From debbugs-submit-bounces@debbugs.gnu.org Mon Aug 07 15:59:24 2017 Received: (at submit) by debbugs.gnu.org; 7 Aug 2017 19:59:24 +0000 Received: from localhost ([127.0.0.1]:50753 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1deoBG-0005Il-Mf for submit@debbugs.gnu.org; Mon, 07 Aug 2017 15:59:24 -0400 Received: from eggs.gnu.org ([208.118.235.92]:40989) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1deoB8-0005IO-Qa for submit@debbugs.gnu.org; Mon, 07 Aug 2017 15:59:13 -0400 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1deoAv-0001So-Ei for submit@debbugs.gnu.org; Mon, 07 Aug 2017 15:59:01 -0400 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=0.8 required=5.0 tests=BAYES_50,FREEMAIL_FROM, T_DKIM_INVALID autolearn=disabled version=3.3.2 Received: from lists.gnu.org ([2001:4830:134:3::11]:56321) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1deoAv-0001SZ-5I for submit@debbugs.gnu.org; Mon, 07 Aug 2017 15:58:53 -0400 Received: from eggs.gnu.org ([2001:4830:134:3::10]:59998) by lists.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1deoAm-0007jZ-87 for guix-patches@gnu.org; Mon, 07 Aug 2017 15:58:52 -0400 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1deoAe-0001LE-BX for guix-patches@gnu.org; Mon, 07 Aug 2017 15:58:44 -0400 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:34941) by eggs.gnu.org with esmtps (TLS1.0:DHE_RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1deoAd-0001KM-PC for guix-patches@gnu.org; Mon, 07 Aug 2017 15:58:36 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 1E9AC21AC3 for ; Mon, 7 Aug 2017 15:58:34 -0400 (EDT) Received: from frontend1 ([10.202.2.160]) by compute5.internal (MEProxy); Mon, 07 Aug 2017 15:58:34 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= content-type:date:from:message-id:mime-version:subject:to :x-me-sender:x-me-sender:x-sasl-enc:x-sasl-enc; s=fm1; bh=a+W0lA CkClQVf3pTYI9bp8VQCnj1+p+yVr+vnG7ToaU=; b=z/pW/66gtFSWPT2Nf6YWSi dsEDSXOF1GPS3OQaKwvSTrcFrmhmtpk5zvgmsDZWiK9AJhuhxLf8JlVRQaEc9Fds /KvEx8g43MgBRaD47opDd0OCQb4b/hXIQsC7eElGdnGn9f7KNEqbJQERJpJTO2g+ GCdcVVfALZE8GkBmXs1Yyq3xZyzvjBq7Eu1en0sAiMIdjKkavUv3Z6bX689nCAiB CXK5kom+tiJ0hOuWqlBWXomvczeFaqFrEh6JFQnRMV3gM04WRs5LUi6LNGKgg3Yd QcXkeFznNCYOpE4+mHW5DFfF54XnQ0zmHyQs2DD5UpqGNs5E8fUO0GAfZaIHPV9w == DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:message-id :mime-version:subject:to:x-me-sender:x-me-sender:x-sasl-enc :x-sasl-enc; s=fm1; bh=a+W0lACkClQVf3pTYI9bp8VQCnj1+p+yVr+vnG7To aU=; b=ill/k6wvKEmEsWhkPtE7k7dpXCa9vtwTdb7z6nQhyf6UrTs730r7xKpvo hb2x5D+9ZV03cIvmCRPosJdxtkQiWA0E03yhIaNn0ti+sefKxjvCqIL5nR+Ak93F E3WYuNy2LLb57C/VOR41s+HSEuH0K7oErccsoDRnjv5zcvMr6ozxKP49jr2uiSz1 agLYoXoY9Rot+E5/xmeN0cQqDzSHhXKYkf0nM5XT76pr7P/ZUyYcf3/QlS2fVrJ+ mhtT5KjS8HO+fBK6tL7jZ25I0x1AyKQ1DvA1sBqBvxE8NVWtf4NSubYV+gqwLOP9 W4tyIv0TDFJTHZUUnFweGU27ekuHg== X-ME-Sender: X-Sasl-enc: ARyF+n1tK7na3TX/EmCXeddwMkos1s3egdRASR6zHGQj 1502135913 Received: from localhost (unknown [188.113.81.93]) by mail.messagingengine.com (Postfix) with ESMTPA id 681E77E780 for ; Mon, 7 Aug 2017 15:58:33 -0400 (EDT) From: Marius Bakke To: guix-patches@gnu.org Subject: Chromium User-Agent: Notmuch/0.25 (https://notmuchmail.org) Emacs/25.2.1 (x86_64-unknown-linux-gnu) Date: Mon, 07 Aug 2017 21:58:31 +0200 Message-ID: <87y3qvb15k.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] [fuzzy] X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.6.x X-Received-From: 2001:4830:134:3::11 X-Spam-Score: 0.6 (/) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.7 (/) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain Hello Guix! Attached is a patch for Chromium, a popular web browser. It requires the new ld wrapper from 'core-updates' and a very powerful build machine (a quad-core Sandy Bridge Xeon uses 2-3 hours). Note that I cannot guarantee timely delivery of security updates. Major version upgrades are hugely painful, and almost always contain many high-severity fixes. Should we mention that in the description? Happy for any feedback. --=-=-= Content-Type: text/x-patch; charset=utf-8 Content-Disposition: attachment; filename=0001-gnu-Add-chromium.patch Content-Transfer-Encoding: quoted-printable From=208679de14536a8ff12cc6a7da5c51d669bd23fbe6 Mon Sep 17 00:00:00 2001 From: Marius Bakke Date: Wed, 12 Oct 2016 17:25:05 +0100 Subject: [PATCH] gnu: Add chromium. * gnu/packages/chromium.scm: New file. * gnu/packages/patches/chromium-disable-api-keys-warning.patch, gnu/packages/patches/chromium-disable-third-party-cookies.patch, gnu/packages/patches/chromium-gn-bootstrap.patch, gnu/packages/patches/chromium-system-icu.patch, gnu/packages/patches/chromium-system-libevent.patch, gnu/packages/patches/chromium-system-nspr.patch, gnu/packages/patches/chromium-system-libxml.patch: New files. * gnu/local.mk: Record it. =2D-- gnu/local.mk | 8 + gnu/packages/chromium.scm | 594 +++++++++++++++++= ++++ .../chromium-disable-api-keys-warning.patch | 17 + .../chromium-disable-third-party-cookies.patch | 13 + gnu/packages/patches/chromium-gn-bootstrap.patch | 13 + gnu/packages/patches/chromium-system-icu.patch | 15 + .../patches/chromium-system-libevent.patch | 84 +++ gnu/packages/patches/chromium-system-libxml.patch | 29 + gnu/packages/patches/chromium-system-nspr.patch | 65 +++ 9 files changed, 838 insertions(+) create mode 100644 gnu/packages/chromium.scm create mode 100644 gnu/packages/patches/chromium-disable-api-keys-warning.= patch create mode 100644 gnu/packages/patches/chromium-disable-third-party-cooki= es.patch create mode 100644 gnu/packages/patches/chromium-gn-bootstrap.patch create mode 100644 gnu/packages/patches/chromium-system-icu.patch create mode 100644 gnu/packages/patches/chromium-system-libevent.patch create mode 100644 gnu/packages/patches/chromium-system-libxml.patch create mode 100644 gnu/packages/patches/chromium-system-nspr.patch diff --git a/gnu/local.mk b/gnu/local.mk index acdadd629..8fb6e63ce 100644 =2D-- a/gnu/local.mk +++ b/gnu/local.mk @@ -86,6 +86,7 @@ GNU_SYSTEM_MODULES =3D \ %D%/packages/certs.scm \ %D%/packages/check.scm \ %D%/packages/chez.scm \ + %D%/packages/chromium.scm \ %D%/packages/ci.scm \ %D%/packages/cmake.scm \ %D%/packages/code.scm \ @@ -540,6 +541,13 @@ dist_patch_DATA =3D \ %D%/packages/patches/chicken-CVE-2017-6949.patch \ %D%/packages/patches/chicken-CVE-2017-11343.patch \ %D%/packages/patches/chmlib-inttypes.patch \ + %D%/packages/patches/chromium-disable-api-keys-warning.patch \ + %D%/packages/patches/chromium-disable-third-party-cookies.patch \ + %D%/packages/patches/chromium-gn-bootstrap.patch \ + %D%/packages/patches/chromium-system-libevent.patch \ + %D%/packages/patches/chromium-system-libxml.patch \ + %D%/packages/patches/chromium-system-icu.patch \ + %D%/packages/patches/chromium-system-nspr.patch \ %D%/packages/patches/clang-libc-search-path.patch \ %D%/packages/patches/clang-3.8-libc-search-path.patch \ %D%/packages/patches/clucene-pkgconfig.patch \ diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm new file mode 100644 index 000000000..81bcb8f05 =2D-- /dev/null +++ b/gnu/packages/chromium.scm @@ -0,0 +1,594 @@ +;;; GNU Guix --- Functional package management for GNU +;;; Copyright =C2=A9 2016, 2017 Marius Bakke +;;; +;;; This file is part of GNU Guix. +;;; +;;; GNU Guix is free software; you can redistribute it and/or modify it +;;; under the terms of the GNU General Public License as published by +;;; the Free Software Foundation; either version 3 of the License, or (at +;;; your option) any later version. +;;; +;;; GNU Guix is distributed in the hope that it will be useful, but +;;; WITHOUT ANY WARRANTY; without even the implied warranty of +;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +;;; GNU General Public License for more details. +;;; +;;; You should have received a copy of the GNU General Public License +;;; along with GNU Guix. If not, see . + +(define-module (gnu packages chromium) + #:use-module ((guix licenses) #:prefix license:) + #:use-module (guix packages) + #:use-module (guix download) + #:use-module (guix git-download) + #:use-module (guix utils) + #:use-module (guix build-system gnu) + #:use-module (gnu packages) + #:use-module (gnu packages assembly) + #:use-module (gnu packages base) + #:use-module (gnu packages bison) + #:use-module (gnu packages compression) + #:use-module (gnu packages cups) + #:use-module (gnu packages curl) + #:use-module (gnu packages databases) + #:use-module (gnu packages fontutils) + #:use-module (gnu packages gl) + #:use-module (gnu packages glib) + #:use-module (gnu packages gnome) + #:use-module (gnu packages gnuzilla) + #:use-module (gnu packages gperf) + #:use-module (gnu packages gtk) + #:use-module (gnu packages icu4c) + #:use-module (gnu packages image) + #:use-module (gnu packages libevent) + #:use-module (gnu packages libffi) + #:use-module (gnu packages libusb) + #:use-module (gnu packages linux) + #:use-module (gnu packages kerberos) + #:use-module (gnu packages ninja) + #:use-module (gnu packages node) + #:use-module (gnu packages pciutils) + #:use-module (gnu packages photo) + #:use-module (gnu packages pkg-config) + #:use-module (gnu packages protobuf) + #:use-module (gnu packages pulseaudio) + #:use-module (gnu packages python) + #:use-module (gnu packages regex) + #:use-module (gnu packages serialization) + #:use-module (gnu packages speech) + #:use-module (gnu packages tls) + #:use-module (gnu packages valgrind) + #:use-module (gnu packages version-control) + #:use-module (gnu packages video) + #:use-module (gnu packages xiph) + #:use-module (gnu packages xml) + #:use-module (gnu packages xdisorg) + #:use-module (gnu packages xorg)) + +(define opus+custom + (package (inherit opus) + (arguments + `(;; Opus Custom is an optional extension of the Opus + ;; specification that allows for unsupported frame + ;; sizes. Chromium requires that this is enabled. + #:configure-flags '("--enable-custom-modes") + ,@(package-arguments opus))))) + +;; Chromium since 58 depends on an unreleased libvpx. So, we +;; package the latest master branch as of 2017-08-05. +(define libvpx+experimental + (package + (inherit libvpx) + (source (origin + (method git-fetch) + (uri (git-reference + (url "https://chromium.googlesource.com/webm/libvpx") + (commit "cbb83ba4aa99b40b0b4a2a407bfd6d0d8be87d1f"))) + (file-name "libvpx-for-chromium-checkout") + (sha256 + (base32 + "1rj4ag0zg8c7cn4a9q75vslk5wc7vqy119k669286lxy8dvarh86")))) + ;; TODO: Make libvpx configure flags overrideable. + (arguments + `(#:phases + (modify-phases %standard-phases + (replace 'configure + (lambda* (#:key outputs #:allow-other-keys) + (setenv "CONFIG_SHELL" (which "bash")) + (let ((out (assoc-ref outputs "out"))) + (setenv "LDFLAGS" + (string-append "-Wl,-rpath=3D" out "/lib")) + (zero? (system* "./configure" + "--enable-shared" + "--as=3Dyasm" + ;; Limit size to avoid CVE-2015-1258 + "--size-limit=3D16384x16384" + ;; Spatial SVC is an experimental VP9 encod= er + ;; used by some packages (i.e. Chromium). + "--enable-experimental" + "--enable-spatial-svc" + (string-append "--prefix=3D" out))))))) + #:tests? #f)))) ; No tests. + +(define-public chromium + (package + (name "chromium") + (version "60.0.3112.90") + (synopsis "Graphical web browser") + (source (origin + (method url-fetch) + (uri (string-append "https://commondatastorage.googleapis.co= m/" + "chromium-browser-official/chromium-" + version ".tar.xz")) + (sha256 + (base32 + "1rirhwvccidza4q4z1gqdwcd9v1bymh1m9r2cq8jhiabfrjpjbxl")) + (patches (search-patches + "chromium-gn-bootstrap.patch" + "chromium-system-nspr.patch" + "chromium-system-icu.patch" + "chromium-system-libevent.patch" + "chromium-system-libxml.patch" + "chromium-disable-api-keys-warning.patch" + "chromium-disable-third-party-cookies.patch")) + (modules '((srfi srfi-1) + (guix build utils))) + (snippet + '(begin + ;; Replace GN files from third_party with shims for building + ;; against system libraries. Keep this list in sync with + ;; "build/linux/unbundle/replace_gn_files.py". + (for-each (lambda (pair) + (let ((source (string-append + "build/linux/unbundle/" (car pair))) + (dest (cdr pair))) + (copy-file source dest))) + (list + '("ffmpeg.gn" . "third_party/ffmpeg/BUILD.gn") + '("flac.gn" . "third_party/flac/BUILD.gn") + '("freetype.gn" . "third_party/freetype/BUILD.gn") + '("harfbuzz-ng.gn" . "third_party/harfbuzz-ng/BUILD= .gn") + '("icu.gn" . "third_party/icu/BUILD.gn") + '("libdrm.gn" . "third_party/libdrm/BUILD.gn") + '("libevent.gn" . "base/third_party/libevent/BUILD.= gn") + '("libjpeg.gn" . + "build/secondary/third_party/libjpeg_turbo/BUILD.= gn") + '("libpng.gn" . "third_party/libpng/BUILD.gn") + '("libvpx.gn" . "third_party/libvpx/BUILD.gn") + '("libwebp.gn" . "third_party/libwebp/BUILD.gn") + '("libxml.gn" . "third_party/libxml/BUILD.gn") + '("libxslt.gn" . "third_party/libxslt/BUILD.gn") + '("openh264.gn" . "third_party/openh264/BUILD.gn") + '("opus.gn" . "third_party/opus/BUILD.gn") + '("re2.gn" . "third_party/re2/BUILD.gn") + '("snappy.gn" . "third_party/snappy/BUILD.gn") + '("yasm.gn" . "third_party/yasm/yasm_assemble.gni") + '("zlib.gn" . "third_party/zlib/BUILD.gn"))) + #t)))) + (build-system gnu-build-system) + (arguments + `(#:tests? #f ; How? + ;; FIXME: There is a "gn" option specifically for setting -rpath, b= ut + ;; it's not recognized when passed. + #:validate-runpath? #f + #:modules ((srfi srfi-26) + (ice-9 ftw) + (ice-9 regex) + (guix build gnu-build-system) + (guix build utils)) + #:phases + (modify-phases %standard-phases + (add-after 'unpack 'remove-bundled-software + (lambda _ + (let ((keep-libs + (list + ;; Third party folders that cannot be deleted yet. + "base/third_party/dmg_fp" + "base/third_party/dynamic_annotations" + "base/third_party/icu" + "base/third_party/superfasthash" + "base/third_party/symbolize" ; glog + "base/third_party/xdg_mime" + "base/third_party/xdg_user_dirs" + "chrome/third_party/mozilla_security_manager" + "courgette/third_party" + "net/third_party/mozilla_security_manager" + "net/third_party/nss" + "third_party/adobe/flash/flapper_version.h" + ;; FIXME: This is used in: + ;; * ui/webui/resources/js/analytics.js + ;; * ui/file_manager/ + "third_party/analytics" + "third_party/angle" + "third_party/angle/src/common/third_party/numerics" + "third_party/angle/src/third_party/compiler" + "third_party/angle/src/third_party/libXNVCtrl" + "third_party/angle/src/third_party/murmurhash" + "third_party/angle/src/third_party/trace_event" + "third_party/boringssl" + "third_party/brotli" + "third_party/cacheinvalidation" + "third_party/catapult" + "third_party/catapult/third_party/polymer" + "third_party/catapult/third_party/py_vulcanize" + "third_party/catapult/third_party/py_vulcanize/third_= party/rcssmin" + "third_party/catapult/third_party/py_vulcanize/third_= party/rjsmin" + "third_party/catapult/tracing/third_party/d3" + "third_party/catapult/tracing/third_party/gl-matrix" + "third_party/catapult/tracing/third_party/jszip" + "third_party/catapult/tracing/third_party/mannwhitney= u" + "third_party/catapult/tracing/third_party/oboe" + "third_party/ced" + "third_party/cld_3" + "third_party/cros_system_api" + "third_party/dom_distiller_js" + "third_party/fips181" + "third_party/flatbuffers" + ;; XXX Needed by pdfium since 59. + "third_party/freetype" + "third_party/glslang-angle" + "third_party/google_input_tools" + "third_party/google_input_tools/third_party/closure_l= ibrary" + (string-append "third_party/google_input_tools/third_= party" + "/closure_library/third_party/closure") + "third_party/googletest" + "third_party/hunspell" + "third_party/iccjpeg" + "third_party/inspector_protocol" + "third_party/jinja2" + "third_party/jstemplate" + "third_party/khronos" + "third_party/leveldatabase" + "third_party/libXNVCtrl" + "third_party/libaddressinput" + "third_party/libjingle_xmpp" + "third_party/libphonenumber" + "third_party/libsecret" ;FIXME: needs pkg-confi= g support. + "third_party/libsrtp" ;TODO: Requires libsrtp= @2. + "third_party/libudev" + "third_party/libwebm" + "third_party/libxml/chromium" + "third_party/libyuv" + "third_party/lss" + "third_party/lzma_sdk" + "third_party/markupsafe" + "third_party/mesa" + "third_party/modp_b64" + "third_party/mt19937ar" + "third_party/node" + "third_party/node/node_modules/vulcanize/third_party/= UglifyJS2" + "third_party/openmax_dl" + "third_party/ots" + "third_party/pdfium" ;TODO: can be built stan= dalone. + "third_party/pdfium/third_party" + "third_party/ply" + "third_party/polymer" + "third_party/protobuf" + "third_party/protobuf/third_party/six" + "third_party/qcms" + "third_party/sfntly" + "third_party/skia" + "third_party/skia/third_party/vulkan" + "third_party/smhasher" + ;; XXX the sources that include this are generated. + "third_party/speech-dispatcher" + "third_party/spirv-headers" + "third_party/spirv-tools-angle" + "third_party/sqlite" + "third_party/swiftshader" + "third_party/swiftshader/third_party" + "third_party/usb_ids" + "third_party/usrsctp" + "third_party/vulkan" + "third_party/vulkan-validation-layers" + "third_party/WebKit" + "third_party/web-animations-js" + "third_party/webrtc" + "third_party/widevine/cdm/widevine_cdm_version.h" + "third_party/widevine/cdm/widevine_cdm_common.h" + "third_party/woff2" + "third_party/xdg-utils" + "third_party/yasm/run_yasm.py" + "third_party/zlib/google" + "url/third_party/mozilla" + "v8/src/third_party/valgrind" + "v8/third_party/inspector_protocol"))) + ;; FIXME: implement as source snippet. This traverses + ;; any "third_party" directory and deletes files that are: + ;; * not ending with ".gn" or ".gni"; or + ;; * not explicitly named as argument (folder or file). + (zero? (apply system* "python" + "build/linux/unbundle/remove_bundled_librarie= s.py" + "--do-remove" keep-libs))))) + (add-after 'remove-bundled-software 'patch-stuff + (lambda* (#:key inputs #:allow-other-keys) + (substitute* "printing/cups_config_helper.py" + (("cups_config =3D.