtp.gmail.com with ESMTPSA id s17sm2330356qtc.15.2019.03.20.19.08.42 (version=TLS1_2 cipher=ECDHE-RSA-CHACHA20-POLY1305 bits=256/256); Wed, 20 Mar 2019 19:08:43 -0700 (PDT) From: Maxim Cournoyer References: <8736rp649l.fsf@apteryx.i-did-not-set--mail-host-address--so-tickle-me> <87y39h4pfk.fsf@gmail.com> <878sykiwwq.fsf@fastmail.com> <87o96glvvm.fsf@gmail.com> <874l81a26n.fsf@fastmail.com> <875zsd7coj.fsf@gmail.com> Date: Wed, 20 Mar 2019 22:08:40 -0400 In-Reply-To: <875zsd7coj.fsf@gmail.com> (Maxim Cournoyer's message of "Wed, 20 Mar 2019 12:06:36 -0400") Message-ID: <87va0d568n.fsf_-_@gmail.com> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha256; protocol="application/pgp-signature" X-Spam-Score: 0.0 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain Here's an improved version, following some comments of Marius on #guix. --=-=-= Content-Type: text/x-patch; charset=utf-8 Content-Disposition: attachment; filename=0001-cmake-Generate-documentation.patch Content-Transfer-Encoding: quoted-printable From=202f33a7321e5e37d37f57c229c8079cb4ffd10834 Mon Sep 17 00:00:00 2001 From: Maxim Cournoyer Date: Wed, 20 Mar 2019 21:38:19 -0400 Subject: [PATCH] cmake: Generate documentation. To prevent complicating the dependencies of a core tool, a new variant, CMAKE-MINIMAL is introduced and the CMake build system is configured to use= it by default. The regular CMAKE package gains a manpage, info manual as well as HTML documentation. Fixes issue #33497 (https://bugs.gnu.org/33497). * gnu/packages/cmake.scm (gnu): Use modules (gnu packages python-xyz), (gnu packages texinfo) and (srfi srfi-1). (cmake-minimal): Rename the original cmake variable to this. [phases]{configure}: Extract the configure script arguments to... [configure-flags]: here. [properties]: Set the HIDDEN? property to #t. (cmake): New variable, which inherits from CMAKE-MINIMAL. [phases]{move-html-doc}: Add phase. [native-inputs]: Add PYTHON-SPHINX and TEXINFO. [outputs]: Add the "doc" output. [properties]: Clear the inherited HIDDEN? property. * guix/build-system/cmake.scm (default-cmake): Use CMAKE-MINIMAL instead of CMAKE. =2D-- gnu/packages/cmake.scm | 94 +++++++++++++++++++++++++++---------- guix/build-system/cmake.scm | 2 +- 2 files changed, 70 insertions(+), 26 deletions(-) diff --git a/gnu/packages/cmake.scm b/gnu/packages/cmake.scm index 7772fbedb1..b999c0c170 100644 =2D-- a/gnu/packages/cmake.scm +++ b/gnu/packages/cmake.scm @@ -8,6 +8,8 @@ ;;; Copyright =C2=A9 2017, 2018 Marius Bakke ;;; Copyright =C2=A9 2018 Arun Isaac ;;; Copyright =C2=A9 2018 Tobias Geerinckx-Rice +;;; Copyright =C2=A9 2019 Maxim Cournoyer + ;;; ;;; This file is part of GNU Guix. ;;; @@ -39,11 +41,16 @@ #:use-module (gnu packages file) #:use-module (gnu packages libevent) #:use-module (gnu packages ncurses) =2D #:use-module (gnu packages xml)) + #:use-module (gnu packages python-xyz) + #:use-module (gnu packages texinfo) + #:use-module (gnu packages xml) + #:use-module (srfi srfi-1)) =20 =2D(define-public cmake +;;; This minimal variant of CMake does not include the documentation. It is +;;; used by the cmake-build-system. +(define-public cmake-minimal (package =2D (name "cmake") + (name "cmake-minimal") (version "3.14.0") (source (origin (method url-fetch) @@ -72,6 +79,23 @@ (build-system gnu-build-system) (arguments `(#:test-target "test" + #:configure-flags + (let ((out (assoc-ref %outputs "out")) + (parallel-job-count (number->string (parallel-job-count)))) + (list "--verbose" + (string-append "--parallel=3D" parallel-job-count) + (string-append "--prefix=3D" out) + "--system-libs" + "--no-system-jsoncpp" ; FIXME: Circular dependency. + ;; By default, the man pages and other docs land + ;; in PREFIX/man and PREFIX/doc, but we want them + ;; in share/{man,doc}. Note that unlike + ;; autoconf-generated configure scripts, cmake's + ;; configure prepends "PREFIX/" to what we pass + ;; to --mandir and --docdir. + "--mandir=3Dshare/man" + ,(string-append "--docdir=3Dshare/doc/cmake-" + (version-major+minor version)))) #:make-flags (let ((skipped-tests (list "BundleUtilities" ; This test fails on Guix. @@ -119,25 +143,10 @@ (setenv "CMAKE_INCLUDE_PATH" (or (getenv "CPATH") (getenv "C_INCLUDE_PATH"))) #t))) + ;; CMake uses its own configure script. (replace 'configure =2D (lambda* (#:key outputs #:allow-other-keys) =2D (let ((out (assoc-ref outputs "out"))) =2D (invoke =2D "./configure" "--verbose" =2D (string-append "--parallel=3D" (number->string (parallel= -job-count))) =2D (string-append "--prefix=3D" out) =2D "--system-libs" =2D "--no-system-jsoncpp" ; FIXME: Circular dependency. =2D ;; By default, the man pages and other docs land =2D ;; in PREFIX/man and PREFIX/doc, but we want them =2D ;; in share/{man,doc}. Note that unlike =2D ;; autoconf-generated configure scripts, cmake's =2D ;; configure prepends "PREFIX/" to what we pass =2D ;; to --mandir and --docdir. =2D "--mandir=3Dshare/man" =2D ,(string-append =2D "--docdir=3Dshare/doc/cmake-" =2D (version-major+minor version))))))))) + (lambda* (#:key (configure-flags '()) #:allow-other-keys) + (apply invoke "./configure" configure-flags)))))) (inputs `(("bzip2" ,bzip2) ("curl" ,curl) @@ -159,12 +168,47 @@ CMake is used to control the software compilation process using simple pla= tform and compiler independent configuration files. CMake generates native make= files and workspaces that can be used in the compiler environment of your choice= .") =2D (license (list license:bsd-3 ; cmake =2D license:bsd-4 ; cmcompress =2D license:bsd-2 ; cmlibarchive =2D license:expat ; cmjsoncpp is dual MIT/pub= lic domain + (properties '((hidden? . #t))) + (license (list license:bsd-3 ; cmake + license:bsd-4 ; cmcompress + license:bsd-2 ; cmlibarchive + license:expat ; cmjsoncpp is dual MIT/public dom= ain license:public-domain)))) ; cmlibarchive/archive_getdat= e.c =20 +(define-public cmake + (package + (inherit cmake-minimal) + (name "cmake") + (arguments + (substitute-keyword-arguments (package-arguments cmake-minimal) + ((#:configure-flags configure-flags ''()) + `(append ,configure-flags + ;; Extra configure flags used to generate the documentatio= n. + '("--sphinx-info" + "--sphinx-man" + "--sphinx-html"))) + ((#:phases phases) + `(modify-phases ,phases + (add-after 'install 'move-html-doc + (lambda* (#:key outputs #:allow-other-keys) + (let ((out (assoc-ref outputs "out")) + (doc (assoc-ref outputs "doc")) + (html (string-append "/share/doc/cmake-" + ,(version-major+minor + (package-version cmake-minimal= )) + "/html"))) + (copy-recursively (string-append out html) + (string-append doc html)) + (delete-file-recursively (string-append out html)) + #t))))))) + ;; Extra inputs required to build the documentation. + (native-inputs + `(,@(package-native-inputs cmake-minimal) + ("python-sphinx" ,python-sphinx) + ("texinfo" ,texinfo))) + (outputs '("out" "doc")) + (properties (alist-delete 'hidden? (package-properties cmake-minimal))= ))) + (define-public emacs-cmake-mode (package (inherit cmake) diff --git a/guix/build-system/cmake.scm b/guix/build-system/cmake.scm index ee116c5a4c..ca88fadddf 100644 =2D-- a/guix/build-system/cmake.scm +++ b/guix/build-system/cmake.scm @@ -48,7 +48,7 @@ =20 ;; Do not use `@' to avoid introducing circular dependencies. (let ((module (resolve-interface '(gnu packages cmake)))) =2D (module-ref module 'cmake))) + (module-ref module 'cmake-minimal))) =20 (define* (lower name #:key source inputs native-inputs outputs system target =2D-=20 2.20.1 --=-=-= Content-Type: text/plain Maxim --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAEBCAAdFiEEJ9WGpPiQCFQyn/CfEmDkZILmNWIFAlyS8igACgkQEmDkZILm NWIEYQ/+Jf2hwHsPwgPmpAxd09jqdNTrnG8dtlbEzdKA+ObJh6nxdkHObgSvCnjl oV7Sq4DJ0YFMQ5QcSwCoL/v/auMGKEE6CtOdxZn9ighVbbW3bnynJBddM9LsZxLR GfaiswavIJ0NDCLkdCWcdznvDmAHN4QjcmlDj7sV8yuFk6j7BffTuoEpp/tKlhoL vBtXb3Z+yWzrWidtgEqq2cJXCmb5cdL9wLidqhwd1mjdRHR6dQCSg7NUBN3MhyhF slDBojl6Cmxajkd8yuRmDJLfBDyRSza9ZLMyd/yMq384qFZaMuodNValu9jc7lzH 0L53MSyF9IHoPR3eCE/o1ibL/xZaa95+lD7EAr3reON94yITL/b0Ih/AI3JyhTKL NtEbZgFGsnIQ73qdIMbCtIpn3Jt0HggrXDc2REadAQ7gywlLsjWiTwzuyNwGDoNx Cj5/UNj3MstkJQlo1pl49geooG5IeuCTVvknzohyD5f7lefXMDfLuO0haPSrQ8vD C47drQt9Oz+aK06PlDC/M3XPEHWc7xU5cXh8tvikIR1kq9hvoP10QPXe1uA64Wp/ mEFO5HzkhS2Dyn7Jwc4bL/00aBfWu0QfTDN1ZuWY9Fn6RVDqlNO5BWsq8ZWTX6RX EUbCh1tTIPwr81lTanjxpQHzk/r5N4ZY+q3TF0gTUI+IhTkSrvA= =9Yzm -----END PGP SIGNATURE----- --==-=-=-- From unknown Sat Aug 16 13:46:12 2025 X-Loop: help-debbugs@gnu.org Subject: bug#33497: [PATCHv2] Re: bug#33497: Our CMake package has no documentation Resent-From: Marius Bakke Original-Sender: "Debbugs-submit" Resent-CC: bug-guix@gnu.org Resent-Date: Thu, 21 Mar 2019 18:41:02 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 33497 X-GNU-PR-Package: guix X-GNU-PR-Keywords: To: Maxim Cournoyer Cc: 33497@debbugs.gnu.org Received: via spool by 33497-submit@debbugs.gnu.org id=B33497.155319365714907 (code B ref 33497); Thu, 21 Mar 2019 18:41:02 +0000 Received: (at 33497) by debbugs.gnu.org; 21 Mar 2019 18:40:57 +0000 Received: from localhost ([127.0.0.1]:53569 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1h72ca-0003sN-SV for submit@debbugs.gnu.org; Thu, 21 Mar 2019 14:40:57 -0400 Received: from out5-smtp.messagingengine.com ([66.111.4.29]:42187) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1h72cZ-0003sC-98 for 33497@debbugs.gnu.org; Thu, 21 Mar 2019 14:40:55 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 1694324539; Thu, 21 Mar 2019 14:40:50 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Thu, 21 Mar 2019 14:40:50 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=nDUK56SUFwLoNFzAhK7Sp+Of2r fwlpphFiu3NZa7GP0=; b=da5of2SpiyNp0tzDQZX18hPjLqPDicdMqV9jzpXSAG