*") + (string-append "cups_config =3D '" (assoc-ref inputs "cups= ") + "/bin/cups-config'\n"))) + + (substitute* + '("base/process/launch_posix.cc" + "base/tracked_objects.cc" + "base/third_party/dynamic_annotations/dynamic_annotatio= ns.c" + "sandbox/linux/seccomp-bpf/sandbox_bpf.cc" + "sandbox/linux/services/credentials.cc" + "sandbox/linux/services/namespace_utils.cc" + "sandbox/linux/services/syscall_wrappers.cc" + "sandbox/linux/syscall_broker/broker_host.cc") + (("include \"base/third_party/valgrind/") "include \"valgri= nd/")) + + (for-each (lambda (file) + (substitute* file + ;; Fix opus include path. + ;; Do not substitute opus_private.h. + (("#include \"opus\\.h\"") + "#include \"opus/opus.h\"") + (("#include \"opus_custom\\.h\"") + "#include \"opus/opus_custom.h\"") + (("#include \"opus_defines\\.h\"") + "#include \"opus/opus_defines.h\"") + (("#include \"opus_multistream\\.h\"") + "#include \"opus/opus_multistream.h\"") + (("#include \"opus_types\\.h\"") + "#include \"opus/opus_types.h\""))) + (append (find-files "third_party/opus/src/celt") + (find-files "third_party/opus/src/src") + (find-files (string-append "third_party/web= rtc/modules" + "/audio_coding/c= odecs/opus")))) + + (substitute* "chrome/common/chrome_paths.cc" + (("/usr/share/chromium/extensions") + ;; TODO: Add ~/.guix-profile. + "/run/current-system/profile/share/chromium/extensions")) + + (substitute* "breakpad/src/common/linux/libcurl_wrapper.h" + (("include \"third_party/curl") "include \"curl")) + (substitute* "media/base/decode_capabilities.cc" + (("third_party/libvpx/source/libvpx/") "")) + #t)) + (replace 'configure + (lambda* (#:key inputs outputs #:allow-other-keys) + (let ((gn-flags + (list + ;; See tools/gn/docs/cookbook.md and + ;; https://www.chromium.org/developers/gn-build-confi= guration + ;; for usage. Run "./gn args . --list" in the Release + ;; directory for an exhaustive list of supported flag= s. + "is_debug=3Dfalse" + "is_official_build=3Dfalse" + "is_clang=3Dfalse" + "use_gold=3Dfalse" + "linux_use_bundled_binutils=3Dfalse" + "use_sysroot=3Dfalse" + "remove_webcore_debug_symbols=3Dtrue" + "enable_iterator_debugging=3Dfalse" + "override_build_date=3D\"01 01 2000 05:00:00\"" + ;; Don't fail when using deprecated ffmpeg features. + "treat_warnings_as_errors=3Dfalse" + "enable_nacl=3Dfalse" + "enable_nacl_nonsfi=3Dfalse" + "use_allocator=3D\"none\"" ; Don't use tcmalloc. + ;; Don't add any API keys. End users can set them in = the + ;; environment if necessary. + ;; https://www.chromium.org/developers/how-tos/api-ke= ys + "use_official_google_api_keys=3Dfalse" + ;; Disable "field trials". + "fieldtrial_testing_like_official_build=3Dtrue" + + "use_system_libjpeg=3Dtrue" + ;; This is currently not supported on Linux: + ;; https://bugs.chromium.org/p/chromium/issues/detail= ?id=3D22208 + ;; "use_system_sqlite=3Dtrue" + "use_gtk3=3Dtrue" + "use_gconf=3Dfalse" ; deprecated by gsettings + "use_gnome_keyring=3Dfalse" ; deprecated by libsecret + "use_xkbcommon=3Dtrue" + "link_pulseaudio=3Dtrue" + "use_openh264=3Dtrue" + + ;; Don't arbitrarily restrict formats supported by ou= r ffmpeg. + "proprietary_codecs=3Dtrue" + "ffmpeg_branding=3D\"Chrome\"" + + ;; WebRTC stuff. + "rtc_use_h264=3Dtrue" + ;; Don't use bundled sources. + "rtc_build_json=3Dfalse" + "rtc_build_libevent=3Dfalse" + "rtc_build_libjpeg=3Dfalse" + "rtc_build_libvpx=3Dfalse" + "rtc_build_opus=3Dfalse" + "rtc_build_ssl=3Dfalse" + ;; TODO: Package these. + "rtc_build_libsrtp=3Dtrue" ; 2.0 + "rtc_build_libyuv=3Dtrue" + "rtc_build_openmax_dl=3Dtrue" + "rtc_build_usrsctp=3Dtrue" + (string-append "rtc_jsoncpp_root=3D\"" + (assoc-ref inputs "jsoncpp") + "/include/jsoncpp/json\"") + (string-append "rtc_ssl_root=3D\"" + (assoc-ref inputs "openssl") + "/include/openssl\"")))) + + ;; XXX: How portable is this. + (mkdir-p "third_party/node/linux/node-linux-x64") + (symlink (string-append (assoc-ref inputs "node") "/bin") + "third_party/node/linux/node-linux-x64/bin") + + (setenv "CC" "gcc") + (setenv "CXX" "g++") + ;; TODO: pre-compile instead. Avoids a race condition. + (setenv "PYTHONDONTWRITEBYTECODE" "1") + (and + ;; Build the "gn" tool. + (zero? (system* "python" + "tools/gn/bootstrap/bootstrap.py" "-s" "-v= ")) + ;; Generate ninja build files. + (zero? (system* "./out/Release/gn" "gen" "out/Release" + (string-append "--args=3D" + (string-join gn-flags " "))= )))))) + (replace 'build + (lambda* (#:key outputs #:allow-other-keys) + (zero? (system* "ninja" "-C" "out/Release" + "-j" (number->string (parallel-job-count)) + "chrome")))) + (replace 'install + (lambda* (#:key inputs outputs #:allow-other-keys) + (let* ((out (assoc-ref outputs "out")) + (bin (string-append out "/bin")) + (exe (string-append bin "/chromium")) + (lib (string-append out "/lib")) + (man (string-append out "/share/man/man1")) + (applications (string-append out "/share/application= s")) + (install-regexp (make-regexp "\\.(so|bin|pak)$")) + (locales (string-append lib "/locales")) + (resources (string-append lib "/resources")) + (gtk+ (assoc-ref inputs "gtk+")) + (mesa (assoc-ref inputs "mesa")) + (nss (assoc-ref inputs "nss")) + (udev (assoc-ref inputs "udev")) + (sh (which "sh"))) + + (mkdir-p applications) + (call-with-output-file (string-append applications + "/chromium.desktop") + (lambda (port) + (format port + "[Desktop Entry]~@ + Name=3DChromium~@ + Comment=3D~a~@ + Exec=3D~a~@ + Icon=3Dchromium.png~@ + Type=3DApplication~%" ,synopsis exe))) + + (with-directory-excursion "out/Release" + (for-each (lambda (file) + (install-file file lib)) + (scandir "." (cut regexp-exec install-regexp <>= ))) + (copy-file "chrome" (string-append lib "/chromium")) + + ;; TODO: Install icons from "../../chrome/app/themes" into + ;; "out/share/icons/hicolor/$size". + (install-file + "product_logo_48.png" + (string-append out "/share/icons/48x48/chromium.png")) + + (copy-recursively "locales" locales) + (copy-recursively "resources" resources) + + (mkdir-p man) + (copy-file "chrome.1" (string-append man "/chromium.1")) + + (mkdir-p bin) + ;; Add a thin wrapper to prevent the user from inadverten= tly + ;; installing non-free software through the Web Store. + ;; TODO: Discover extensions from the profile and pass + ;; something like "--disable-extensions-except=3D...". + (call-with-output-file exe + (lambda (port) + (format port + "#!~a~@ + CHROMIUM_FLAGS=3D\"--disable-background-netwo= rking\"~@ + if [ -z \"$CHROMIUM_ENABLE_WEB_STORE\" ]~@ + then~@ + CHROMIUM_FLAGS=3D\"$CHROMIUM_FLAGS --disa= ble-extensions\"~@ + fi~@ + exec ~a $CHROMIUM_FLAGS \"$@\"~%" + sh (string-append lib "/chromium")))) + (chmod exe #o755) + + (wrap-program exe + ;; TODO: Get these in RUNPATH. + `("LD_LIBRARY_PATH" ":" prefix + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib:" + mesa "/lib:" udev "/lib"))) + ;; Avoid file manager crash. See . + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/sh= are")))) + #t))))))) + (native-inputs + `(("bison" ,bison) + ("git" ,git) ; last_commit_position.py + ("gperf" ,gperf) + ("ninja" ,ninja) + ("node" ,node) + ("pkg-config" ,pkg-config) + ("which" ,which) + ("yasm" ,yasm) + + ;; Headers. + ("curl" ,curl) + ("valgrind" ,valgrind) + + ("python-beautifulsoup4" ,python2-beautifulsoup4) + ("python-html5lib" ,python2-html5lib) + ("python" ,python-2))) + (inputs + `(("alsa-lib" ,alsa-lib) + ("atk" ,atk) + ("cups" ,cups) + ("dbus" ,dbus) + ("dbus-glib" ,dbus-glib) + ("udev" ,eudev) + ("expat" ,expat) + ("flac" ,flac) + ("ffmpeg" ,ffmpeg) + ("fontconfig" ,fontconfig) + ("freetype" ,freetype) + ("gdk-pixbuf" ,gdk-pixbuf) + ("glib" ,glib) + ("gtk+-2" ,gtk+-2) + ("gtk+" ,gtk+) + ("harfbuzz" ,harfbuzz) + ("icu4c" ,icu4c) + ("jsoncpp" ,jsoncpp) + ("libevent" ,libevent) + ("libffi" ,libffi) + ("libjpeg-turbo" ,libjpeg-turbo) + ("libpng" ,libpng) + ("libusb" ,libusb) + ("libvpx" ,libvpx+experimental) + ("libwebp" ,libwebp) + ("libx11" ,libx11) + ("libxcb" ,libxcb) + ("libxcomposite" ,libxcomposite) + ("libxcursor" ,libxcursor) + ("libxdamage" ,libxdamage) + ("libxext" ,libxext) + ("libxfixes" ,libxfixes) + ("libxi" ,libxi) + ("libxkbcommon" ,libxkbcommon) + ("libxml2" ,libxml2) + ("libxrandr" ,libxrandr) + ("libxrender" ,libxrender) + ("libxscrnsaver" ,libxscrnsaver) + ("libxslt" ,libxslt) + ("libxtst" ,libxtst) + ("mesa" ,mesa) + ("minizip" ,minizip) + ("mit-krb5" ,mit-krb5) + ("nss" ,nss) + ("openh264" ,openh264) + ("openssl" ,openssl) + ("opus" ,opus+custom) + ("pango" ,pango) + ("pciutils" ,pciutils) + ("protobuf" ,protobuf) + ("pulseaudio" ,pulseaudio) + ("re2" ,re2) + ("snappy" ,snappy) + ("speech-dispatcher" ,speech-dispatcher) + ("sqlite" ,sqlite))) + (home-page "https://www.chromium.org/") + (description + "Chromium is a web browser using the @code{Blink} rendering engine.") + ;; Chromium is developed as BSD-3, but bundles a large number of third= -party + ;; software with other licenses. For full information, see chrome://cr= edits. + (license (list license:bsd-3 + license:bsd-2 + license:expat + license:asl2.0 + license:mpl2.0 + license:public-domain + license:lgpl2.1+)))) diff --git a/gnu/packages/patches/chromium-disable-api-keys-warning.patch b= /gnu/packages/patches/chromium-disable-api-keys-warning.patch new file mode 100644 index 000000000..c7e219f40 =2D-- /dev/null +++ b/gnu/packages/patches/chromium-disable-api-keys-warning.patch @@ -0,0 +1,17 @@ +Disable warning about missing API keys. + +Copied from: + +https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/tree/debian/= patches/disable/google-api-warning.patch + +--- a/chrome/browser/ui/startup/startup_browser_creator_impl.cc ++++ b/chrome/browser/ui/startup/startup_browser_creator_impl.cc +@@ -816,8 +816,6 @@ void StartupBrowserCreatorImpl::AddInfoB + !command_line_.HasSwitch(switches::kTestType) && + !command_line_.HasSwitch(switches::kEnableAutomation)) { + chrome::ShowBadFlagsPrompt(browser); +- GoogleApiKeysInfoBarDelegate::Create(InfoBarService::FromWebContents( +- browser->tab_strip_model()->GetActiveWebContents())); + ObsoleteSystemInfoBarDelegate::Create(InfoBarService::FromWebContents( + browser->tab_strip_model()->GetActiveWebContents())); +=20 diff --git a/gnu/packages/patches/chromium-disable-third-party-cookies.patc= h b/gnu/packages/patches/chromium-disable-third-party-cookies.patch new file mode 100644 index 000000000..0694c35f3 =2D-- /dev/null +++ b/gnu/packages/patches/chromium-disable-third-party-cookies.patch @@ -0,0 +1,13 @@ +Disable third party cookies by default. + +--- a/components/content_settings/core/browser/cookie_settings.cc ++++ b/components/content_settings/core/browser/cookie_settings.cc +@@ -101,7 +101,7 @@ void CookieSettings::GetCookieSettings( + void CookieSettings::RegisterProfilePrefs( + user_prefs::PrefRegistrySyncable* registry) { + registry->RegisterBooleanPref( +- prefs::kBlockThirdPartyCookies, false, ++ prefs::kBlockThirdPartyCookies, true, + user_prefs::PrefRegistrySyncable::SYNCABLE_PREF); + } +=20 diff --git a/gnu/packages/patches/chromium-gn-bootstrap.patch b/gnu/package= s/patches/chromium-gn-bootstrap.patch new file mode 100644 index 000000000..6d1dcb166 =2D-- /dev/null +++ b/gnu/packages/patches/chromium-gn-bootstrap.patch @@ -0,0 +1,13 @@ +description: add file needed to build gn +author: Michael Gilbert + +--- a/tools/gn/bootstrap/bootstrap.py ++++ b/tools/gn/bootstrap/bootstrap.py +@@ -490,6 +490,7 @@ def write_gn_ninja(path, root_gen_dir, o + 'base/sys_info.cc', + 'base/task_runner.cc', + 'base/task_scheduler/delayed_task_manager.cc', ++ 'base/task_scheduler/environment_config.cc', + 'base/task_scheduler/post_task.cc', + 'base/task_scheduler/priority_queue.cc', + 'base/task_scheduler/scheduler_lock_impl.cc', diff --git a/gnu/packages/patches/chromium-system-icu.patch b/gnu/packages/= patches/chromium-system-icu.patch new file mode 100644 index 000000000..c35c1b75c =2D-- /dev/null +++ b/gnu/packages/patches/chromium-system-icu.patch @@ -0,0 +1,15 @@ +description: maintain compatibility with system icu library +author: Michael Gilbert + +--- a/BUILD.gn ++++ b/BUILD.gn +@@ -657,8 +657,7 @@ group("gn_all") { + } + } +=20 +- if ((is_linux && !is_chromeos && !is_chromecast) || (is_win && use_drfu= zz) || +- (use_libfuzzer && is_mac)) { ++ if (false) { + deps +=3D [ + "//testing/libfuzzer/fuzzers", + "//testing/libfuzzer/tests:libfuzzer_tests", diff --git a/gnu/packages/patches/chromium-system-libevent.patch b/gnu/pack= ages/patches/chromium-system-libevent.patch new file mode 100644 index 000000000..91fc9e3b5 =2D-- /dev/null +++ b/gnu/packages/patches/chromium-system-libevent.patch @@ -0,0 +1,84 @@ +description: build using system libevent +author: Michael Gilbert + +https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/tree/debian/= patches/system/event.patch + +--- a/third_party/webrtc/base/task_queue_libevent.cc ++++ b/third_party/webrtc/base/task_queue_libevent.cc +@@ -15,7 +15,7 @@ + #include + #include +=20 +-#include "base/third_party/libevent/event.h" ++#include + #include "webrtc/base/checks.h" + #include "webrtc/base/logging.h" + #include "webrtc/base/task_queue_posix.h" +--- a/tools/gn/bootstrap/bootstrap.py ++++ b/tools/gn/bootstrap/bootstrap.py +@@ -609,26 +609,6 @@ def write_gn_ninja(path, root_gen_dir, o + 'base/time/time_now_posix.cc', + 'base/trace_event/heap_profiler_allocation_register_posix.cc', + ]) +- static_libraries['libevent'] =3D { +- 'sources': [ +- 'base/third_party/libevent/buffer.c', +- 'base/third_party/libevent/evbuffer.c', +- 'base/third_party/libevent/evdns.c', +- 'base/third_party/libevent/event.c', +- 'base/third_party/libevent/event_tagging.c', +- 'base/third_party/libevent/evrpc.c', +- 'base/third_party/libevent/evutil.c', +- 'base/third_party/libevent/http.c', +- 'base/third_party/libevent/log.c', +- 'base/third_party/libevent/poll.c', +- 'base/third_party/libevent/select.c', +- 'base/third_party/libevent/signal.c', +- 'base/third_party/libevent/strlcpy.c', +- ], +- 'tool': 'cc', +- 'include_dirs': [], +- 'cflags': cflags + ['-DHAVE_CONFIG_H'], +- } +=20 + if is_linux or is_aix: + ldflags.extend(['-pthread']) +@@ -660,13 +640,7 @@ def write_gn_ninja(path, root_gen_dir, o + 'base/allocator/allocator_shim.cc', + 'base/allocator/allocator_shim_default_dispatch_to_glibc.cc', + ]) +- libs.extend(['-lrt', '-latomic', '-lnspr4']) +- static_libraries['libevent']['include_dirs'].extend([ +- os.path.join(SRC_ROOT, 'base', 'third_party', 'libevent', 'linu= x') +- ]) +- static_libraries['libevent']['sources'].extend([ +- 'base/third_party/libevent/epoll.c', +- ]) ++ libs.extend(['-lrt', '-latomic', '-lnspr4', '-levent']) + else: + libs.extend(['-lrt']) + static_libraries['base']['sources'].extend([ +@@ -703,12 +677,6 @@ def write_gn_ninja(path, root_gen_dir, o + 'base/time/time_mac.cc', + 'base/threading/platform_thread_mac.mm', + ]) +- static_libraries['libevent']['include_dirs'].extend([ +- os.path.join(SRC_ROOT, 'base', 'third_party', 'libevent', 'mac') +- ]) +- static_libraries['libevent']['sources'].extend([ +- 'base/third_party/libevent/kqueue.c', +- ]) +=20 + libs.extend([ + '-framework', 'AppKit', +--- a/base/message_loop/message_pump_libevent.cc ++++ b/base/message_loop/message_pump_libevent.cc +@@ -14,7 +14,7 @@ + #include "base/files/file_util.h" + #include "base/logging.h" + #include "base/posix/eintr_wrapper.h" +-#include "base/third_party/libevent/event.h" ++#include + #include "base/time/time.h" + #include "base/trace_event/trace_event.h" + #include "build/build_config.h" diff --git a/gnu/packages/patches/chromium-system-libxml.patch b/gnu/packag= es/patches/chromium-system-libxml.patch new file mode 100644 index 000000000..23c42d79c =2D-- /dev/null +++ b/gnu/packages/patches/chromium-system-libxml.patch @@ -0,0 +1,29 @@ +description: system libxml2 2.9.4 does not yet provide XML_PARSE_NOXXE +author: Michael Gilbert + +Copied from: + +https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/tree/debian/= patches/system/libxml.patch + +--- a/third_party/libxml/chromium/libxml_utils.cc ++++ b/third_party/libxml/chromium/libxml_utils.cc +@@ -24,8 +24,7 @@ XmlReader::~XmlReader() { +=20 + bool XmlReader::Load(const std::string& input) { + const int kParseOptions =3D XML_PARSE_RECOVER | // recover on errors +- XML_PARSE_NONET | // forbid network access +- XML_PARSE_NOXXE; // no external entities ++ XML_PARSE_NONET; // forbid network access + // TODO(evanm): Verify it's OK to pass NULL for the URL and encoding. + // The libxml code allows for these, but it's unclear what effect is ha= s. + reader_ =3D xmlReaderForMemory(input.data(), static_cast(input.siz= e()), +@@ -35,8 +34,7 @@ bool XmlReader::Load(const std::string& +=20 + bool XmlReader::LoadFile(const std::string& file_path) { + const int kParseOptions =3D XML_PARSE_RECOVER | // recover on errors +- XML_PARSE_NONET | // forbid network access +- XML_PARSE_NOXXE; // no external entities ++ XML_PARSE_NONET; // forbid network access + reader_ =3D xmlReaderForFile(file_path.c_str(), NULL, kParseOptions); + return reader_ !=3D NULL; + } diff --git a/gnu/packages/patches/chromium-system-nspr.patch b/gnu/packages= /patches/chromium-system-nspr.patch new file mode 100644 index 000000000..5f2cca0c3 =2D-- /dev/null +++ b/gnu/packages/patches/chromium-system-nspr.patch @@ -0,0 +1,65 @@ +description: use system nspr library +author: Michael Gilbert + +--- a/base/time/pr_time_unittest.cc ++++ b/base/time/pr_time_unittest.cc +@@ -7,7 +7,7 @@ +=20 + #include "base/compiler_specific.h" + #include "base/macros.h" +-#include "base/third_party/nspr/prtime.h" ++#include + #include "base/time/time.h" + #include "build/build_config.h" + #include "testing/gtest/include/gtest/gtest.h" +--- a/base/time/time.cc ++++ b/base/time/time.cc +@@ -14,7 +14,7 @@ + #include "base/logging.h" + #include "base/macros.h" + #include "base/strings/stringprintf.h" +-#include "base/third_party/nspr/prtime.h" ++#include + #include "build/build_config.h" +=20 + namespace base { +--- a/tools/gn/bootstrap/bootstrap.py ++++ b/tools/gn/bootstrap/bootstrap.py +@@ -510,7 +510,6 @@ def write_gn_ninja(path, root_gen_dir, o + 'base/third_party/dmg_fp/dtoa_wrapper.cc', + 'base/third_party/dmg_fp/g_fmt.cc', + 'base/third_party/icu/icu_utf.cc', +- 'base/third_party/nspr/prtime.cc', + 'base/threading/non_thread_safe_impl.cc', + 'base/threading/post_task_and_reply_impl.cc', + 'base/threading/sequenced_task_runner_handle.cc', +@@ -661,7 +660,7 @@ def write_gn_ninja(path, root_gen_dir, o + 'base/allocator/allocator_shim.cc', + 'base/allocator/allocator_shim_default_dispatch_to_glibc.cc', + ]) +- libs.extend(['-lrt', '-latomic']) ++ libs.extend(['-lrt', '-latomic', '-lnspr4']) + static_libraries['libevent']['include_dirs'].extend([ + os.path.join(SRC_ROOT, 'base', 'third_party', 'libevent', 'linu= x') + ]) +--- a/base/BUILD.gn ++++ b/base/BUILD.gn +@@ -58,6 +58,9 @@ config("base_flags") { + "-Wno-char-subscripts", + ] + } ++ ldflags =3D [ ++ "-lnspr4", ++ ] + } +=20 + config("base_implementation") { +@@ -868,8 +871,6 @@ component("base") { + "third_party/dmg_fp/g_fmt.cc", + "third_party/icu/icu_utf.cc", + "third_party/icu/icu_utf.h", +- "third_party/nspr/prtime.cc", +- "third_party/nspr/prtime.h", + "third_party/superfasthash/superfasthash.c", + "third_party/valgrind/memcheck.h", + "threading/non_thread_safe.h", =2D-=20 2.14.0 --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlmIxmgACgkQoqBt8qM6 VPohGQf/aE97eOjQpjyF93GU6xb2DYFASSUOjCgHn/8UUyZj1hmqfDXUNsPeNEo3 kZW9U9vGQH4dKK2j4wpc72rQZQ8598VCwnr2lg8sT3vU+DOOEVsRr5KjnMLKMoZJ pgLbEnHbnNtlVPmFGBWi0M3VvMqn4XWJRJKAZsl69CQBUDOTCW148PqnG8UfNL4U /bBVsKJWk/vhtXR0PSPyJzeHLbPFlopbxh7uPISacX/j5waY6jE7qdh8hy7q+TR0 JyVsX/nszBWGIXU+Dr7pCo/C0nbRz7qt+IDE5iCv247Ao4zhnp4+Jtbwej0QFPuo kXcvP2GoZy7m4r1nx6GzveU/Eg2g5g== =9Kg8 -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Mon Aug 07 16:24:34 2017 Received: (at 28004) by debbugs.gnu.org; 7 Aug 2017 20:24:34 +0000 Received: from localhost ([127.0.0.1]:50759 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1deoZm-0005tE-Bg for submit@debbugs.gnu.org; Mon, 07 Aug 2017 16:24:34 -0400 Received: from aibo.runbox.com ([91.220.196.211]:53760) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1deoZk-0005t5-4D for 28004@debbugs.gnu.org; Mon, 07 Aug 2017 16:24:32 -0400 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit03.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1deoZi-0007Ps-Hf; Mon, 07 Aug 2017 22:24:30 +0200 Received: from [163.172.212.115] (helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1deoZ7-0007dC-SF; Mon, 07 Aug 2017 22:23:54 +0200 Date: Mon, 7 Aug 2017 20:23:41 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20170807202341.5c54jx4mpudor47i@abyayala> Mail-Followup-To: Marius Bakke , 28004@debbugs.gnu.org References: <87y3qvb15k.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="ujecsmtc47vy3x44" Content-Disposition: inline In-Reply-To: <87y3qvb15k.fsf@fastmail.com> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --ujecsmtc47vy3x44 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Hi Marius, Marius Bakke transcribed 43K bytes: > Hello Guix! >=20 > Attached is a patch for Chromium, a popular web browser. Nice! I've been using this from your branch for a while now, works just fine :) Is this not affected by the chromium discussion which happened a while back? Can we include this? I'm all for this, because I mainly use it for websites where firefox/icecat doesn't work so well, and building it locally takes a very long time. (Pro-tip: Don't offload from very powerful laptops to 10 year old computers with 2 cores ;)) > It requires the new ld wrapper from 'core-updates' and a very powerful > build machine (a quad-core Sandy Bridge Xeon uses 2-3 hours). But to notice: it builds with less than 3GB RAM. > Note that I cannot guarantee timely delivery of security updates. Major > version upgrades are hugely painful, and almost always contain many > high-severity fixes. Should we mention that in the description? >=20 > Happy for any feedback. >=20 Shouldn't you mention defines in addition to the define-public aswell, or don't we do that? --=20 ng0 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://n0is.noblogs.org/my-keys https://www.infotropique.org https://krosos.org --ujecsmtc47vy3x44 Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlmIzE0ACgkQ4i+bv+40 hYgyExAAjy+7Xrssgze/xnwH7xII69/0vvrBhg+pcEF0M7Qv6pvyaABa8y8/jZHN bgNo9YDb3e+CvGl40xKXypkrIdd4UH7Lv9iV3N4eoueUJJy7d8th/x/sU1crpltP ydKlLafzCCkZ1aWxhMJ1tvcbS3/Kl3DCgknToujlVMSK+YQM+qxl8R/rXkapA6Bt dQgy9LO7cpNvKmgldRSTaJI4OcyKnxkqFEz4wBSdhXpgOFXDM5KQCc1uFmo78eVJ o2LDsIy/lCjwVy7v7tEvQC0Bsg5BKmKhuj5yWitUT6je1dv2o6dNit0yn3X7rmHa bYl2CQ/AtSUZyXL09OwKIHeJDno0vVQJWSoR1KdcAdIprnebhWgK/BqnJ5PntqoS Z3y0MCZlj+IRtJnidI0aDGLMBrPcErRjNbrE8BvkLBa+COlgHqnEL/x8AFz37dx/ MF/J9jlF/3P4HHnqMVhXJPKgSflkOq8VpVPqFXCS9ILamgFOpUOlUn09/KwpHrWO gK+WFmfFbGBMW5U5XKrCjfnmpsM+C/Flink01N7pWTMFf+OqBt312eyIS4W1IKTx 8ENmQcpeu4hT9w1jbp3a1JdEW6xmLFTI1V3VLc+sc1CW7NCMiAEzPK+W9pHPDWKy 99qGyGel+kXI/kO6lbqrbe6SyW/dj/4JNmkLF3PzdbN4AbHP5p4= =Llsp -----END PGP SIGNATURE----- --ujecsmtc47vy3x44-- From debbugs-submit-bounces@debbugs.gnu.org Mon Aug 07 17:16:41 2017 Received: (at 28004) by debbugs.gnu.org; 7 Aug 2017 21:16:41 +0000 Received: from localhost ([127.0.0.1]:50796 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1depOC-000767-P8 for submit@debbugs.gnu.org; Mon, 07 Aug 2017 17:16:41 -0400 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:52211) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1depOB-00075w-98 for 28004@debbugs.gnu.org; Mon, 07 Aug 2017 17:16:40 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id BCAE020CBA; Mon, 7 Aug 2017 17:16:38 -0400 (EDT) Received: from frontend2 ([10.202.2.161]) by compute5.internal (MEProxy); Mon, 07 Aug 2017 17:16:38 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc :x-sasl-enc; s=fm1; bh=8B51PVDDZHGbs2NCvrOSBHe3r6lptwaXygkOFjoIv 24=; b=EJbKEWv1+fk2LIbbIpPdUsu+UlM9PhMpFiufam4rVfw9jTPG/iOtKkk9y IbWH0fkNSZnNdu5L1BQprvw2oew36w2xgXvJsPVGd9Toyh8HNkpaF3eoPJmzSB2L XOMV1ObO4dSyXoxDw+s/B5s9AwRoz5Y44ymSeH1V1gffm8egTtdIW2IJj/Ozgscj 2WCyjaeFHBloxXzrM40tXm3TIjQ5LMdBvLOO8SwqYxTerDykFym5tafYuhCe2TAQ UY3tX+t7stAsP6CogXmL3q4hHFVc1ELJCAVELVvfZrjplBLPc0mTt47f0fqkbf18 vNlAgFfh6oNFInXxhpExdnJ1zyBnw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc:x-sasl-enc; s=fm1; bh=8B51PVDDZHGbs2NCvr OSBHe3r6lptwaXygkOFjoIv24=; b=GHPEUrAqSLoVVqJLatvezdAZe1+ddrL15r BoCojNbhF5lnPhjGsIbZaLgCcCVw9RuA2GuMfRdTsnkh5MWB7JVGiHqRnHK2VAub V0okJmOJ/SPNVMli1q46zUGUkjwT13A6aAv6pYt4SHxtyiG41F/HtlhdrCRkB+8F /TxXj2Vv1lA8vQFcBIYvM/TdDF/43IBOZixPUwNi5FEQZs8uWwlZh2V4tf+YJuCK ZiakmWepyasFXSQobdP9E90Gs38bqSMNmp+6RSzIB+W6KBiY7xmfKryjrsUNd7Dt RAfF8k1w8Dd9MnuW3dHeVzY2nie7GwFaMniTobQO9QiI3MF9pISg== X-ME-Sender: X-Sasl-enc: iIKXrcZoTDqxkQyHZdXueRj5NI0duvTOQjkTynv18f/8 1502140598 Received: from localhost (unknown [188.113.81.93]) by mail.messagingengine.com (Postfix) with ESMTPA id 5A1F5247AE; Mon, 7 Aug 2017 17:16:38 -0400 (EDT) From: Marius Bakke To: ng0 Subject: Re: [bug#28004] Chromium In-Reply-To: <20170807202341.5c54jx4mpudor47i@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <20170807202341.5c54jx4mpudor47i@abyayala> User-Agent: Notmuch/0.25 (https://notmuchmail.org) Emacs/25.2.1 (x86_64-unknown-linux-gnu) Date: Mon, 07 Aug 2017 23:16:36 +0200 Message-ID: <87shh3axjf.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable ng0 writes: > Hi Marius, > > Marius Bakke transcribed 43K bytes: >> Hello Guix! >>=20 >> Attached is a patch for Chromium, a popular web browser. > > Nice! I've been using this from your branch for a while now, > works just fine :) > Is this not affected by the chromium discussion which happened > a while back? Can we include this? I'm all for this, because I > mainly use it for websites where firefox/icecat doesn't work so > well, and building it locally takes a very long time. I believe this is within the Free System Distribution Guidelines. DRM ("Widevine") is disabled at build time, and the Web Store is non-functional without the end user explicitly enabling it. There are some grey areas though. The browser may interact with certain non-free APIs (apart from regular browser duties) such as translation or prediction services. These features are optional, but some are enabled by default, and difficult to maintain patches for (I've tried). However, I have verified that it does not send any unsolicited requests with the current command-line options, apart from the very first launch which spawns a login prompt (help wanted!). Without either of those flags the browser "calls home" every time it starts. >> Note that I cannot guarantee timely delivery of security updates. Major >> version upgrades are hugely painful, and almost always contain many >> high-severity fixes. Should we mention that in the description? >>=20 >> Happy for any feedback. >>=20 > > Shouldn't you mention defines in addition to the define-public aswell, > or don't we do that? Not for new files (modules), typically. I don't think Magit can fill out those variable names (by pressing C on the hunks) either ;-) But it should probably go in web-browsers.scm anyway. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlmI2LQACgkQoqBt8qM6 VPq/MQgAjq8CBcZi+jDFnJsWC6UuBVsJ4YMgfkApERqAnVFxLCgylPM012u50HB1 cI6bj7G1r8x6yIHG77wex1H0aI764AOIamGHpZAzCbaAOQq9kiY6xpvkSWW4i2b9 WkJus2l/kNMKRJmF+qDOCUj9CGotYTX2Hr+JvSA0j1mXWGBRQcWKuOM7oZMKu76u I0E3MlRlenaAZ3lMatl7gfxmDTwbCgu3npkSXxN9h4CGp58QEEeMDb1bJxx3MpM+ VWWF56SnUkAzdVr/bYvV2oV/ZW5vrBNT4OqkhQXUtXyOZ+RXiGwdbF1mN1YVrKVo InjpK7QSOh8MV53gIx+INT0izAEm+w== =rqKg -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Tue Aug 08 01:53:49 2017 Received: (at 28004) by debbugs.gnu.org; 8 Aug 2017 05:53:49 +0000 Received: from localhost ([127.0.0.1]:50994 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1dexSe-00018g-O8 for submit@debbugs.gnu.org; Tue, 08 Aug 2017 01:53:48 -0400 Received: from aibo.runbox.com ([91.220.196.211]:51590) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1dexSc-00018X-HB for 28004@debbugs.gnu.org; Tue, 08 Aug 2017 01:53:47 -0400 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit03.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1dexSa-00033l-2O; Tue, 08 Aug 2017 07:53:44 +0200 Received: from tor-relay.zwiebeltoralf.de ([5.9.158.75] helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1dexSN-000838-8F; Tue, 08 Aug 2017 07:53:32 +0200 Date: Tue, 8 Aug 2017 05:53:29 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20170808055329.pnlmynfcfpmon3lk@abyayala> Mail-Followup-To: Marius Bakke , 28004@debbugs.gnu.org References: <87y3qvb15k.fsf@fastmail.com> <20170807202341.5c54jx4mpudor47i@abyayala> <87shh3axjf.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="y2gs5rjra2pfxkfb" Content-Disposition: inline In-Reply-To: <87shh3axjf.fsf@fastmail.com> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --y2gs5rjra2pfxkfb Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 2.4K bytes: > ng0 writes: >=20 > > Hi Marius, > > > > Marius Bakke transcribed 43K bytes: > >> Hello Guix! > >>=20 > >> Attached is a patch for Chromium, a popular web browser. > > > > Nice! I've been using this from your branch for a while now, > > works just fine :) > > Is this not affected by the chromium discussion which happened > > a while back? Can we include this? I'm all for this, because I > > mainly use it for websites where firefox/icecat doesn't work so > > well, and building it locally takes a very long time. >=20 > I believe this is within the Free System Distribution Guidelines. What I meant was this long discussion about "QTWebengine is nonfree", but as far as I experienced in being one of the early users of chromium for a long time, it doesn't depend on anything Qt and doesn't bundle it. So without having the time this morning to refresh the discussion, I think it was about Chromium as a part for other software which is provided through QtWebengine (Or maybe I'm tired and write only almost nonsense). > DRM > ("Widevine") is disabled at build time, and the Web Store is > non-functional without the end user explicitly enabling it. >=20 > There are some grey areas though. The browser may interact with certain > non-free APIs (apart from regular browser duties) such as translation or > prediction services. These features are optional, but some are enabled > by default, and difficult to maintain patches for (I've tried). >=20 > However, I have verified that it does not send any unsolicited requests > with the current command-line options, apart from the very first launch > which spawns a login prompt (help wanted!). Without either of those > flags the browser "calls home" every time it starts. >=20 > >> Note that I cannot guarantee timely delivery of security updates. Major > >> version upgrades are hugely painful, and almost always contain many > >> high-severity fixes. Should we mention that in the description? > >>=20 > >> Happy for any feedback. > >>=20 > > > > Shouldn't you mention defines in addition to the define-public aswell, > > or don't we do that? >=20 > Not for new files (modules), typically. I don't think Magit can fill out > those variable names (by pressing C on the hunks) either ;-) But it > should probably go in web-browsers.scm anyway. Isn't web-browsers just for smaller browsers? we have gnuzilla, and I'm about to add palemoon when I have analysed and cleaned up my build of it. Of course we coukd add them all to web-browser, the file won't become too l= arge. --=20 ng0 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://n0is.noblogs.org/my-keys https://www.infotropique.org https://krosos.org --y2gs5rjra2pfxkfb Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlmJUdkACgkQ4i+bv+40 hYj/YxAAubXpNlkkHNFk6SBMjqzqIljNeGPbO691BmojeiCfcCCwf/he9NkIcQuD bWAcUBnz+W75OneginHj3WB8pkF0UhmNmoi6mKlOCZTnSwdBDaTim9HlSc4wtPo0 AM2qVgV1w41wNzMPs0kuFCbyXBQ9SwMsx9JLrCebmKJEYElHP2gC0wogBnKVwPH8 DBzl/eN0KkRnB9EDYCEM2Yspck5tlurhnXzxjoGBM/GPaCXYVjTRDiPi1S4U01uW ThNNpDO+dPvBv+Nqrfc1Vs3qhUlfBKOrISZYwHhwJbZYhG8SU3acuSIgkcK5oKe7 dWhgkD3sIHV7E8Zl/II0jMCTgqB5QVYwzZwexCLGnL/yQ81w+8zOQpmHbyfeDCso jc8EkiGnX602neFKZRMxWBYJ1HVkIzQ5vt/XwpDHyWR/assQybrJ+6pBTbyAc8DS IE/zJbw/VKaNaFDUVt9GPEMUzGDN86p5ntvl34kueGKCipqEgxkOdyP3zO3PN1VY AwjHhIz+hgHJTxIjwGlZw7IveILJX4iKqr3cp8XLcIeAtd5SjiQr+3MlEm5No1Vu /82iHJoE09ls75y3M40YCSyCES3hjV68sBpaprVWLYzBcKW9M3HhXPUsCUSiYOnX ei9RTC990tY9Cd44YR4oyaYQC5A0QvLeOlhkoebXEJE1bmml2tg= =iLCQ -----END PGP SIGNATURE----- --y2gs5rjra2pfxkfb-- From debbugs-submit-bounces@debbugs.gnu.org Tue Aug 08 09:18:26 2017 Received: (at 28004) by debbugs.gnu.org; 8 Aug 2017 13:18:26 +0000 Received: from localhost ([127.0.0.1]:51162 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1df4Ow-00053T-2D for submit@debbugs.gnu.org; Tue, 08 Aug 2017 09:18:26 -0400 Received: from aibo.runbox.com ([91.220.196.211]:54834) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1df4Ou-00053J-45 for 28004@debbugs.gnu.org; Tue, 08 Aug 2017 09:18:24 -0400 Received: from [10.9.9.212] (helo=mailfront12.runbox.com) by mailtransmit03.