neYmuMNyOkKxo7Yk34nCaQavgwPuGY68sBU8ruBghGzubBZ4/Dtz/T42W5CXmJor t0BDJiHr4319nYBlLDTcYZP2v2+1RWGAVCAFt9LENxRne2zs7OyV15xoaKA/uKiL rg9jBzO6B9LxDkqqZySwNXoAE9WcrXunTeKyFgPPiLfMX/Peyis+grIDufvpVdGu jnU5CPGrRSXtssLweGTkrwmv+SF6Tzk01V62H3KYEvwnukECWkCi3ukCt5VesVxz VklM5BTC61Dj51QmWnvJk3HbR/qVc1EztsTbwdU3RPTA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=nDUK56 SUFwLoNFzAhK7Sp+Of2rfwlpphFiu3NZa7GP0=; b=rfr4kDtHVj8O2UwHrukak1 +++vVmJL2eeR2vXWf1qGW3wqzj7ZquzSDBUkmB/Czgf1hZhYppRi7NWJM/tjvOgW //wzCbkxMoTIdcZ1HVuabkwPXX0DdbS3qUzzov4pToqrkgzlRNT9XquUvoVBvr2E PufpViyBOLSSuS4B4OcO/mv+atTSDHTcUASOkrAtg9g3BTy4DvxYeoeAxuy69oCP cv6T82ERionoIfnNsu3kbd8vVPJ6LfZXZplVKZq1SOYRgT5VE1veRv9edjpt5Yxe UQRja8dSR5SzdxRZ4BY/Kt6kGZL83GCUykJe3sg7dhG3+bwxDzLpC7ejAC4yREJQ == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedutddrieelgddutddtucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmne cujfgurhephffvufgjfhgffffkgggtsehgtderredtredtnecuhfhrohhmpeforghrihhu shcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeenucffohhmrg hinhepghhnuhdrohhrghenucfkphepiedvrdduiedrvddviedrudegtdenucfrrghrrghm pehmrghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhush htvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 580F9E4804; Thu, 21 Mar 2019 14:40:49 -0400 (EDT) From: Marius Bakke In-Reply-To: <87va0d568n.fsf_-_@gmail.com> References: <8736rp649l.fsf@apteryx.i-did-not-set--mail-host-address--so-tickle-me> <87y39h4pfk.fsf@gmail.com> <878sykiwwq.fsf@fastmail.com> <87o96glvvm.fsf@gmail.com> <874l81a26n.fsf@fastmail.com> <875zsd7coj.fsf@gmail.com> <87va0d568n.fsf_-_@gmail.com> User-Agent: Notmuch/0.28.2 (https://notmuchmail.org) Emacs/26.1 (x86_64-pc-linux-gnu) Date: Thu, 21 Mar 2019 19:40:47 +0100 Message-ID: <87bm24840g.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain Maxim Cournoyer writes: > Here's an improved version, following some comments of Marius on #guix. > > From 2f33a7321e5e37d37f57c229c8079cb4ffd10834 Mon Sep 17 00:00:00 2001 > From: Maxim Cournoyer > Date: Wed, 20 Mar 2019 21:38:19 -0400 > Subject: [PATCH] cmake: Generate documentation. > > To prevent complicating the dependencies of a core tool, a new variant, > CMAKE-MINIMAL is introduced and the CMake build system is configured to use it > by default. The regular CMAKE package gains a manpage, info manual as well > as HTML documentation. > > Fixes issue #33497 (https://bugs.gnu.org/33497). > > * gnu/packages/cmake.scm (gnu): Use modules (gnu packages python-xyz), > (gnu packages texinfo) and (srfi srfi-1). > (cmake-minimal): Rename the original cmake variable to this. > [phases]{configure}: Extract the configure script arguments to... > [configure-flags]: here. > [properties]: Set the HIDDEN? property to #t. > (cmake): New variable, which inherits from CMAKE-MINIMAL. > [phases]{move-html-doc}: Add phase. > [native-inputs]: Add PYTHON-SPHINX and TEXINFO. > [outputs]: Add the "doc" output. > [properties]: Clear the inherited HIDDEN? property. > * guix/build-system/cmake.scm (default-cmake): Use CMAKE-MINIMAL instead of > CMAKE. Thanks! LGTM. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlyT2rAACgkQoqBt8qM6 VPp5+QgA0M9PEV2mbTkP0WM2tMWaaps0GlUBGV6HnkiveJWFvGSZPUqJwShk0XsS AXPRWJei2cA44g74yHd2MA5zA3kEWdCq1j0IpYZhy8Xm9I2FvH3yc/tKz+0cwIuS zQ2LYpA4tU3OkaKDvwAKGRnxhjGvVx78DE3cj56Ki8XNRzBNZ1yzjdeb7FbP1yS0 QIDUGCXLN/2D8hygf6HjYlQbp3xvOQlZMM25SJMrbFs7ezNiCH1ZRjyWdr9hXuDy JtAYlNuiylOxGU3O3L5uaX8QbSQFVonKuZ3W20j/GjgNtmBRZ5ufUkqJDE1/R2+b VRjSYWw37JsqTQj3vSRyp22QoYIsvQ== =NIVQ -----END PGP SIGNATURE----- --=-=-=-- From unknown Sat Aug 16 13:46:12 2025 MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) X-Loop: help-debbugs@gnu.org From: help-debbugs@gnu.org (GNU bug Tracking System) To: Maxim Cournoyer Subject: bug#33497: closed (Re: bug#33497: [PATCHv2] Re: bug#33497: Our CMake package has no documentation) Message-ID: References: <8736nfps5q.fsf@gmail.com> <8736rp649l.fsf@apteryx.i-did-not-set--mail-host-address--so-tickle-me> X-Gnu-PR-Message: they-closed 33497 X-Gnu-PR-Package: guix Reply-To: 33497@debbugs.gnu.org Date: Fri, 22 Mar 2019 02:20:02 +0000 Content-Type: multipart/mixed; boundary="----------=_1553221202-25743-1" This is a multi-part message in MIME format... ------------=_1553221202-25743-1 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="utf-8" Your bug report #33497: [PATCH] Add doc (including info manual) for cmake which was filed against the guix package, has been closed. The explanation is attached below, along with your original report. If you require more details, please reply to 33497@debbugs.gnu.org. --=20 33497: http://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D33497 GNU Bug Tracking System Contact help-debbugs@gnu.org with problems ------------=_1553221202-25743-1 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at 33497-done) by debbugs.gnu.org; 22 Mar 2019 02:19:40 +0000 Received: from localhost ([127.0.0.1]:53873 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1h79mV-0006gG-TY for submit@debbugs.gnu.org; Thu, 21 Mar 2019 22:19:40 -0400 Received: from mail-io1-f50.google.com ([209.85.166.50]:40622) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1h79mU-0006g3-38 for 33497-done@debbugs.gnu.org; Thu, 21 Mar 2019 22:19:38 -0400 Received: by mail-io1-f50.google.com with SMTP id d201so509186iof.7 for <33497-done@debbugs.gnu.org>; Thu, 21 Mar 2019 19:19:38 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:to:cc:subject:references:date:in-reply-to:message-id :user-agent:mime-version; bh=QZTenkVez/DOsEeEK9KqsEqKk/BQmaAnxEJXHrWCMpQ=; b=ZMhOxk2qN/i0qaWylPErkvQSSWkqnSSWilu+4cD339Xp/MRnkyTwWG499Q1dn5XYoG Hd6DZmMsUFeP6lU0tvBJ1KqxTVjHRGuTteW8QC7AgsCGlsnil5NlNg9oJVTmd8bEuStJ +C6K3ANnkUJnnZ2LAE/F4oJdz/NS2FJWo6Fcx4o9aNj91/tNmfRyzE+RJXMb1V3aZRvI fXQTHl3lxiilx6WrO8xr25zVhDqCuigGV17QqgKNEZ/Nroh5LdPqpaDweqFP/OOREi2Q DQlHVPhOAl9xXwodYPQm8Z5CnAysmyQtUodltD4m7HoMzbk+HHHmCK4jmv0dwtJgD10K m5cA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:to:cc:subject:references:date:in-reply-to :message-id:user-agent:mime-version; bh=QZTenkVez/DOsEeEK9KqsEqKk/BQmaAnxEJXHrWCMpQ=; b=hUiqFQIglnvHPp3fcDrRrJ3IGjOoFYMKQmy87Kf98BBYinl86301yu0jDM/jS+84uE bQNYw9tXGtoH1Pd+Nd5fXEXEj1JYC9o84Fh7+NmbG/TeeafaaIt0DZbueVghHnZfLVU3 GszisKUb8NA2oFEsQPoYUUWLMCntf4fPfeN1NRi5qoIVTdGVxcxUaOiH3VOAaTBNUGXo 0AYwS4ud05lfd2cZIgF2s8iZpN5jCakdvKewfCTtAWKB4VWndkONFHIEmLbaoTofn6Fs sxc8UdSq+PsIdxZgR4xvhLC0vB08qzE1LG30eUdw1A0ZIRPJ+upm7fG2LdD8Up50u5hd vGKA== X-Gm-Message-State: APjAAAW45rsKz+Nu068/H9VgQa0O8iDXdviFdNg/s1TVoUf+szE5PaU9 