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1df4Or-00021C-OE; Tue, 08 Aug 2017 15:18:21 +0200 Received: from 178-17-170-194.ip.as43289.net ([178.17.170.194] helo=localhost) by mailfront12.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1df4Oa-0000ho-Pt; Tue, 08 Aug 2017 15:18:05 +0200 Date: Tue, 8 Aug 2017 13:18:01 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20170808131801.snryxiiehczhnibr@abyayala> Mail-Followup-To: Marius Bakke , 28004@debbugs.gnu.org References: <87y3qvb15k.fsf@fastmail.com> <20170807202341.5c54jx4mpudor47i@abyayala> <87shh3axjf.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="fojmp473whfkmaen" Content-Disposition: inline In-Reply-To: <87shh3axjf.fsf@fastmail.com> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --fojmp473whfkmaen Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 2.4K bytes: > ng0 writes: >=20 > > Hi Marius, > > > > Marius Bakke transcribed 43K bytes: > >> Hello Guix! > >>=20 > >> Attached is a patch for Chromium, a popular web browser. > > > > Nice! I've been using this from your branch for a while now, > > works just fine :) > > Is this not affected by the chromium discussion which happened > > a while back? Can we include this? I'm all for this, because I > > mainly use it for websites where firefox/icecat doesn't work so > > well, and building it locally takes a very long time. >=20 > I believe this is within the Free System Distribution Guidelines. DRM > ("Widevine") is disabled at build time, and the Web Store is > non-functional without the end user explicitly enabling it. >=20 > There are some grey areas though. The browser may interact with certain > non-free APIs (apart from regular browser duties) such as translation or > prediction services. These features are optional, but some are enabled > by default, and difficult to maintain patches for (I've tried). >=20 > However, I have verified that it does not send any unsolicited requests > with the current command-line options, apart from the very first launch > which spawns a login prompt (help wanted!). Without either of those > flags the browser "calls home" every time it starts. >=20 > >> Note that I cannot guarantee timely delivery of security updates. Major > >> version upgrades are hugely painful, and almost always contain many > >> high-severity fixes. Should we mention that in the description? > >>=20 > >> Happy for any feedback. > >>=20 > > > > Shouldn't you mention defines in addition to the define-public aswell, > > or don't we do that? >=20 > Not for new files (modules), typically. I don't think Magit can fill out > those variable names (by pressing C on the hunks) either ;-) But it > should probably go in web-browsers.scm anyway. Unless someone else is already building this, I'm giving it a spin. I guess you changed some things since the version of yours I have in here: https://gitlab.com/ng0_guix/packages/blob/master/ng0/packages/chromiu= m.scm so I have to rebuild it. It might take a while because I'm offloading to something much slower but which doesn't care about heat as much as a this one ;) --=20 ng0 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://n0is.noblogs.org/my-keys https://www.infotropique.org https://krosos.org --fojmp473whfkmaen Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlmJuggACgkQ4i+bv+40 hYjEvg/6A+sEDd80ky69QnV1f+o/D0CNmcB0ktGereRo2M5j63lbNxCoIeDtWKm/ LoVmoCrUdO15qm06GPGGUB2ymWlt0jLRFbui1ooj8P33jHqjSue4E8OCe4ls7Y/K QHUnTVJdRtbQcpm/ZK8ZfdstMGJrf3akWVD4KlzGsr2bPCYotV8iMEJHJhWucbKK RL2TWSH19pZfyd7w8a1QEueucuytQ5iUyAD53TOXOb3yiZRYfUr8I2xLEjfUO++2 bkmzKIC/0Gn+VDQrsBlktO3S1HxOko9UUVd5fKAgLOf+fAh6zO2ZWWGPq87rH/ao K5+UyHd2rWMMYBK9frjbPsKkQ8VppD0MBGOhWB9b01H55gAjocBQiklk8XsL0NSh dLFm7PJBlmLRoQlLGlJty1Gq26jZOf3WOmIHO3nCAJfxS/EpcpvO7lMQMsAnBA/d heHYdvUYjeyAx/WglXj4BKmPdPZr9z6ElpkZjBFpnrJRQYxSL2hp+SPyUEUA7z7X pk7wIloDCDaIcWYa+d9vYWYkVF5S40WTcXy4j+om28Z9JWb6TyrW1aahZgm9MfT/ S0JMMTinOMAczOc1DWgDS4eFmU3VqwMm+TMs1LQHFczRVkipjPpkCYgJ2oE8lUbe PyP5GYnhvAjBYsT1wmL2pqOJu47J/OrefR+xPZJJoJxjgVK2uUQ= =SVds -----END PGP SIGNATURE----- --fojmp473whfkmaen-- From debbugs-submit-bounces@debbugs.gnu.org Tue Aug 08 10:22:56 2017 Received: (at 28004) by debbugs.gnu.org; 8 Aug 2017 14:22:57 +0000 Received: from localhost ([127.0.0.1]:52114 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1df5PJ-0006lu-Eq for submit@debbugs.gnu.org; Tue, 08 Aug 2017 10:22:56 -0400 Received: from aibo.runbox.com ([91.220.196.211]:60974) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1df5PH-0006lk-0C for 28004@debbugs.gnu.org; Tue, 08 Aug 2017 10:22:51 -0400 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit03.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1df5PF-0008Ml-FC; Tue, 08 Aug 2017 16:22:49 +0200 Received: from [51.255.202.66] (helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1df5Ow-0002ZC-0H; Tue, 08 Aug 2017 16:22:30 +0200 Date: Tue, 8 Aug 2017 14:22:23 +0000 From: ng0 To: Marius Bakke , 28004@debbugs.gnu.org Subject: Re: [bug#28004] Chromium Message-ID: <20170808142223.re52odap7y32eten@abyayala> Mail-Followup-To: Marius Bakke , 28004@debbugs.gnu.org References: <87y3qvb15k.fsf@fastmail.com> <20170807202341.5c54jx4mpudor47i@abyayala> <87shh3axjf.fsf@fastmail.com> <20170808131801.snryxiiehczhnibr@abyayala> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="xkknvqa42h2lusi5" Content-Disposition: inline In-Reply-To: <20170808131801.snryxiiehczhnibr@abyayala> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --xkknvqa42h2lusi5 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable ng0 transcribed 3.4K bytes: > Marius Bakke transcribed 2.4K bytes: > > ng0 writes: > >=20 > > > Hi Marius, > > > > > > Marius Bakke transcribed 43K bytes: > > >> Hello Guix! > > >>=20 > > >> Attached is a patch for Chromium, a popular web browser. > > > > > > Nice! I've been using this from your branch for a while now, > > > works just fine :) > > > Is this not affected by the chromium discussion which happened > > > a while back? Can we include this? I'm all for this, because I > > > mainly use it for websites where firefox/icecat doesn't work so > > > well, and building it locally takes a very long time. > >=20 > > I believe this is within the Free System Distribution Guidelines. DRM > > ("Widevine") is disabled at build time, and the Web Store is > > non-functional without the end user explicitly enabling it. > >=20 > > There are some grey areas though. The browser may interact with certain > > non-free APIs (apart from regular browser duties) such as translation or > > prediction services. These features are optional, but some are enabled > > by default, and difficult to maintain patches for (I've tried). > >=20 > > However, I have verified that it does not send any unsolicited requests > > with the current command-line options, apart from the very first launch > > which spawns a login prompt (help wanted!). Without either of those > > flags the browser "calls home" every time it starts. > >=20 > > >> Note that I cannot guarantee timely delivery of security updates. Ma= jor > > >> version upgrades are hugely painful, and almost always contain many > > >> high-severity fixes. Should we mention that in the description? > > >>=20 > > >> Happy for any feedback. > > >>=20 > > > > > > Shouldn't you mention defines in addition to the define-public aswell, > > > or don't we do that? > >=20 > > Not for new files (modules), typically. I don't think Magit can fill out > > those variable names (by pressing C on the hunks) either ;-) But it > > should probably go in web-browsers.scm anyway. >=20 > Unless someone else is already building this, I'm giving it a spin. >=20 > I guess you changed some things since the version of yours I have in > here: https://gitlab.com/ng0_guix/packages/blob/master/ng0/packages/chrom= ium.scm > so I have to rebuild it. > It might take a while because I'm offloading to something much slower > but which doesn't care about heat as much as a this one ;) Patch itself LGTM, I'm now waiting on the build to finish in the next couple of hours. Thanks for your work on this! --=20 ng0 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://n0is.noblogs.org/my-keys https://www.infotropique.org https://krosos.org --xkknvqa42h2lusi5 Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlmJyR8ACgkQ4i+bv+40 hYgTTw//fB8XVC9a/WYkzW3eJWQ6zfBgXRwRYjb+dO48WHdmzbkxfs4ub5vwcOce SQeJg1Dj2JwkxSlJYvxAa9Gadh2LiXNyaBhqlAEWdmesDcF2CPAlDicw2uADUMTu JFKyA0HkJLnSaTWaD4THqGTpDX6vLcnEDEbCNp9bisJQqky4S955zIz4QWf7VbTa +7p854l36h91aUW5VYHQFTH5jMgMBVt4UIlhWrEbAV7CQE5u0Jv3Bfa8Tq1qlmM4 oXEC1tCorK39vbnW4Op2/YnWA5C3DfdNIPgikmMuKq4jwZO4ECR+S99DRY/6i/Mn cCbonTt/hFaVG4DHvaru5DSAVx2tzszO8EFj3uGBt2CacFkfYmouHzDL+D24AhVD xlFnO5XZIilvq9jo+BFUu5D7LwbvsqX1ohjSxmBo5SC3W1riMB554/dc+01OjIhr AsXjhEGR4r5p0O56k5ks7vW2jdRWOfhfgGkuarr4rmO0AixH8XDQfW7B07OwOzBq TWECe3q8+PoeSrHT+4WPrnmpAB2XGRLp1x4TYEAC0DN//jqthnGcrdSdWV5cdC6Y kTMoa2P6UzGzZcoAADLzm6mWlHlDSuasQbgeavAD/bglM+f4ShIlluQNNSSEByDE 7xJi/gcq+T+zeWMLnLzn5ERLEhg/M5XuT82tbsPmuOCzbMlkwpw= =XXF+ -----END PGP SIGNATURE----- --xkknvqa42h2lusi5-- From debbugs-submit-bounces@debbugs.gnu.org Tue Aug 08 11:44:55 2017 Received: (at 28004) by debbugs.gnu.org; 8 Aug 2017 15:44:55 +0000 Received: from localhost ([127.0.0.1]:52156 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1df6gd-0000Gx-9H for submit@debbugs.gnu.org; Tue, 08 Aug 2017 11:44:55 -0400 Received: from aibo.runbox.com ([91.220.196.211]:42148) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1df6gb-0000Go-IO for 28004@debbugs.gnu.org; Tue, 08 Aug 2017 11:44:50 -0400 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit03.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1df6ga-0000cw-2c; Tue, 08 Aug 2017 17:44:48 +0200 Received: from tornode.torreactor.ml ([78.109.23.1] helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1df6gE-000702-GT; Tue, 08 Aug 2017 17:44:27 +0200 Date: Tue, 8 Aug 2017 15:44:22 +0000 From: ng0 To: Marius Bakke , 28004@debbugs.gnu.org Subject: Re: [bug#28004] Chromium Message-ID: <20170808154422.rfmrom3qkgscloyj@abyayala> Mail-Followup-To: Marius Bakke , 28004@debbugs.gnu.org References: <87y3qvb15k.fsf@fastmail.com> <20170807202341.5c54jx4mpudor47i@abyayala> <87shh3axjf.fsf@fastmail.com> <20170808131801.snryxiiehczhnibr@abyayala> <20170808142223.re52odap7y32eten@abyayala> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="ubers75lufbo3rfv" Content-Disposition: inline In-Reply-To: <20170808142223.re52odap7y32eten@abyayala> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --ubers75lufbo3rfv Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable ng0 transcribed 3.7K bytes: > ng0 transcribed 3.4K bytes: > > Marius Bakke transcribed 2.4K bytes: > > > ng0 writes: > > >=20 > > > > Hi Marius, > > > > > > > > Marius Bakke transcribed 43K bytes: > > > >> Hello Guix! > > > >>=20 > > > >> Attached is a patch for Chromium, a popular web browser. > > > > > > > > Nice! I've been using this from your branch for a while now, > > > > works just fine :) > > > > Is this not affected by the chromium discussion which happened > > > > a while back? Can we include this? I'm all for this, because I > > > > mainly use it for websites where firefox/icecat doesn't work so > > > > well, and building it locally takes a very long time. > > >=20 > > > I believe this is within the Free System Distribution Guidelines. DRM > > > ("Widevine") is disabled at build time, and the Web Store is > > > non-functional without the end user explicitly enabling it. > > >=20 > > > There are some grey areas though. The browser may interact with certa= in > > > non-free APIs (apart from regular browser duties) such as translation= or > > > prediction services. These features are optional, but some are enabled > > > by default, and difficult to maintain patches for (I've tried). > > >=20 > > > However, I have verified that it does not send any unsolicited reques= ts > > > with the current command-line options, apart from the very first laun= ch > > > which spawns a login prompt (help wanted!). Without either of those > > > flags the browser "calls home" every time it starts. > > >=20 > > > >> Note that I cannot guarantee timely delivery of security updates. = Major > > > >> version upgrades are hugely painful, and almost always contain many > > > >> high-severity fixes. Should we mention that in the description? > > > >>=20 > > > >> Happy for any feedback. > > > >>=20 > > > > > > > > Shouldn't you mention defines in addition to the define-public aswe= ll, > > > > or don't we do that? > > >=20 > > > Not for new files (modules), typically. I don't think Magit can fill = out > > > those variable names (by pressing C on the hunks) either ;-) But it > > > should probably go in web-browsers.scm anyway. > >=20 > > Unless someone else is already building this, I'm giving it a spin. > >=20 > > I guess you changed some things since the version of yours I have in > > here: https://gitlab.com/ng0_guix/packages/blob/master/ng0/packages/chr= omium.scm > > so I have to rebuild it. > > It might take a while because I'm offloading to something much slower > > but which doesn't care about heat as much as a this one ;) >=20 > Patch itself LGTM, I'm now waiting on the build to finish in the > next couple of hours. x86_64 architecture, builds fails at this point: [6247/27388] STAMP obj/mojo/common/common.stamp [6248/27388] ACTION //net/http:generate_transport_security_state(//build/to= olchain/linux:x64) FAILED: gen/net/http/transport_security_state_static.h python ../../build/gn_run_binary.py transport_security_state_generator ../.= =2E/net/http/transport_security_state_static.json ../../net/http/transport_= security_state_static.pins ../../net/http/transport_security_state_static.t= emplate gen/net/http/transport_security_state_static.h =2E/transport_security_state_generator: error while loading shared librarie= s: libglib-2.0.so.0: cannot open shared object file: No such file or direct= ory transport_security_state_generator failed with exit code 127 [6249/27388] AR obj/sandbox/linux/libsandbox_services.a ninja: build stopped: subcommand failed. phase `build' failed after 1777.2 seconds builder for `/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.0.3112= =2E90.drv' failed with exit code 1 @ build-failed /gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.0.31= 12.90.drv - 1 builder for `/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chro= mium-60.0.3112.90.drv' failed with exit code 1 derivation '/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.0.3112.