ismIdavPEd0O7EZrHrNoKJ1se5Fd X-Google-Smtp-Source: APXvYqzrUngL9hFW6OffdI7vc/F9bNpx3Z+gicA857Mv4+HDUpqsRbF9XMQsriQSxl8OKdd0ve0AXQ== X-Received: by 2002:a6b:6d15:: with SMTP id a21mr4759490iod.235.1553221172164; Thu, 21 Mar 2019 19:19:32 -0700 (PDT) Received: from kwak ([2607:f2c0:94b4:fa00::235]) by smtp.gmail.com with ESMTPSA id k18sm3203864iob.60.2019.03.21.19.19.30 (version=TLS1_2 cipher=ECDHE-RSA-CHACHA20-POLY1305 bits=256/256); Thu, 21 Mar 2019 19:19:31 -0700 (PDT) From: Maxim Cournoyer To: Marius Bakke Subject: Re: bug#33497: [PATCHv2] Re: bug#33497: Our CMake package has no documentation References: <8736rp649l.fsf@apteryx.i-did-not-set--mail-host-address--so-tickle-me> <87y39h4pfk.fsf@gmail.com> <878sykiwwq.fsf@fastmail.com> <87o96glvvm.fsf@gmail.com> <874l81a26n.fsf@fastmail.com> <875zsd7coj.fsf@gmail.com> <87va0d568n.fsf_-_@gmail.com> <87bm24840g.fsf@fastmail.com> Date: Thu, 21 Mar 2019 22:19:29 -0400 In-Reply-To: <87bm24840g.fsf@fastmail.com> (Marius Bakke's message of "Thu, 21 Mar 2019 19:40:47 +0100") Message-ID: <8736nfps5q.fsf@gmail.com> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 33497-done Cc: 33497-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Marius Bakke writes: > Maxim Cournoyer writes: > >> Here's an improved version, following some comments of Marius on #guix. >> >> From 2f33a7321e5e37d37f57c229c8079cb4ffd10834 Mon Sep 17 00:00:00 2001 >> From: Maxim Cournoyer >> Date: Wed, 20 Mar 2019 21:38:19 -0400 >> Subject: [PATCH] cmake: Generate documentation. >> >> To prevent complicating the dependencies of a core tool, a new variant, >> CMAKE-MINIMAL is introduced and the CMake build system is configured to use it >> by default. The regular CMAKE package gains a manpage, info manual as well >> as HTML documentation. >> >> Fixes issue #33497 (https://bugs.gnu.org/33497). >> >> * gnu/packages/cmake.scm (gnu): Use modules (gnu packages python-xyz), >> (gnu packages texinfo) and (srfi srfi-1). >> (cmake-minimal): Rename the original cmake variable to this. >> [phases]{configure}: Extract the configure script arguments to... >> [configure-flags]: here. >> [properties]: Set the HIDDEN? property to #t. >> (cmake): New variable, which inherits from CMAKE-MINIMAL. >> [phases]{move-html-doc}: Add phase. >> [native-inputs]: Add PYTHON-SPHINX and TEXINFO. >> [outputs]: Add the "doc" output. >> [properties]: Clear the inherited HIDDEN? property. >> * guix/build-system/cmake.scm (default-cmake): Use CMAKE-MINIMAL instead of >> CMAKE. > > Thanks! LGTM. Pushed to core-updates with commit 2f33a7321e. Thank you! Maxim ------------=_1553221202-25743-1 Content-Type: message/rfc822 Content-Disposition: inline Content-Transfer-Encoding: 7bit Received: (at submit) by debbugs.gnu.org; 25 Nov 2018 06:49:30 +0000 Received: from localhost ([127.0.0.1]:46008 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gQoEU-0000Su-Iu for submit@debbugs.gnu.org; Sun, 25 Nov 2018 01:49:30 -0500 Received: from eggs.gnu.org ([208.118.235.92]:57009) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gQoES-0000Sg-EK for submit@debbugs.gnu.org; Sun, 25 Nov 2018 01:49:29 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gQoEM-0002GA-IW for submit@debbugs.gnu.org; Sun, 25 Nov 2018 01:49:23 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,FREEMAIL_FROM autolearn=disabled version=3.3.2 Received: from lists.gnu.org ([2001:4830:134:3::11]:55854) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1gQoEM-0002G2-Fx for submit@debbugs.gnu.org; Sun, 25 Nov 2018 01:49:22 -0500 Received: from eggs.gnu.org ([2001:4830:134:3::10]:38377) by lists.