= 90.drv' offloaded to '192.168.1.179' failed: build of `/gnu/store/2afpy542v= ywbmk093dd1kzlfx74s2460-chromium-60.0.3112.90.drv' failed @ build-failed /gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.0.31= 12.90.drv - 1 builder for `/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chro= mium-60.0.3112.90.drv' failed with exit code 100 guix build: error: build failed: build of `/gnu/store/2afpy542vywbmk093dd1k= zlfx74s2460-chromium-60.0.3112.90.drv' failed Have you experienced this before? --=20 ng0 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://n0is.noblogs.org/my-keys https://www.infotropique.org https://krosos.org --ubers75lufbo3rfv Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlmJ3FYACgkQ4i+bv+40 hYihDQ//Tyv9Ii84cUS30tYe15JjJF1WN0R6wol4BBhOvuwi8DHldBhXwBUZKRAg exBQ63x4/JaFIlVdH02vMNbnIj1o1R6wAIzddvyRDAOMcQWNoMXYsD8NOmIRNbcU XJkBroRNF04wzujNO3xx31txj54dxlkzcz+SJ7IQ7sR3oYFWBE3q7EGMChRxzgVJ ddFI1zfRVlFatQ5PaIxanKDZoHMiQ3MXSiGlayWvIIvOa9Yosh5sImXOjMXH2Wlh 6S3se4io70HSN19vTqUkSQnP+Ph38kDmc3aQGX21MWDAflapb4tcT3vg7xlaZJCA Itxi9jmRY19oPsl1IKs6cXBmUg079Rd88l5t0ez7LEiYkdUQyhI0yDSuN0mtSBEh cGdoGPLUV8F46N8bUj9rDjt2FujYx9cQd5Qvr69fl/QouPIhJapeBQiNgWBnWLP4 aw0WXO2OW4MoTRWZvOLOuI452WJrWbLCPcwmhSUtydDVvb+1VddJO4p26/yIh31b cHhhSh1y0J0VYS0EBGGpBpRb7fd58FaOudSenW7JteD3ZrZZPcMFJL70hKEFWhmw BGne3WWULfw+mQUtuZYj3CEUkKdorR/UOuSF2z1wDJYNC+8Q3VIApVDfR0sxE2B1 fCenKWCCuZrDS7DODTRiSClKHV6L2FgWhOpFSyE2S22G9D4ui5k= =qTMb -----END PGP SIGNATURE----- --ubers75lufbo3rfv-- From debbugs-submit-bounces@debbugs.gnu.org Tue Aug 08 15:00:44 2017 Received: (at 28004) by debbugs.gnu.org; 8 Aug 2017 19:00:44 +0000 Received: from localhost ([127.0.0.1]:52217 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1df9k8-00070T-VC for submit@debbugs.gnu.org; Tue, 08 Aug 2017 15:00:44 -0400 Received: from aibo.runbox.com ([91.220.196.211]:52896) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1df9k6-00070J-Qx for 28004@debbugs.gnu.org; Tue, 08 Aug 2017 15:00:39 -0400 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1df9k4-0004UN-J2; Tue, 08 Aug 2017 21:00:36 +0200 Received: from tor-exit4-readme.dfri.se ([171.25.193.78] helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1df9jT-0003hj-9I; Tue, 08 Aug 2017 20:59:59 +0200 Date: Tue, 8 Aug 2017 18:59:52 +0000 From: ng0 To: Marius Bakke , 28004@debbugs.gnu.org Subject: Re: [bug#28004] Chromium Message-ID: <20170808185952.3fduefzgmc4nmrjh@abyayala> Mail-Followup-To: Marius Bakke , 28004@debbugs.gnu.org References: <87y3qvb15k.fsf@fastmail.com> <20170807202341.5c54jx4mpudor47i@abyayala> <87shh3axjf.fsf@fastmail.com> <20170808131801.snryxiiehczhnibr@abyayala> <20170808142223.re52odap7y32eten@abyayala> <20170808154422.rfmrom3qkgscloyj@abyayala> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="5ylkdz3epm3sfdhc" Content-Disposition: inline In-Reply-To: <20170808154422.rfmrom3qkgscloyj@abyayala> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --5ylkdz3epm3sfdhc Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable ng0 transcribed 5.5K bytes: > ng0 transcribed 3.7K bytes: > > ng0 transcribed 3.4K bytes: > > > Marius Bakke transcribed 2.4K bytes: > > > > ng0 writes: > > > >=20 > > > > > Hi Marius, > > > > > > > > > > Marius Bakke transcribed 43K bytes: > > > > >> Hello Guix! > > > > >>=20 > > > > >> Attached is a patch for Chromium, a popular web browser. > > > > > > > > > > Nice! I've been using this from your branch for a while now, > > > > > works just fine :) > > > > > Is this not affected by the chromium discussion which happened > > > > > a while back? Can we include this? I'm all for this, because I > > > > > mainly use it for websites where firefox/icecat doesn't work so > > > > > well, and building it locally takes a very long time. > > > >=20 > > > > I believe this is within the Free System Distribution Guidelines. D= RM > > > > ("Widevine") is disabled at build time, and the Web Store is > > > > non-functional without the end user explicitly enabling it. > > > >=20 > > > > There are some grey areas though. The browser may interact with cer= tain > > > > non-free APIs (apart from regular browser duties) such as translati= on or > > > > prediction services. These features are optional, but some are enab= led > > > > by default, and difficult to maintain patches for (I've tried). > > > >=20 > > > > However, I have verified that it does not send any unsolicited requ= ests > > > > with the current command-line options, apart from the very first la= unch > > > > which spawns a login prompt (help wanted!). Without either of those > > > > flags the browser "calls home" every time it starts. > > > >=20 > > > > >> Note that I cannot guarantee timely delivery of security updates= =2E Major > > > > >> version upgrades are hugely painful, and almost always contain m= any > > > > >> high-severity fixes. Should we mention that in the description? > > > > >>=20 > > > > >> Happy for any feedback. > > > > >>=20 > > > > > > > > > > Shouldn't you mention defines in addition to the define-public as= well, > > > > > or don't we do that? > > > >=20 > > > > Not for new files (modules), typically. I don't think Magit can fil= l out > > > > those variable names (by pressing C on the hunks) either ;-) But it > > > > should probably go in web-browsers.scm anyway. > > >=20 > > > Unless someone else is already building this, I'm giving it a spin. > > >=20 > > > I guess you changed some things since the version of yours I have in > > > here: https://gitlab.com/ng0_guix/packages/blob/master/ng0/packages/c= hromium.scm > > > so I have to rebuild it. > > > It might take a while because I'm offloading to something much slower > > > but which doesn't care about heat as much as a this one ;) > >=20 > > Patch itself LGTM, I'm now waiting on the build to finish in the > > next couple of hours. >=20 > x86_64 architecture, builds fails at this point: >=20 > [6247/27388] STAMP obj/mojo/common/common.stamp > [6248/27388] ACTION //net/http:generate_transport_security_state(//build/= toolchain/linux:x64) > FAILED: gen/net/http/transport_security_state_static.h > python ../../build/gn_run_binary.py transport_security_state_generator ..= /../net/http/transport_security_state_static.json ../../net/http/transport_= security_state_static.pins ../../net/http/transport_security_state_static.t= emplate gen/net/http/transport_security_state_static.h > ./transport_security_state_generator: error while loading shared librarie= s: libglib-2.0.so.0: cannot open shared object file: No such file or direct= ory > transport_security_state_generator failed with exit code 127 > [6249/27388] AR obj/sandbox/linux/libsandbox_services.a > ninja: build stopped: subcommand failed. > phase `build' failed after 1777.2 seconds > builder for `/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.0.31= 12.90.drv' failed with exit code 1 > @ build-failed /gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.0.= 3112.90.drv - 1 builder for `/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-ch= romium-60.0.3112.90.drv' failed with exit code 1 > derivation '/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.0.311= 2.90.drv' offloaded to '192.168.1.179' failed: build of `/gnu/store/2afpy54= 2vywbmk093dd1kzlfx74s2460-chromium-60.0.3112.90.drv' failed > @ build-failed /gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.0.= 3112.90.drv - 1 builder for `/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-ch= romium-60.0.3112.90.drv' failed with exit code 100 > guix build: error: build failed: build of `/gnu/store/2afpy542vywbmk093dd= 1kzlfx74s2460-chromium-60.0.3112.90.drv' failed >=20 > Have you experienced this before? As efraim pointed out I missed the part where you wrote that it is for core-updates. I just assumed it worked like it is on master because what I had locally (chromium 58) works on master). Someone else must test it then. --=20 ng0 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://n0is.noblogs.org/my-keys https://www.infotropique.org https://krosos.org --5ylkdz3epm3sfdhc Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlmKCigACgkQ4i+bv+40 hYjM8RAAqfGzQRj7U7ZfN/e7hWROq4fN/VAs2hCdIIfviR9wQ+sURnxb+YMLG6+/ wjH8Mouy1A5NwHZIvCPlt2x2BkQ6jnqykgHVmjqKpeSdbSAm2wq8ticJXvs4V23P gogHuMShmnzG2zP3H6BARHfyZkYznMZhkWP/Viokbxmz5OZHdQPsyxEfgVcsbhDc YKNP3LJQ7Uy5ew5tHULvCMnnfV7lSdZv+odxM0hq3pcIenyiMG7U0mtF4T0DbK4j nliJcicyREzz14tmOv4oAdkFVn5XQL3aLz9UJl6Jlgp3JueLxyHKiH8JAS65dVvG hN7160Q1NWHVBCpzU4ges5vbOjcpIFEisGDBffKL100tEcn2+rk8gUdf+y5gWstZ h34hb+qnnvcm4j6UbfL2lfEet+9EQRT7zfal/wbl5l+yl0NKEc7YjOipVdaM2tQV LDimFP96ENFXqGD8RFRulTsxhsH+guUOwmNn+7Wpye68hAIQeXoooDZqYlcb9W6w mU8ShuP1LYDQCaWrLi88EeS0fitm7dUHRP7UDkMqfK6syOMz8amJyILbL/CFltw6 kRuUZ1Mu4IhdBBBqJE9AkOhCjh5pkYDCMA+8ITp1Gt4RsgFTbjBiTqRzAf9kJq+i 67kjvEjIvs7y+XrQE7V+dQ2wwDC62WFWoVR5xO853pqwygqMvV4= =0TyA -----END PGP SIGNATURE----- --5ylkdz3epm3sfdhc-- From debbugs-submit-bounces@debbugs.gnu.org Tue Aug 08 15:51:42 2017 Received: (at 28004) by debbugs.gnu.org; 8 Aug 2017 19:51:42 +0000 Received: from localhost ([127.0.0.1]:52239 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1dfAXW-0008CY-IK for submit@debbugs.gnu.org; Tue, 08 Aug 2017 15:51:42 -0400 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:35087) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1dfAXU-0008CO-PJ for 28004@debbugs.gnu.org; Tue, 08 Aug 2017 15:51:41 -0400 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id 6771B20DBD; Tue, 8 Aug 2017 15:51:40 -0400 (EDT) Received: from frontend1 ([10.202.2.160]) by compute4.internal (MEProxy); Tue, 08 Aug 2017 15:51:40 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=famulari.name; h=content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc :x-sasl-enc; s=mesmtp; bh=WKbbD9+fk5QIlzabW3ok92skc7r5JWAiEsKkK+ eTpLo=; b=v9ZPqYUnr3C8zMeJ6DV/zIUXbkleSIRJkgGS2BCZy3e+QXWZNoMEc4 4s7J86YvyETFrnKH0qN0tNOAs1p7+5M4SpyFvAmTdmR3ciRgC+ec9rwoLAtbqfZ1 aooCTJYMpK6NVqNHJ+FPUfODec8qG3kHyIov8Crx2amZr4kBtF3oE= DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc:x-sasl-enc; s=fm1; bh=WKbbD9+fk5QIlzabW3 ok92skc7r5JWAiEsKkK+eTpLo=; b=EpdcsH6VRQsKUqOZK/WAhcwikC9Oxnlgvc kGWm0PADfrNIfOSw9NFDlsrR7y1tcJlvWhrKJyuAbKyHsjSVX6fBQyF1WHSU9kzw FiZd3OctFYyjsClX3FbILlNWpQsQDSN9UtoWRw2zwtK6sYi5zcHuswS2kRovh4/e gW4MLAKqPBQos+8GagrYYECguHMDCUPUUk/XbjqtI0C3UH84+iIbcyKmEojr6rTC v7j/vR8RDH5ywYIn7gtE/5Vkfg6Ljnccbm6WVSOK7z+LVmKZBMGg6/3YLUHGGKZp eGYkA49EzlKwg9cHtJ9wO3Bt3c1adWETZmiRdOxYMiFT5GqpFdLQ== X-ME-Sender: X-Sasl-enc: +RwaQysmDmGQV3Nv2VUkTUjq16vHA2B2h3y0T22d2fhf 1502221900 Received: from localhost (c-73-165-108-70.hsd1.pa.comcast.net [73.165.108.70]) by mail.messagingengine.com (Postfix) with ESMTPA id 2BCBC7F9A9; Tue, 8 Aug 2017 15:51:40 -0400 (EDT) Date: Tue, 8 Aug 2017 15:51:39 -0400 From: Leo Famulari To: Marius Bakke , 28004@debbugs.gnu.org Subject: Re: [bug#28004] Chromium Message-ID: <20170808195139.GB32221@jasmine.lan> References: <87y3qvb15k.fsf@fastmail.com> <20170807202341.5c54jx4mpudor47i@abyayala> <87shh3axjf.fsf@fastmail.com> <20170808131801.snryxiiehczhnibr@abyayala> <20170808142223.re52odap7y32eten@abyayala> <20170808154422.rfmrom3qkgscloyj@abyayala> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="+pHx0qQiF2pBVqBT" Content-Disposition: inline In-Reply-To: <20170808154422.rfmrom3qkgscloyj@abyayala> User-Agent: Mutt/1.8.3 (2017-05-23) X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --+pHx0qQiF2pBVqBT Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Tue, Aug 08, 2017 at 03:44:22PM +0000, ng0 wrote: > x86_64 architecture, builds fails at this point: >=20 > [6247/27388] STAMP obj/mojo/common/common.stamp > [6248/27388] ACTION //net/http:generate_transport_security_state(//build/= toolchain/linux:x64) > FAILED: gen/net/http/transport_security_state_static.h > python ../../build/gn_run_binary.py transport_security_state_generator ..= /../net/http/transport_security_state_static.json ../../net/http/transport_= security_state_static.pins ../../net/http/transport_security_state_static.t= emplate gen/net/http/transport_security_state_static.h > ./transport_security_state_generator: error while loading shared librarie= s: libglib-2.0.so.0: cannot open shared object file: No such file or direct= ory > transport_security_state_generator failed with exit code 127 > [6249/27388] AR obj/sandbox/linux/libsandbox_services.a > ninja: build stopped: subcommand failed. > phase `build' failed after 1777.2 seconds > builder for `/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.0.31= 12.90.drv' failed with exit code 1 > @ build-failed /gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.0.= 3112.90.drv - 1 builder for `/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-ch= romium-60.0.3112.90.drv' failed with exit code 1 > derivation '/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.0.311= 2.90.drv' offloaded to '192.168.1.179' failed: build of `/gnu/store/2afpy54= 2vywbmk093dd1kzlfx74s2460-chromium-60.0.3112.90.drv' failed > @ build-failed /gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.0.= 3112.90.drv - 1 builder for `/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-ch= romium-60.0.3112.90.drv' failed with exit code 100 > guix build: error: build failed: build of `/gnu/store/2afpy542vywbmk093dd= 1kzlfx74s2460-chromium-60.0.3112.90.drv' failed >=20 > Have you experienced this before? Based on discussion on #guix, this package is based on core-updates. Did you try building it on core-updates? --+pHx0qQiF2pBVqBT Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEEsFFZSPHn08G5gDigJkb6MLrKfwgFAlmKFkoACgkQJkb6MLrK fwhSLBAAxNeYKxomhmWr1g0YP/ljXvMPys1+UouTzWoJmX/yvRK4jku/sMXnfinY qmWUgmLFAqcnUdV/fZVPm4SPnyi0uVh4pbNfi1C1gGrcvck33N3L0cYE2rDfl6zL VMMhxVYkFg7Vs92l5wMilbgfqpv4kz+BO66BQvJkP+zcaQoOgknf6ToqR3weNE80 kQiccUsR+/B4jj6+fVAq7ugRUFU4kBnYuhYwR3Xq2BWU8aCv6CfhmVyajairB9QV jB0lI4QCrjBrbFH9dLKaFcbCCHYAfkWJHV5+zyzIjevR4vlAGN0xPEPluEu1rbwJ htcWlrB4i7A6PvavMXtjMoCujqXaF12YjSK6FmoLmt2J19/sEImjmz5zoKvu7K7B LXxEqWixPaP29RlgwEGxI0X7yE8sjZkYvUthdgEV7+rvABxXrxf6waF6vV1dBJ8M iv2KgoAPHYC92GBJc5WPpDr5jh5zBhxcZl5KK3nfS/neOMcVWavLLecWzT3k1rpX WC2CfnR6FQr1ISQpPmleBSckAWQjf/9agWEUtLr3Nv81DXA/USAE/JO1NkQCMyka XC4zxuVF1jTSyHJ1+xEAUdJoqSQO0v3J4u9NGueKWDOGgBqoGvIW6Fjik7u2gsKU dbE1OaDduwNaWsHRxRXliqdynGe2xN0iONvjMEjm3W45ClZqCZo= =5paE -----END PGP SIGNATURE----- --+pHx0qQiF2pBVqBT-- From debbugs-submit-bounces@debbugs.gnu.org Tue Aug 08 16:46:50 2017 Received: (at 28004) by debbugs.gnu.org; 8 Aug 2017 20:46:50 +0000 Received: from localhost ([127.0.0.1]:52278 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1dfBOo-00015E-Hs for submit@debbugs.gnu.org; Tue, 08 Aug 2017 16:46:49 -0400 Received: from aibo.runbox.com ([91.220.196.211]:32832) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1dfBOm-000154-Gq for 28004@debbugs.gnu.org; Tue, 08 Aug 2017 16:46:45 -0400 Received: from [10.9.9.212] (helo=mailfront12.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1dfBOj-0005DR-U3; Tue, 08 Aug 2017 22:46:42 +0200 Received: from tornode.torreactor.ml ([78.109.23.1] helo=localhost) by mailfront12.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1dfBOf-0004T5-VM; Tue, 08 Aug 2017 22:46:38 +0200 Date: Tue, 8 Aug 2017 20:46:33 +0000 From: ng0 To: Leo Famulari Subject: Re: [bug#28004] Chromium Message-ID: <20170808204633.6imimm5u3fycyb6o@abyayala> Mail-Followup-To: Leo Famulari , Marius Bakke , 28004@debbugs.gnu.org References: <87y3qvb15k.fsf@fastmail.com> <20170807202341.5c54jx4mpudor47i@abyayala> <87shh3axjf.fsf@fastmail.com> <20170808131801.snryxiiehczhnibr@abyayala> <20170808142223.re52odap7y32eten@abyayala> <20170808154422.rfmrom3qkgscloyj@abyayala> <20170808195139.GB32221@jasmine.lan> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="ykvlhrzop3gguvph" Content-Disposition: inline In-Reply-To: <20170808195139.GB32221@jasmine.lan> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Marius Bakke X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --ykvlhrzop3gguvph Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Leo Famulari transcribed 3.0K bytes: > On Tue, Aug 08, 2017 at 03:44:22PM +0000, ng0 wrote: > > x86_64 architecture, builds fails at this point: > >=20 > > [6247/27388] STAMP obj/mojo/common/common.stamp > > [6248/27388] ACTION //net/http:generate_transport_security_state(//buil= d/toolchain/linux:x64) > > FAILED: gen/net/http/transport_security_state_static.h > > python ../../build/gn_run_binary.py transport_security_state_generator = =2E./../net/http/transport_security_state_static.json ../../net/http/transp= ort_security_state_static.pins ../../net/http/transport_security_state_stat= ic.template gen/net/http/transport_security_state_static.h > > ./transport_security_state_generator: error while loading shared librar= ies: libglib-2.0.so.0: cannot open shared object file: No such file or dire= ctory > > transport_security_state_generator failed with exit code 127 > > [6249/27388] AR obj/sandbox/linux/libsandbox_services.a > > ninja: build stopped: subcommand failed. > > phase `build' failed after 1777.2 seconds > > builder for `/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.0.= 3112.90.drv' failed with exit code 1 > > @ build-failed /gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.= 0.3112.90.drv - 1 builder for `/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-= chromium-60.0.3112.90.drv' failed with exit code 1 > > derivation '/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.0.3= 112.90.drv' offloaded to '192.168.1.179' failed: build of `/gnu/store/2afpy= 542vywbmk093dd1kzlfx74s2460-chromium-60.0.3112.90.drv' failed > > @ build-failed /gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-chromium-60.= 0.3112.90.drv - 1 builder for `/gnu/store/2afpy542vywbmk093dd1kzlfx74s2460-= chromium-60.0.3112.90.drv' failed with exit code 100 > > guix build: error: build failed: build of `/gnu/store/2afpy542vywbmk093= dd1kzlfx74s2460-chromium-60.0.3112.90.drv' failed > >=20 > > Have you experienced this before? >=20 > Based on discussion on #guix, this package is based on core-updates. Did > you try building it on core-updates? No, I have no time for switching a system to core-updates for a moment and = dealing with whatever needs to be dealt with before I can build it there, unless core-up= dates is stable. I don't want to be the roadblock, I could test it at some point in the next= 2 - 3 weeks and this package looks like it is good to go if it builds. --=20 ng0 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://n0is.noblogs.org/my-keys https://www.infotropique.org https://krosos.org --ykvlhrzop3gguvph Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlmKIykACgkQ4i+bv+40 hYifmA//cuH4rNuNE4c2046amm5+QtEoNi481/GEQadiptjZhDZO4wXhU7QO1Muc uHBJm/f9LK3hCg0bMgi3fvLXqaqAU16XTgJgkIr6jDzXPAG5h0ujgNnORMRqPFp+ bkzBmvEVG4+M14sOpVCqfGSJMu8TuO83hF06X0mJCrRfUU1Xp+nCyEOOzfDqllNy xDRc64MXZWeSARcCE29w3Rq35gYK8O1ZoVIyCrw6/oM7yY5Uy9p64M/++thk2qRs LX1kFf6YGfuhnyie2cRYV+6VJfcw3Vw1MtqFoI6Mkmtcripn2m7o0w/vnb3/AHP0 9BONRowt6FDJtwr+jerwxVFImp79aIEyYFSCA8FnLPKMhFiawmO0jrH5/WUMxHHK RBjHxLvI7dXJiICiGpaWGnltv4xpJaVsWKbDyo2uOClfyRgPvrIBkDxto03OhviZ D4/FPaQVnUJa+FFJWfyIBAkwVnDbwc8B98qD7eoVzss5rq0qVqiIYNsEI/FDWB5k 0p9hOBLqOmKzO8LakeaX19a4OUJ6Q8R0mh7WZl2o8PvDOr3mv64f68ZUQhH/M5U0 fWAT6QkhwmYekAB/t2XgkVf4xFdmGSgQu4PaXGt7OHP9WTjtiyLi19dQj7YH/AYW 34zzMTpD0XAwbpI0LqvFkB4YDhNwM65iKmgKMRoBkVwfUFYhPAI= =5DGU -----END PGP SIGNATURE----- --ykvlhrzop3gguvph-- From debbugs-submit-bounces@debbugs.gnu.org Thu Aug 10 01:32:03 2017 Received: (at 28004) by debbugs.gnu.org; 10 Aug 2017 05:32:03 +0000 Received: from localhost ([127.0.0.1]:53912 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1dfg4h-0003qk-2O for submit@debbugs.gnu.org; Thu, 10 Aug 2017 01:32:03 -0400 Received: from flashner.co.il ([178.62.234.194]:48090) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1dfg4c-0003qE-EG for 28004@debbugs.gnu.org; Thu, 10 Aug 2017 01:31:58 -0400 Received: from localhost (46-117-130-79.bb.netvision.net.il [46.117.130.79]) by flashner.co.il (Postfix) with ESMTPSA id 32EFF4012C for <28004@debbugs.gnu.org>; Thu, 10 Aug 2017 05:31:52 +0000 (UTC) Date: Thu, 10 Aug 2017 08:31:49 +0300 From: Efraim Flashner To: 28004@debbugs.gnu.org Subject: Re: [bug#28004] Chromium Message-ID: <20170810053149.GH2458@macbook42.flashner.co.il> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="VaKJWhUROU/xPxjb" Content-Disposition: inline User-Agent: Mutt/1.8.3 (2017-05-23) X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.0 (/) --VaKJWhUROU/xPxjb Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable This built on aarch64 on core-updates in about 12.5 hours. I did need to add the following substitution* to the package definition. diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm index 81bcb8f05..855779a11 100644 --- a/gnu/packages/chromium.scm +++ b/gnu/packages/chromium.scm @@ -346,6 +346,13 @@ (("include \"third_party/curl") "include \"curl")) (substitute* "media/base/decode_capabilities.cc" (("third_party/libvpx/source/libvpx/") "")) + + ;; We don't cross compile most packages, so get rid of the + ;; unnecessary ARCH-linux-gnu* prefix. + (substitute* "build/toolchain/linux/BUILD.gn" + (("aarch64-linux-gnu-") "") + (("arm-linux-gnueabihf-") "")) + #t)) (replace 'configure (lambda* (#:key inputs outputs #:allow-other-keys) With this addition it builds for me. --=20 Efraim Flashner =D7=90=D7=A4=D7=A8=D7=99=D7=9D = =D7=A4=D7=9C=D7=A9=D7=A0=D7=A8 GPG key =3D A28B F40C 3E55 1372 662D 14F7 41AA E7DC CA3D 8351 Confidentiality cannot be guaranteed on emails sent or received unencrypted --VaKJWhUROU/xPxjb Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAEBCgAdFiEEoov0DD5VE3JmLRT3Qarn3Mo9g1EFAlmL77oACgkQQarn3Mo9 g1HLEw//Z1BXa7VVH3fdq+YCGVNmaOmw6UUG8Szq4MVJJQX9n2DWpJkVPNOxpoPS 8IFEXxetMTKvaB5Ph1SJ80S+BWPlQO3wCmwPWFkk5EARRirajydqmVfZWoiBfwSc R8Z0TKPjCnyinxBet9aoj3t7sWUm379E++VSlYPSx5gi2Imhfk6wiUaysiNZf/pG ZF4qqk3RzYO9BoIn+l9lS1HZhN8EmcJWEMzeVg8Cdzx0IWDKhP7Z26+yIHR6vBMB IEzwv502Kc6U7qhnu+NJKKz/EttbrNv2dTlHzhZ/iRamb6+2PZv7bOjUwMyXyms5 Rg0L0NZiXq11Y2xFMZXwvbY3hz60vv6dXYyT0kwlzB7MLymeQ7Kj5A/hhfHsIkUk ZLN1kma1AlPuHCKhDRAT1NsmILVHQz8aASXjYLWIEI+OB1AOk0tuZw2Aa2ryII54 9JpocoAGDkUHsey2gtLgXMuVnUlpEYB8Qq+aqZgkPVr7WCukOZqG7WT+azUp5mLm EgV5YI/Au+vXn6Z433xIe0D4r16IUKSH8T/5LmFFgXIqYrOjPIkrwSHWWttzTZdu +rkrX9ROli4XW/XRc/pE5rInPPLd0baEvZnuEhFMjDx7qtAEtoIJNkhAb8OZASIZ +Qt2D49Nub6TU+ACnravUMfSKDL584d2k9nlc7LkVrTlEqSQYA4= =l6O7 -----END PGP SIGNATURE----- --VaKJWhUROU/xPxjb-- From debbugs-submit-bounces@debbugs.gnu.org Thu Aug 31 03:37:01 2017 Received: (at 28004) by debbugs.gnu.org; 31 Aug 2017 07:37:01 +0000 Received: from localhost ([127.0.0.1]:36027 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1dnK28-0003e0-Su for submit@debbugs.gnu.org; Thu, 31 Aug 2017 03:37:01 -0400 Received: from aibo.runbox.com ([91.220.196.211]:60886) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1dnK26-0003dr-QG for 28004@debbugs.gnu.org; Thu, 31 Aug 2017 03:36:59 -0400 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit03.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1dnK24-0004PJ-Az; Thu, 31 Aug 2017 09:36:56 +0200 Received: from [89.248.166.157] (helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1dnK20-00013U-O7; Thu, 31 Aug 2017 09:36:53 +0200 Date: Thu, 31 Aug 2017 07:36:49 +0000 From: ng0 To: Efraim Flashner Subject: Re: [bug#28004] Chromium Message-ID: <20170831073649.ln3fhfj6l33kha46@abyayala> Mail-Followup-To: Efraim Flashner , 28004@debbugs.gnu.org References: <87y3qvb15k.fsf@fastmail.com> <20170810053149.GH2458@macbook42.flashner.co.il> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="sry552gbwr5qzg6c" Content-Disposition: inline In-Reply-To: <20170810053149.GH2458@macbook42.flashner.co.il> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --sry552gbwr5qzg6c Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Efraim Flashner transcribed 2.2K bytes: > This built on aarch64 on core-updates in about 12.5 hours. I did need to > add the following substitution* to the package definition. As core-updates has been merged now, is this package good to go? I could build it on my x86_64 builder this afternoon if it requires one more check. --=20 ng0 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://n0is.noblogs.org/my-keys https://www.infotropique.org https://krosos.org --sry552gbwr5qzg6c Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlmnvJEACgkQ4i+bv+40 hYh6+A//ZRKWqt0lDh9zOKxk/jL4y64Q63Unt1/ENauWPzkgY6ZHl1ouQlLOPet9 fuA7b/KNfAgf4Q8S1Vn2TxAiCOfxV2W+FV7Xf98C8JoDcXuOFi1l5vDtWyLKnhQK 78mLWTCswa1go8Gp9e0HPKfUzs6EaxXiHmn3RYOWZJJpDFlY5v8mFn2uJ5/Cj4Le 21NdKb/TrBMOFoM5ULxzehXqGMg14wjwSD/Y427QY67hWM3cz1Qlpqra9mkoZXTU KhUO3ruu4LBmjiJ3Szh6KaDaH+OpL3lE+GSjQByCTZ2c3IA9XQ49kZjELn+WFmxS olGsdJxNKn7fypQKRP36fSSoSNfcl7dkEzuRsHXLDh7AbLVLtmqiQ0hUA8+EDVxA TJWA7/2ArU1lsGGNsKW4aCq/rC8a2rHdNU6m4HFgU+IHoN/ei7GKtmheryMGgcQ9 MAiGFg9qh06TguX0A7GJPnBV1b7gQjPMweqB+rIbhOE/sDi+X6ppuYhkqrA5+Utr KCyId4TKPZh1R+2wBrQzVgTfx+39semlxbUZgXkcoD0lF9ejz3FL5QvEjXG17Z1d Rb/ZuWw2pg1MUSO4dNtak0pQ2juee8YAs2NgPLiHsvliDHROo7+XUn2IMeViOe3E gHVlnypnATlvGFkxDlCxGAT3wpkDylCpmJauamOxC1Whxrh/Ndg= =ezrJ -----END PGP SIGNATURE----- --sry552gbwr5qzg6c-- From debbugs-submit-bounces@debbugs.gnu.org Tue Oct 10 09:20:07 2017 Received: (at 28004) by debbugs.gnu.org; 10 Oct 2017 13:20:07 +0000 Received: from localhost ([127.0.0.1]:59417 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e1uS6-0003GX-Si for submit@debbugs.gnu.org; Tue, 10 Oct 2017 09:20:07 -0400 Received: from aibo.runbox.com ([91.220.196.211]:36546) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e1uS4-0003GN-Nu for 28004@debbugs.gnu.org; Tue, 10 Oct 2017 09:20:05 -0400 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1e1uS3-0007pg-Ia; Tue, 10 Oct 2017 15:20:03 +0200 Received: from torsrv6.snydernet.net ([178.175.131.194] helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1e1uRs-0001EW-EL; Tue, 10 Oct 2017 15:19:52 +0200 Date: Tue, 10 Oct 2017 13:19:49 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20171010131949.y43plpzxbppvrigr@abyayala> References: <87y3qvb15k.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="5m7wnijtj2inbq6o" Content-Disposition: inline In-Reply-To: <87y3qvb15k.fsf@fastmail.com> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --5m7wnijtj2inbq6o Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 43K bytes: > Hello Guix! >=20 > Attached is a patch for Chromium, a popular web browser. >=20 > It requires the new ld wrapper from 'core-updates' and a very powerful > build machine (a quad-core Sandy Bridge Xeon uses 2-3 hours). >=20 > Note that I cannot guarantee timely delivery of security updates. Major > version upgrades are hugely painful, and almost always contain many > high-severity fixes. Should we mention that in the description? >=20 > Happy for any feedback. Hi, could this patch be merged into master now? It would be too bad to see this gathering digitial dust. --=20 ng0 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://dist.ng0.infotropique.org/dist/keys/ https://www.infotropique.org https://ng0.infotropique.org --5m7wnijtj2inbq6o Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlncyPUACgkQ4i+bv+40 hYh+OA/8DL/2Ce/FbX+yHFPaTgTYTXIy7mnPQYChqSxitmC2V8ot9hsci9dOvPwu bJXFc3vbC1OPaELaPkI0E7ZVBso8maApMy/Pp9ajNQwZxTxDfmcH7ofUc1lqS6z5 oBO6l0cd8golJedSpWBM2fiD6EsbgBA7gYGnND+1fJAdFkxvFWp7wmTekxfCjQKR gWsPFtF1uOS+4fRoLHrlHBs5CMeiULOsJV6ju+amiUlBg5wziwaUz6X33c8JoOXM Twa0vADwa4Lz1pO1IqMZCRAjitPuW6/bjYf3+D7PcW4OazxJ5f9C/NyYFnrAcmnr sK7+rKs0JrfYvq/dSerhh+XKyf7wfapiHxEs3PeBmfnBPrTrTivaCJjdZAQM3KZQ V1KXEQBcrvbQrIR5dEOw8/YdsfwR0lJSle3vWaL6/6AWeJ4T4r2rHgbiRyjN9djT VVuLY81YnUmUrsC6rvZUXHzFIQmzwEooIif9jGAh+JsgXReZrlS5GLBNWMqKzJh5 skQl3DeDNtfs7Yg9X7eJqzoracnygCToC0rx55NmBGSJjH4Sb4eA3D9GQ2q+xKfQ bQoJIhN5zHaLEyy4UxUYmvv3DEvvzWlck3VJ3SGYBfpwMo3+RJ8I8VErcblDRdEe jt8uzWb6hNPhAErr0JFOcjm8xh2gcGqB8wPQAvrhjiAGDjtx8PI= =SY74 -----END PGP SIGNATURE----- --5m7wnijtj2inbq6o-- From debbugs-submit-bounces@debbugs.gnu.org Wed Oct 11 15:53:01 2017 Received: (at 28004) by debbugs.gnu.org; 11 Oct 2017 19:53:01 +0000 Received: from localhost ([127.0.0.1]:34504 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e2N3t-0006Bq-9n for submit@debbugs.gnu.org; Wed, 11 Oct 2017 15:53:01 -0400 Received: from eggs.gnu.org ([208.118.235.92]:53004) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e2N3r-0006Be-O1 for 28004@debbugs.gnu.org; Wed, 11 Oct 2017 15:52:59 -0400 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1e2N3l-0007KR-O8 for 28004@debbugs.gnu.org; Wed, 11 Oct 2017 15:52:54 -0400 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=0.8 required=5.0 tests=BAYES_50,RP_MATCHES_RCVD autolearn=disabled version=3.3.2 Received: from fencepost.gnu.org ([2001:4830:134:3::e]:57624) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1e2N3l-0007KM-LI; Wed, 11 Oct 2017 15:52:53 -0400 Received: from [2a01:e0a:1d:7270:6a6c:dc17:fc02:cfda] (port=48882 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1e2N3l-0008Dq-3T; Wed, 11 Oct 2017 15:52:53 -0400 From: ludo@gnu.org (Ludovic =?utf-8?Q?Court=C3=A8s?=) To: ng0 , Leo Famulari Subject: Re: [bug#28004] Chromium References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 20 =?utf-8?Q?Vend=C3=A9miaire?= an 226 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Wed, 11 Oct 2017 21:52:46 +0200 In-Reply-To: <20171010131949.y43plpzxbppvrigr@abyayala> (ng0@infotropique.org's message of "Tue, 10 Oct 2017 13:19:49 +0000") Message-ID: <87lgkha2cx.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/25.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Received-From: 2001:4830:134:3::e X-Spam-Score: -5.0 (-----) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Marius Bakke X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -5.0 (-----) Hi! ng0 skribis: > Marius Bakke transcribed 43K bytes: >> Hello Guix! >>=20 >> Attached is a patch for Chromium, a popular web browser. >>=20 >> It requires the new ld wrapper from 'core-updates' and a very powerful >> build machine (a quad-core Sandy Bridge Xeon uses 2-3 hours). >>=20 >> Note that I cannot guarantee timely delivery of security updates. Major >> version upgrades are hugely painful, and almost always contain many >> high-severity fixes. Should we mention that in the description? >>=20 >> Happy for any feedback. > > Hi, > > could this patch be merged into master now? Probably (I think at the time Marius submitted it the =E2=80=98ld=E2=80=99 = wrapper enhancements were not in =E2=80=98master=E2=80=99 yet.) For the security aspect though, given that it=E2=80=99s a fairly critical component, I=E2=80=99d like to have Leo=E2=80=99s opinion. Thoughts? > It would be too bad to see this gathering digitial dust. Indeed! Thanks, Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Thu Oct 12 16:05:36 2017 Received: (at 28004) by debbugs.gnu.org; 12 Oct 2017 20:05:36 +0000 Received: from localhost ([127.0.0.1]:36387 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e2jjc-00035y-5T for submit@debbugs.gnu.org; Thu, 12 Oct 2017 16:05:36 -0400 Received: from out2-smtp.messagingengine.com ([66.111.4.26]:54185) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e2jja-00035m-4E for 28004@debbugs.gnu.org; Thu, 12 Oct 2017 16:05:34 -0400 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id 1732F21224; Thu, 12 Oct 2017 16:05:33 -0400 (EDT) Received: from frontend1 ([10.202.2.160]) by compute4.internal (MEProxy); Thu, 12 Oct 2017 16:05:33 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=famulari.name; h=cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= mesmtp; bh=yV869GRz9geCcOicTDyqNyJanLGOJTucQYSdj1jL5mY=; b=Wadzv 9bRnIHJJHm9n3cx1xWX8DNyTRqN0xwxi/VaQ3WDG1U3hVo9qpJ0kimdvUcrUSOS8 QWwLRX2N7q9xMYG0wrJ8DvId22Nouqm57PwoWuVDotq9DLu1KwDtu54Qx2vZLhP2 EjMbl3VopCNBgf6fKzA1z+mziToH61Ajc68RTM= DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm1; bh=yV869GRz9geCcOicTDyqNyJanLGOJ TucQYSdj1jL5mY=; b=e84QCKQQ4n5PgCW4Zl6ICNZSu/3KlMRLRTSNQb7B4BRxg SMC9xpe7A2brUnYvAePe6JzabWiSIax8wZyoruh0zMdjAeNSewvp4i+1L9QCdMod T7it7Rm5oVkufZz06+kqx1yjwYDUnsu5VlpZeO8pKwXIQZ9EYxzXA23LScS5fDWx sIu7zhbMautLvFH394kbl0wwCIc3dr+zt8ybFwdGqDaRG4zSgQsECZARJRW7RshS xqbGLQjV4t31ZLmwRrlXDxGQr1YnzoacQ9wgJPvL/AAPkUeSw0kCNvQ4NLICk990 fe7nIaWFb906eTn+4mVhfxsquWtBbmOvzP25kO5mA== X-ME-Sender: Received: from localhost (c-73-165-108-70.hsd1.pa.comcast.net [73.165.108.70]) by mail.messagingengine.com (Postfix) with ESMTPA id AD8867F92A; Thu, 12 Oct 2017 16:05:32 -0400 (EDT) Date: Thu, 12 Oct 2017 15:56:28 -0400 From: Leo Famulari To: Ludovic =?iso-8859-1?Q?Court=E8s?