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1gQoEL-0004qe-Rg for bug-guix@gnu.org; Sun, 25 Nov 2018 01:49:22 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1gQoEG-0002E4-Sv for bug-guix@gnu.org; Sun, 25 Nov 2018 01:49:21 -0500 Received: from mail-it1-x129.google.com ([2607:f8b0:4864:20::129]:36405) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_128_CBC_SHA1:16) (Exim 4.71) (envelope-from ) id 1gQoEG-0002Dk-OM for bug-guix@gnu.org; Sun, 25 Nov 2018 01:49:16 -0500 Received: by mail-it1-x129.google.com with SMTP id c9so23003433itj.1 for ; Sat, 24 Nov 2018 22:49:16 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:to:subject:date:message-id:user-agent:mime-version; bh=y3aqZ/DB712IjzDQ+TnxXO0APkgZXfZo9w1yTNK2K/U=; b=LFCHZr2JpFLVt4rEwdkcfyIt6Drwcx8LfgQoxe5+hUW1fk2XglxsridKKh4xeVhhFx vLvnw1Owb9jcTqgv1rGFIWC9mPWqE5jazXGLo1TRPvlCwxL7otpar6sUdzsXZrXltHXR Ots0xZSjasLHuyE8P+g7aiQBU8etrPVBK4Aw3MtkGzTUKoxIYEKUyBK4yQWgUWJV/ogF w90gIPYbe2TXdEGmHLiVLVv2DqhBEbE2SueVXzzXJfmm5nn6G45uMNOgT4HTECGFRD2x fiYm4+L/WHOYVUBMEgPdAeBkRJJTpKyQ0fYJPfjNFABC4Hj0ryIMuRUViPiIVLn701gl LANQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:to:subject:date:message-id:user-agent :mime-version; bh=y3aqZ/DB712IjzDQ+TnxXO0APkgZXfZo9w1yTNK2K/U=; b=DXv6LEQjMlXddSYPs431rJzrCjEh+jTP9dXaxg8uxRFeTlTeNLrInX7kFWdpapPy3w CWRlIyMvsCc6lmSckzku3j+G2kaZUoz5TxKOOl4tHLa5J8krTYg0EbP5jvak1TIYoSBg winasFru8ahZRSLWIIlhOgB2cFC9QXbLNsRx1PCzRrRI8QRgS+9YIwd5E5v4PjJ3vrW+ puvcqf+e0deZNyXl3NBt80sQO2j1SBMEhC4zHQSibYZcZUj2v+mqKcWIRm43FQ3pDjV1 xqF6weKb0rNNdZ8JsMsJUXfUmgTU43ysYIC1fkPu8v9RPtvwCQgj1coTZQhGVFobm/60 Or2w== X-Gm-Message-State: AA+aEWYxWpkYGxEP9lzzE8285v7LIxH0zdTD6vNLyQ+IChbki/jAWGXv 7SU8NTzjru9DiL7NUzw1FfzfFb/8ZuM= X-Google-Smtp-Source: AJdET5feOEEceVZmrudLlEViDT+9jiSNQkjmUyGUwhSxqZEbxRR5FzI56PlYX0mE6aSeimTq7M1yVQ== X-Received: by 2002:a24:5989:: with SMTP id p131-v6mr18006565itb.0.1543128555773; Sat, 24 Nov 2018 22:49:15 -0800 (PST) Received: from apteryx ([45.72.138.75]) by smtp.gmail.com with ESMTPSA id q197sm2844957itb.22.2018.11.24.22.49.14 for (version=TLS1_2 cipher=ECDHE-RSA-CHACHA20-POLY1305 bits=256/256); Sat, 24 Nov 2018 22:49:14 -0800 (PST) From: Maxim Cournoyer X-Google-Original-From: Maxim Cournoyer To: bug-guix Subject: Our CMake package has no documentation Date: Sun, 25 Nov 2018 01:49:10 -0500 Message-ID: <8736rp649l.fsf@apteryx.i-did-not-set--mail-host-address--so-tickle-me> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-detected-operating-system: by eggs.gnu.org: Genre and OS details not recognized. X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.6.x X-Received-From: 2001:4830:134:3::11 X-Spam-Score: -4.0 (----) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -5.0 (-----) Hello, Our CMake package lacks any documentation (manpage or other). Patch to follow. Maxim ------------=_1553221202-25743-1--