= Subject: Re: [bug#28004] Chromium Message-ID: <20171012195628.GA31843@jasmine.lan> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="qMm9M+Fa2AknHoGS" Content-Disposition: inline In-Reply-To: <87lgkha2cx.fsf@gnu.org> User-Agent: Mutt/1.9.1 (2017-09-22) X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Marius Bakke , ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --qMm9M+Fa2AknHoGS Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Wed, Oct 11, 2017 at 09:52:46PM +0200, Ludovic Court=C3=A8s wrote: > ng0 skribis: > > could this patch be merged into master now? >=20 > Probably (I think at the time Marius submitted it the =E2=80=98ld=E2=80= =99 wrapper > enhancements were not in =E2=80=98master=E2=80=99 yet.) >=20 > For the security aspect though, given that it=E2=80=99s a fairly critical > component, I=E2=80=99d like to have Leo=E2=80=99s opinion. Thoughts? Any questions in particular? For me, the primary question is maintenance. As Marius pointed out when sending the patch, major version upgrades may be difficult, and timely delivery of security updates cannot be guaranteed. But these caveats apply to every package. [0] They aren't a reason to exclude Chromium from Guix. Now, if we add the Chromium package and then let if fall behind for weeks or months, that will be a problem, and we will need to remove it. It's relatively easy to remove packages of end-user applications, since it's rare that other packages depend on them. As always, I'm willing to help with security updates as much as my volunteer schedule allows. The other issue will be bugs caused by the use of non-bundled libraries. Presumably, important bugs are fixed in the bundled libraries before they are released by the upstream library (if ever). But again, this is an issue with all of our packages. We will address these issues when we find them. There was a new release last month, 61.0.3163. I'd like to try updating to it this weekend if I have the disk (does anyone know how much is required) and computing power. Then we can push :) [0] Users who really need to rely on the security of Chromium or Chrome should use the "official" installation from the Chromium or Google teams, and turn on auto-updates. Every update can be expected to fix critical bugs. --qMm9M+Fa2AknHoGS Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEEsFFZSPHn08G5gDigJkb6MLrKfwgFAlnfyOkACgkQJkb6MLrK fwhMuRAAzRlNHHyaU11WhgvdpnUdH/cN4sKNUW9sYQdigUSq+CnFEvCAK2WonkH9 D6+jfgcmZDL4d1/h/e8dIuA8+3SpL7sisrYhqrwxnIm7DmFEIAmM783QM0Z80+NF V1MdC7LBb5Rho5cRbXdMQxIGz8BbgEzwZFgjvpuAeMAkKhX46LP3S8f/NYm8obpN TmZhrRtFEzMkYa5Z3RPgeMEaxiyFmUSExppguhjbXeMuW6/Gl161lV6mF6AD6qza ExT0YY+xF5w3o+k3i80mfKzA9XPH9mi7LWbRuaORgO0OiNqyw6mP+rUaJfMwE0n7 ZTglRIL1iJgCXteTp9zl/EJOAcNUvVVuKR9kHOMaz1VIFvmhtscMRirHkWDd47iH 4SvmkbQ9qvMDUne59uulQKC7p08R8hG+IG+ZJUHEa7i3/lLeCAkb3jS1GbSVXQ0w vJFDBfg5IKmHDGLgA8niZxmVFmHva6L0neoT5RMkeuRLYw0Z8Wpgbl7Y21UyoLKL bsehhMC+kVBtMvA+y2F0rYHlTOkYxKL9j576as1OvJjaLm+jJHlKlrnUYMAA8oud xYSL88sqGEgJ9JiRusf+Ehrres+CAYxuNJItqSRzQmyLBKl7NReDCGtuOAGAMcMC dYH3FFgCBalyqDX0xifPOSlaoMxEQfGeUV1jmBMxEygwctL+330= =GPw3 -----END PGP SIGNATURE----- --qMm9M+Fa2AknHoGS-- From debbugs-submit-bounces@debbugs.gnu.org Thu Oct 12 16:29:00 2017 Received: (at 28004) by debbugs.gnu.org; 12 Oct 2017 20:29:00 +0000 Received: from localhost ([127.0.0.1]:36399 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e2k6G-0003gO-Ag for submit@debbugs.gnu.org; Thu, 12 Oct 2017 16:29:00 -0400 Received: from aibo.runbox.com ([91.220.196.211]:33366) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e2k6E-0003gG-7Y for 28004@debbugs.gnu.org; Thu, 12 Oct 2017 16:28:58 -0400 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit03.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1e2k69-0007gN-EO; Thu, 12 Oct 2017 22:28:53 +0200 Received: from [85.159.237.210] (helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1e2k5f-0001it-1G; Thu, 12 Oct 2017 22:28:23 +0200 Date: Thu, 12 Oct 2017 20:28:18 +0000 From: ng0 To: Leo Famulari Subject: Re: [bug#28004] Chromium Message-ID: <20171012202818.kuxrucng2xbvabo3@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="ajc7ngzq362ceeil" Content-Disposition: inline In-Reply-To: <20171012195628.GA31843@jasmine.lan> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Ludovic =?utf-8?Q?Court=C3=A8s?= , Marius Bakke , ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --ajc7ngzq362ceeil Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Leo Famulari transcribed 2.9K bytes: > On Wed, Oct 11, 2017 at 09:52:46PM +0200, Ludovic Court=C3=A8s wrote: > > ng0 skribis: > > > could this patch be merged into master now? > >=20 > > Probably (I think at the time Marius submitted it the =E2=80=98ld=E2=80= =99 wrapper > > enhancements were not in =E2=80=98master=E2=80=99 yet.) > >=20 > > For the security aspect though, given that it=E2=80=99s a fairly critic= al > > component, I=E2=80=99d like to have Leo=E2=80=99s opinion. Thoughts? >=20 > Any questions in particular? >=20 > For me, the primary question is maintenance. >=20 > As Marius pointed out when sending the patch, major version upgrades may > be difficult, and timely delivery of security updates cannot be > guaranteed. But these caveats apply to every package. [0] They aren't a > reason to exclude Chromium from Guix. >=20 > Now, if we add the Chromium package and then let if fall behind for > weeks or months, that will be a problem, and we will need to remove it. > It's relatively easy to remove packages of end-user applications, since > it's rare that other packages depend on them. >=20 > As always, I'm willing to help with security updates as much as my > volunteer schedule allows. >=20 > The other issue will be bugs caused by the use of non-bundled libraries. > Presumably, important bugs are fixed in the bundled libraries before > they are released by the upstream library (if ever). But again, this is > an issue with all of our packages. We will address these issues when we > find them. >=20 > There was a new release last month, 61.0.3163. I'd like to try updating > to it this weekend if I have the disk (does anyone know how much is > required) and computing power. Then we can push :) Around 8 GiB for a full build as far as I know, that is when you include debbuging symbols. So it's less than 8 GiB. > [0] Users who really need to rely on the security of Chromium or Chrome > should use the "official" installation from the Chromium or Google > teams, and turn on auto-updates. Every update can be expected to fix > critical bugs. --=20 ng0 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://dist.ng0.infotropique.org/dist/keys/ https://www.infotropique.org https://ng0.infotropique.org --ajc7ngzq362ceeil Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlnf0GIACgkQ4i+bv+40 hYhDYQ/7BEycQQ89P6BWD45IXq/kk5va4Nk40CSFiZlI+Ja3FJAIiPGX1PzAxEQJ Rc8nl0bsUt+wkkAyOsShGktFXmIgHdgJ+QpqOSv/pZVu5tcV3hZ0wq8Df0X6rIDL 1l3+KEzlHwlphzGk/lrvKot5Np/OiTSWTNE8iRnvlqSxKBv4g/o5PNup9fuvNCsd QRn9Mlm42sCm+g4Jg9Qr+xN6qOBadVutG6NFfPHPIAVAiLoe4nx6JcZX+xs2xEvw PJbmQlRp4ObkDUo3rC+AS/++tGhE3bpI4BWGlmePpBQdiRDMVlNkA73o5HfNjKzt S14Isrzd3ri6xuWMri8aOMCgwJeRdleqrPENpXukl2cQLx5uBj5BrQRe1lEnfgVM PE9jBq7dZVwTDNNFy6NgTmodM+oucJHE4ILN3ZPnj4meARQVZUZ7cfeFL3uRozdR jBxo4WdCt4W4QtdqvbpvE9YoiRPStcFJSoWCR9ZqhD13rcBBhMuXR8kUdB6erZ/J U4iiMqiAp7GZvzV6SQp/99II3Ym3PeTcB0RT16HVuX9mJDiKRANAwebfkeVSJ3yk Kv9Z+NotWFSDq4m3Ha86c0/+w8Nyv7wwM2b9p5i4iLGby1WapsRaJUaghAhPPujn wl8WqgreaZ6KAS5B1NJC12FPEC3uZln4BbYDn85Vt/oUn389NJ0= =zg6Y -----END PGP SIGNATURE----- --ajc7ngzq362ceeil-- From debbugs-submit-bounces@debbugs.gnu.org Fri Oct 13 02:51:21 2017 Received: (at 28004) by debbugs.gnu.org; 13 Oct 2017 06:51:21 +0000 Received: from localhost ([127.0.0.1]:36667 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e2toX-0008Tn-At for submit@debbugs.gnu.org; Fri, 13 Oct 2017 02:51:21 -0400 Received: from hera.aquilenet.fr ([141.255.128.1]:52223) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e2toV-0008Tc-1l for 28004@debbugs.gnu.org; Fri, 13 Oct 2017 02:51:19 -0400 Received: from localhost (localhost [127.0.0.1]) by hera.aquilenet.fr (Postfix) with ESMTP id 04333BD0F; Fri, 13 Oct 2017 08:51:18 +0200 (CEST) X-Virus-Scanned: Debian amavisd-new at aquilenet.fr Received: from hera.aquilenet.fr ([127.0.0.1]) by localhost (hera.aquilenet.fr [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id B1M-_eV3e95b; Fri, 13 Oct 2017 08:51:15 +0200 (CEST) Received: from ribbon (unknown [193.50.110.214]) by hera.aquilenet.fr (Postfix) with ESMTPSA id 77BA9B474; Fri, 13 Oct 2017 08:51:15 +0200 (CEST) From: ludo@gnu.org (Ludovic =?utf-8?Q?Court=C3=A8s?=) To: Leo Famulari Subject: Re: [bug#28004] Chromium References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 22 =?utf-8?Q?Vend=C3=A9miaire?= an 226 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Fri, 13 Oct 2017 08:51:13 +0200 In-Reply-To: <20171012195628.GA31843@jasmine.lan> (Leo Famulari's message of "Thu, 12 Oct 2017 15:56:28 -0400") Message-ID: <87shensfq6.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/25.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: 1.0 (+) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Marius Bakke , ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 1.0 (+) Heya, Leo Famulari skribis: > On Wed, Oct 11, 2017 at 09:52:46PM +0200, Ludovic Court=C3=A8s wrote: >> ng0 skribis: >> > could this patch be merged into master now? >>=20 >> Probably (I think at the time Marius submitted it the =E2=80=98ld=E2=80= =99 wrapper >> enhancements were not in =E2=80=98master=E2=80=99 yet.) >>=20 >> For the security aspect though, given that it=E2=80=99s a fairly critical >> component, I=E2=80=99d like to have Leo=E2=80=99s opinion. Thoughts? > > Any questions in particular? Not really, I was wondering about the Marius=E2=80=99 warning as to the difficulty of keeping it up-to-date. > For me, the primary question is maintenance. > > As Marius pointed out when sending the patch, major version upgrades may > be difficult, and timely delivery of security updates cannot be > guaranteed. But these caveats apply to every package. [0] They aren't a > reason to exclude Chromium from Guix. Right. A browser is particularly sensitive though. > Now, if we add the Chromium package and then let if fall behind for > weeks or months, that will be a problem, and we will need to remove it. > It's relatively easy to remove packages of end-user applications, since > it's rare that other packages depend on them. > > As always, I'm willing to help with security updates as much as my > volunteer schedule allows. > > The other issue will be bugs caused by the use of non-bundled libraries. > Presumably, important bugs are fixed in the bundled libraries before > they are released by the upstream library (if ever). But again, this is > an issue with all of our packages. We will address these issues when we > find them. Yeah. > There was a new release last month, 61.0.3163. I'd like to try updating > to it this weekend if I have the disk (does anyone know how much is > required) and computing power. Then we can push :) Sounds like a plan! > [0] Users who really need to rely on the security of Chromium or Chrome > should use the "official" installation from the Chromium or Google > teams, and turn on auto-updates. Every update can be expected to fix > critical bugs. I get your point, but OTOH getting binaries from Google is not something I feel like recommending. :-) I think we should make sure that our package does not call home in any way. That=E2=80=99s what I expect from a security- and privacy-conscious distro. WDYT? Thanks for your feedback! Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Wed Oct 18 18:41:17 2017 Received: (at 28004) by debbugs.gnu.org; 18 Oct 2017 22:41:17 +0000 Received: from localhost ([127.0.0.1]:48821 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e4x1P-0006Va-BW for submit@debbugs.gnu.org; Wed, 18 Oct 2017 18:41:17 -0400 Received: from out4-smtp.messagingengine.com ([66.111.4.28]:36355) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e4x1M-0006VR-GQ for 28004@debbugs.gnu.org; Wed, 18 Oct 2017 18:41:05 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 2F18820BE7; Wed, 18 Oct 2017 18:41:04 -0400 (EDT) Received: from frontend2 ([10.202.2.161]) by compute5.internal (MEProxy); Wed, 18 Oct 2017 18:41:04 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=fCAkSGH+w9xlS6+kBle36pyUTnnc4v2l7rZpDmnslSc=; b=eATJMHSC 6XjqhpJRSPCuYhteEKVRk3VwlpS6E+b4ZZmXMHclFd9ez8DD89Ggc1WaLBp0w5nE PMGbLavInawCR1MMOY/zF+hlKPJWwu85rF3YuQ3+VJEgjzQ71UKN8ntvBwg8nIKr 7O9JfaauNaYS3bSQUZ3f9KQ2U/JS65Mv0FajBUCLoMgqYS645gjAOWu19J9yvUcc VLNptOvy+uXSl+bzdjbbV5SzsfDWLC5IusnMdjdKe9AjzhF8w3UJbTjOA5HkDJXQ bcrXwyNs+98c8lB817BfZPmNw07ZQ02XOf+ixixnygeske9sNocr6Zo+NdEHiqgb tMA3eRREDzYCdQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm1; bh=fCAkSGH+w9xlS6+kBle36pyUTnnc4 v2l7rZpDmnslSc=; b=bZ6fEz6UqKrUXc/YB91ThAc3zGY9Yr16Xme/2yUtCc2sq KTwYSkYzcJqI3KIOBADkxYzXHuAOWpCm00mdzIvDFzfHuIUsCue5kVHeY53QSbWu bRwns6Lp8/G1IPhZV9znr6BEqbNUu8UrgatV3omOm+Fpoy4OICrMkMDeY+4J96RV +tWrXBssm1Oc8ICkA1D+qjBvWoMhoIN+EfguOQ49yZgqsgISX08kFZd+BnXNqHjo 9o5pjBOuyxo3QllPtKhtRLSFNFA0LqS//nXFDGFrMuB5ZeEe9POdaf84s6tEgWfO WtFJHIRYnZI4PsHAJFMYeabz38eiyyvZ2s3Knmj3A== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id 2FA152473E; Wed, 18 Oct 2017 18:41:03 -0400 (EDT) From: Marius Bakke To: Ludovic =?utf-8?Q?Court=C3=A8s?= , Leo Famulari Subject: Re: [bug#28004] Chromium In-Reply-To: <87shensfq6.fsf@gnu.org> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> User-Agent: Notmuch/0.25.1 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Thu, 19 Oct 2017 00:41:01 +0200 Message-ID: <87o9p45bb6.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.0 (/) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Ludovic Court=C3=A8s writes: > I think we should make sure that our package does not call home in any > way. That=E2=80=99s what I expect from a security- and privacy-conscious > distro. Currently, it calls home at first launch, prompting for a login. But I've verified that it does not send any unsolicited requests for subsequent startups, as long as the user does not change the command-line flags. Anyway I'm attaching the current iteration of this patch. Chromium 62 is out today, I'll try to update this weekend and will push it after that in lieu of other feedback. I would be very happy if someone managed to complete the 62 upgrade before me, however! ;-) --=-=-= Content-Type: text/x-patch; charset=utf-8 Content-Disposition: attachment; filename=0001-gnu-Add-chromium.patch Content-Transfer-Encoding: quoted-printable From=20d6e3ef7f28a9bc4ace0c52e09b1e4bdde84e01e0 Mon Sep 17 00:00:00 2001 From: Marius Bakke Date: Wed, 12 Oct 2016 17:25:05 +0100 Subject: [PATCH] gnu: Add chromium. * gnu/packages/chromium.scm: New file. * gnu/packages/patches/chromium-disable-api-keys-warning.patch, gnu/packages/patches/chromium-disable-third-party-cookies.patch, gnu/packages/patches/chromium-system-icu.patch: New files. * gnu/local.mk: Record it. =2D-- gnu/local.mk | 4 + gnu/packages/chromium.scm | 650 +++++++++++++++++= ++++ .../chromium-disable-api-keys-warning.patch | 17 + .../chromium-disable-third-party-cookies.patch | 13 + gnu/packages/patches/chromium-system-icu.patch | 15 + 5 files changed, 699 insertions(+) create mode 100644 gnu/packages/chromium.scm create mode 100644 gnu/packages/patches/chromium-disable-api-keys-warning.= patch create mode 100644 gnu/packages/patches/chromium-disable-third-party-cooki= es.patch create mode 100644 gnu/packages/patches/chromium-system-icu.patch diff --git a/gnu/local.mk b/gnu/local.mk index bb4724426..80be45d45 100644 =2D-- a/gnu/local.mk +++ b/gnu/local.mk @@ -86,6 +86,7 @@ GNU_SYSTEM_MODULES =3D \ %D%/packages/certs.scm \ %D%/packages/check.scm \ %D%/packages/chez.scm \ + %D%/packages/chromium.scm \ %D%/packages/ci.scm \ %D%/packages/cmake.scm \ %D%/packages/cobol.scm \ @@ -557,6 +558,9 @@ dist_patch_DATA =3D \ %D%/packages/patches/chicken-CVE-2017-6949.patch \ %D%/packages/patches/chicken-CVE-2017-11343.patch \ %D%/packages/patches/chmlib-inttypes.patch \ + %D%/packages/patches/chromium-disable-api-keys-warning.patch \ + %D%/packages/patches/chromium-disable-third-party-cookies.patch \ + %D%/packages/patches/chromium-system-icu.patch \ %D%/packages/patches/clang-libc-search-path.patch \ %D%/packages/patches/clang-3.8-libc-search-path.patch \ %D%/packages/patches/clisp-remove-failing-test.patch \ diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm new file mode 100644 index 000000000..5693b70ff =2D-- /dev/null +++ b/gnu/packages/chromium.scm @@ -0,0 +1,650 @@ +;;; GNU Guix --- Functional package management for GNU +;;; Copyright =C2=A9 2016, 2017 Marius Bakke +;;; +;;; This file is part of GNU Guix. +;;; +;;; GNU Guix is free software; you can redistribute it and/or modify it +;;; under the terms of the GNU General Public License as published by +;;; the Free Software Foundation; either version 3 of the License, or (at +;;; your option) any later version. +;;; +;;; GNU Guix is distributed in the hope that it will be useful, but +;;; WITHOUT ANY WARRANTY; without even the implied warranty of +;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +;;; GNU General Public License for more details. +;;; +;;; You should have received a copy of the GNU General Public License +;;; along with GNU Guix. If not, see . + +(define-module (gnu packages chromium) + #:use-module ((guix licenses) #:prefix license:) + #:use-module (guix packages) + #:use-module (guix download) + #:use-module (guix git-download) + #:use-module (guix utils) + #:use-module (guix build-system gnu) + #:use-module (gnu packages) + #:use-module (gnu packages assembly) + #:use-module (gnu packages base) + #:use-module (gnu packages bison) + #:use-module (gnu packages compression) + #:use-module (gnu packages cups) + #:use-module (gnu packages curl) + #:use-module (gnu packages databases) + #:use-module (gnu packages fontutils) + #:use-module (gnu packages gl) + #:use-module (gnu packages glib) + #:use-module (gnu packages gnome) + #:use-module (gnu packages gnuzilla) + #:use-module (gnu packages gperf) + #:use-module (gnu packages gtk) + #:use-module (gnu packages icu4c) + #:use-module (gnu packages image) + #:use-module (gnu packages libevent) + #:use-module (gnu packages libffi) + #:use-module (gnu packages libusb) + #:use-module (gnu packages linux) + #:use-module (gnu packages kerberos) + #:use-module (gnu packages ninja) + #:use-module (gnu packages node) + #:use-module (gnu packages pciutils) + #:use-module (gnu packages photo) + #:use-module (gnu packages pkg-config) + #:use-module (gnu packages protobuf) + #:use-module (gnu packages pulseaudio) + #:use-module (gnu packages python) + #:use-module (gnu packages regex) + #:use-module (gnu packages serialization) + #:use-module (gnu packages speech) + #:use-module (gnu packages tls) + #:use-module (gnu packages valgrind) + #:use-module (gnu packages version-control) + #:use-module (gnu packages video) + #:use-module (gnu packages xiph) + #:use-module (gnu packages xml) + #:use-module (gnu packages xdisorg) + #:use-module (gnu packages xorg)) + +(define (remote-patch file-name uri hash) + "Return an object with the given FILE-NAME. URI must be a FTP = or +HTTP(S) URI that returns a file with the given HASH." + (origin + (method url-fetch) + (uri uri) + (sha256 (base32 hash)) + (file-name file-name))) + +(define opus+custom + (package (inherit opus) + (arguments + `(;; Opus Custom is an optional extension of the Opus + ;; specification that allows for unsupported frame + ;; sizes. Chromium requires that this is enabled. + #:configure-flags '("--enable-custom-modes") + ,@(package-arguments opus))))) + +;; Chromium since 58 depends on an unreleased libvpx. So, we +;; package the latest master branch as of 2017-10-12. +(define libvpx+experimental + (package + (inherit libvpx) + (source (origin + (method git-fetch) + (uri (git-reference + (url "https://chromium.googlesource.com/webm/libvpx") + (commit "175b36cb6d2811c721d63277ba953ea817f32361"))) + (file-name "libvpx-for-chromium-checkout") + (sha256 + (base32 + "1j8ni29mcj74lfsc0hsha22zzp24ig53iki0id5bdfhzl8q1rpyk")))) + ;; TODO: Make libvpx configure flags overrideable. + (arguments + `(#:phases + (modify-phases %standard-phases + (replace 'configure + (lambda* (#:key outputs #:allow-other-keys) + (setenv "CONFIG_SHELL" (which "bash")) + (let ((out (assoc-ref outputs "out"))) + (setenv "LDFLAGS" + (string-append "-Wl,-rpath=3D" out "/lib")) + (zero? (system* "./configure" + "--enable-shared" + "--as=3Dyasm" + ;; Limit size to avoid CVE-2015-1258 + "--size-limit=3D16384x16384" + ;; Spatial SVC is an experimental VP9 encod= er + ;; used by some packages (i.e. Chromium). + "--enable-experimental" + "--enable-spatial-svc" + (string-append "--prefix=3D" out))))))) + #:tests? #f)))) ; No tests. + +(define %chromium-gn-bootstrap.patch + (remote-patch "chromium-gn-bootstrap.patch" + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-clien= t/\ +chromium/files/chromium-gn-bootstrap-r14.patch?id=3D\ +900e6203d4015711887137bcd03c913361dbf41f" + "1050abvq24s1a5vd97d5ljb8bmv0wcdgkj3vk0scygkr1954qy4q")) + +(define %chromium-gcc-compat.patch + (remote-patch "chromium-gcc-compat.patch" + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-clien= t/\ +chromium/files/chromium-gcc-r1.patch?id=3D506399c6ac2ace6501429925a608db9d= 7e502bde" + "0n5bc1ckq83vlfzh5k3frh7cp7hyhxii89iq2v4jg46lblqgxkqi")) + +(define %chromium-gcc-5-compat.patch + (remote-patch "chromium-gcc-5-compat.patch" + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-clien= t/\ +chromium/files/chromium-gcc5-r1.patch?id=3D506399c6ac2ace6501429925a608db9= d7e502bde" + "0jz9sg24yzimcass3c3myynp3sf2c1rasrcwh7jn1gbbj4yp7j8v")) + +(define %chromium-atk-compat.patch + (remote-patch "chromium-atk-compat.patch" + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-clien= t/\ +chromium/files/chromium-atk-r1.patch?id=3D506399c6ac2ace6501429925a608db9d= 7e502bde" + "13g9g1k9f3fqpgjhnlqvf5np6m58czr57zq1fqdf5y5nfyxrl3pw")) + +(define %chromium-system-nspr.patch + (remote-patch "chromium-system-nspr.patch" + "https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium= .git/\ +plain/debian/patches/system/nspr.patch?id=3D64458c4216edd82503dc9366e2f4d8= 0ae7c763b0" + "0l69sq3w9n5zygykf1gfzp1zfb7gkjk62nnvbrmkn00gzq6cc643")) + +(define %chromium-system-libevent.patch + (remote-patch "chromium-system-libevent.patch" + "https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium= .git/\ +plain/debian/patches/system/event.patch?id=3D64458c4216edd82503dc9366e2f4d= 80ae7c763b0" + "0vibc92kwycm8jlyfa49135nq0flm6gkrf8ic76m5rkraclijvn9")) + +(define-public chromium + (package + (name "chromium") + (version "61.0.3163.100") + (synopsis "Graphical web browser") + (source (origin + (method url-fetch) + (uri (string-append "https://commondatastorage.googleapis.co= m/" + "chromium-browser-official/chromium-" + version ".tar.xz")) + (sha256 + (base32 + "06r89jim9cq87668ya8wwk69hh17rl04cj94nb9c28v6mj69cda1")) + (patches (append (list %chromium-gn-bootstrap.patch + %chromium-atk-compat.patch + %chromium-gcc-compat.patch + %chromium-gcc-5-compat.patch + %chromium-system-nspr.patch + %chromium-system-libevent.patch) + (search-patches + "chromium-system-icu.patch" + "chromium-disable-api-keys-warning.patch" + "chromium-disable-third-party-cookies.patc= h"))) + (modules '((srfi srfi-1) + (guix build utils))) + (snippet + '(begin + ;; Replace GN files from third_party with shims for buil= ding + ;; against system libraries. Keep this list in sync with + ;; "build/linux/unbundle/replace_gn_files.py". + (for-each (lambda (pair) + (let ((source (string-append + "build/linux/unbundle/" (car = pair))) + (dest (cdr pair))) + (copy-file source dest))) + (list + '("ffmpeg.gn" . "third_party/ffmpeg/BUILD.gn") + '("flac.gn" . "third_party/flac/BUILD.gn") + '("freetype.gn" . "third_party/freetype/BUILD= .gn") + '("harfbuzz-ng.gn" . "third_party/harfbuzz-ng= /BUILD.gn") + '("icu.gn" . "third_party/icu/BUILD.gn") + '("libdrm.gn" . "third_party/libdrm/BUILD.gn") + '("libevent.gn" . "base/third_party/libevent/= BUILD.gn") + '("libjpeg.gn" . + "build/secondary/third_party/libjpeg_turbo/= BUILD.gn") + '("libpng.gn" . "third_party/libpng/BUILD.gn") + '("libvpx.gn" . "third_party/libvpx/BUILD.gn") + '("libwebp.gn" . "third_party/libwebp/BUILD.g= n") + ;;'("libxml.gn" . "third_party/libxml/BUILD.g= n") ;TODO + '("libxslt.gn" . "third_party/libxslt/BUILD.g= n") + '("openh264.gn" . "third_party/openh264/BUILD= .gn") + '("opus.gn" . "third_party/opus/BUILD.gn") + '("re2.gn" . "third_party/re2/BUILD.gn") + '("snappy.gn" . "third_party/snappy/BUILD.gn") + '("yasm.gn" . "third_party/yasm/yasm_assemble= .gni") + '("zlib.gn" . "third_party/zlib/BUILD.gn"))) + #t)))) + (build-system gnu-build-system) + (arguments + `(#:tests? #f ; TODO: Maybe run --headless or something. + ;; FIXME: There is a "gn" option specifically for setting -rpath, b= ut + ;; it's not recognized when passed. + #:validate-runpath? #f + #:modules ((srfi srfi-26) + (ice-9 ftw) + (ice-9 regex) + (guix build gnu-build-system) + (guix build utils)) + #:phases + (modify-phases %standard-phases + (add-after 'unpack 'remove-bundled-software + (lambda _ + (let ((keep-libs + (list + ;; Third party folders that cannot be deleted yet. + "base/third_party/dmg_fp" + "base/third_party/dynamic_annotations" + "base/third_party/icu" + "base/third_party/libevent" + "base/third_party/nspr" + "base/third_party/superfasthash" + "base/third_party/symbolize" ; glog + "base/third_party/xdg_mime" + "base/third_party/xdg_user_dirs" + "buildtools/third_party/libc++" + "chrome/third_party/mozilla_security_manager" + "courgette/third_party" + "net/third_party/mozilla_security_manager" + "net/third_party/nss" + "third_party/adobe/flash/flapper_version.h" + ;; FIXME: This is used in: + ;; * ui/webui/resources/js/analytics.js + ;; * ui/file_manager/ + "third_party/analytics" + "third_party/angle" + "third_party/angle/src/common/third_party/base" + "third_party/angle/src/common/third_party/murmurhash" + "third_party/angle/src/third_party/compiler" + "third_party/angle/src/third_party/libXNVCtrl" + "third_party/angle/src/third_party/trace_event" + "third_party/boringssl" + "third_party/brotli" + "third_party/cacheinvalidation" + "third_party/catapult" + "third_party/catapult/third_party/polymer" + "third_party/catapult/third_party/py_vulcanize" + "third_party/catapult/third_party/py_vulcanize/third_= party/rcssmin" + "third_party/catapult/third_party/py_vulcanize/third_= party/rjsmin" + "third_party/catapult/tracing/third_party/d3" + "third_party/catapult/tracing/third_party/gl-matrix" + "third_party/catapult/tracing/third_party/jszip" + "third_party/catapult/tracing/third_party/mannwhitney= u" + "third_party/catapult/tracing/third_party/oboe" + "third_party/ced" + "third_party/cld_3" + "third_party/cros_system_api" + "third_party/dom_distiller_js" + "third_party/fips181" + "third_party/flatbuffers" + ;; XXX Needed by pdfium since 59. + "third_party/freetype" + "third_party/glslang-angle" + "third_party/google_input_tools" + "third_party/google_input_tools/third_party/closure_l= ibrary" + (string-append "third_party/google_input_tools/third_= party" + "/closure_library/third_party/closure") + "third_party/googletest" + "third_party/hunspell" + "third_party/iccjpeg" + "third_party/inspector_protocol" + "third_party/jinja2" + "third_party/jstemplate" + "third_party/khronos" + "third_party/leveldatabase" + "third_party/libXNVCtrl" + "third_party/libaddressinput" + "third_party/libjingle_xmpp" + "third_party/libphonenumber" + "third_party/libsecret" ;FIXME: needs pkg-config supp= ort. + "third_party/libsrtp" ;TODO: Requires libsrtp@2. + "third_party/libudev" + "third_party/libwebm" + "third_party/libxml" ;FIXME: Unbundle (again). + "third_party/libyuv" + "third_party/lss" + "third_party/lzma_sdk" + "third_party/markupsafe" + "third_party/mesa" + "third_party/modp_b64" + "third_party/mt19937ar" + "third_party/node" + "third_party/node/node_modules/vulcanize/third_party/= UglifyJS2" + "third_party/openmax_dl" + "third_party/ots" + "third_party/pdfium" ;TODO: can be built standalone. + "third_party/pdfium/third_party" + "third_party/ply" + "third_party/polymer" + "third_party/protobuf" + "third_party/protobuf/third_party/six" + "third_party/qcms" + "third_party/sfntly" + "third_party/skia" + "third_party/skia/third_party/vulkan" + "third_party/smhasher" + ;; XXX the sources that include this are generated. + "third_party/speech-dispatcher" + "third_party/spirv-headers" + "third_party/spirv-tools-angle" + "third_party/sqlite" + "third_party/swiftshader" + "third_party/swiftshader/third_party" + "third_party/usb_ids" + "third_party/usrsctp" + "third_party/vulkan" + "third_party/vulkan-validation-layers" + "third_party/WebKit" + "third_party/web-animations-js" + "third_party/webrtc" + "third_party/widevine/cdm/widevine_cdm_version.h" + "third_party/widevine/cdm/widevine_cdm_common.h" + "third_party/woff2" + "third_party/xdg-utils" + "third_party/yasm/run_yasm.py" + "third_party/zlib/google" + "url/third_party/mozilla" + "v8/src/third_party/valgrind" + "v8/third_party/inspector_protocol"))) + ;; FIXME: implement as source snippet. This traverses + ;; any "third_party" directory and deletes files that are: + ;; * not ending with ".gn" or ".gni"; or + ;; * not explicitly named as argument (folder or file). + (zero? (apply system* "python" + "build/linux/unbundle/remove_bundled_librarie= s.py" + "--do-remove" keep-libs))))) + (add-after 'remove-bundled-software 'patch-stuff + (lambda* (#:key inputs #:allow-other-keys) + (substitute* "printing/cups_config_helper.py" + (("cups_config =3D.*") + (string-append "cups_config =3D '" (assoc-ref inputs "cups= ") + "/bin/cups-config'\n"))) + + (substitute* + '("base/process/launch_posix.cc" + "base/tracked_objects.cc" + "base/third_party/dynamic_annotations/dynamic_annotatio= ns.c" + "sandbox/linux/seccomp-bpf/sandbox_bpf.cc" + "sandbox/linux/services/credentials.cc" + "sandbox/linux/services/namespace_utils.cc" + "sandbox/linux/services/syscall_wrappers.cc" + "sandbox/linux/syscall_broker/broker_host.cc") + (("include \"base/third_party/valgrind/") "include \"valgri= nd/")) + + (for-each (lambda (file) + (substitute* file + ;; Fix opus include path. + ;; Do not substitute opus_private.h. + (("#include \"opus\\.h\"") + "#include \"opus/opus.h\"") + (("#include \"opus_custom\\.h\"") + "#include \"opus/opus_custom.h\"") + (("#include \"opus_defines\\.h\"") + "#include \"opus/opus_defines.h\"") + (("#include \"opus_multistream\\.h\"") + "#include \"opus/opus_multistream.h\"") + (("#include \"opus_types\\.h\"") + "#include \"opus/opus_types.h\""))) + (append (find-files "third_party/opus/src/celt") + (find-files "third_party/opus/src/src") + (find-files (string-append "third_party/web= rtc/modules" + "/audio_coding/c= odecs/opus")))) + + (substitute* "chrome/common/chrome_paths.cc" + (("/usr/share/chromium/extensions") + ;; TODO: Add ~/.guix-profile. + "/run/current-system/profile/share/chromium/extensions")) + + (substitute* "breakpad/src/common/linux/libcurl_wrapper.h" + (("include \"third_party/curl") "include \"curl")) + (substitute* "media/base/decode_capabilities.cc" + (("third_party/libvpx/source/libvpx/") "")) + + ;; We don't cross compile most packages, so get rid of the + ;; unnecessary ARCH-linux-gnu* prefix. + (substitute* "build/toolchain/linux/BUILD.gn" + (("aarch64-linux-gnu-") "") + (("arm-linux-gnueabihf-") "")) + #t)) + (replace 'configure + (lambda* (#:key inputs outputs #:allow-other-keys) + (let ((gn-flags + (list + ;; See tools/gn/docs/cookbook.md and + ;; https://www.chromium.org/developers/gn-build-confi= guration + ;; for usage. Run "./gn args . --list" in the Release + ;; directory for an exhaustive list of supported flag= s. + "is_debug=3Dfalse" + "is_official_build=3Dfalse" + "is_clang=3Dfalse" + "use_gold=3Dfalse" + "linux_use_bundled_binutils=3Dfalse" + "use_custom_libcxx=3Dfalse" + "use_sysroot=3Dfalse" + "remove_webcore_debug_symbols=3Dtrue" + "enable_iterator_debugging=3Dfalse" + "override_build_date=3D\"01 01 2000 05:00:00\"" + ;; Don't fail when using deprecated ffmpeg features. + "treat_warnings_as_errors=3Dfalse" + "enable_nacl=3Dfalse" + "enable_nacl_nonsfi=3Dfalse" + "use_allocator=3D\"none\"" ; Don't use tcmalloc. + ;; Don't add any API keys. End users can set them in = the + ;; environment if necessary. + ;; https://www.chromium.org/developers/how-tos/api-ke= ys + "use_official_google_api_keys=3Dfalse" + ;; Disable "field trials". + "fieldtrial_testing_like_official_build=3Dtrue" + + "use_system_libjpeg=3Dtrue" + ;; This is currently not supported on Linux: + ;; https://bugs.chromium.org/p/chromium/issues/detail= ?id=3D22208 + ;; "use_system_sqlite=3Dtrue" + "use_gtk3=3Dtrue" + "use_gconf=3Dfalse" ; deprecated by gsettings + "use_gnome_keyring=3Dfalse" ; deprecated by libsecret + "use_xkbcommon=3Dtrue" + "link_pulseaudio=3Dtrue" + "use_openh264=3Dtrue" + + ;; Don't arbitrarily restrict formats supported by sy= stem ffmpeg. + "proprietary_codecs=3Dtrue" + "ffmpeg_branding=3D\"Chrome\"" + + ;; WebRTC stuff. + "rtc_use_h264=3Dtrue" + ;; Don't use bundled sources. + "rtc_build_json=3Dfalse" + "rtc_build_libevent=3Dfalse" + "rtc_build_libjpeg=3Dfalse" + "rtc_build_libvpx=3Dfalse" + "rtc_build_opus=3Dfalse" + "rtc_build_ssl=3Dfalse" + ;; TODO: Package these. + "rtc_build_libsrtp=3Dtrue" ; 2.0 + "rtc_build_libyuv=3Dtrue" + "rtc_build_openmax_dl=3Dtrue" + "rtc_build_usrsctp=3Dtrue" + (string-append "rtc_jsoncpp_root=3D\"" + (assoc-ref inputs "jsoncpp") + "/include/jsoncpp/json\"") + (string-append "rtc_ssl_root=3D\"" + (assoc-ref inputs "openssl") + "/include/openssl\"")))) + + ;; XXX: How portable is this. + (mkdir-p "third_party/node/linux/node-linux-x64") + (symlink (string-append (assoc-ref inputs "node") "/bin") + "third_party/node/linux/node-linux-x64/bin") + + (setenv "CC" "gcc") + (setenv "CXX" "g++") + ;; TODO: pre-compile instead. Avoids a race condition. + (setenv "PYTHONDONTWRITEBYTECODE" "1") + (and + ;; Build the "gn" tool. + (zero? (system* "python" + "tools/gn/bootstrap/bootstrap.py" "-s" "-v= ")) + ;; Generate ninja build files. + (zero? (system* "./out/Release/gn" "gen" "out/Release" + (string-append "--args=3D" + (string-join gn-flags " "))= )))))) + (replace 'build + (lambda* (#:key outputs #:allow-other-keys) + (zero? (system* "ninja" "-C" "out/Release" + "-j" (number->string (parallel-job-count)) + "chrome")))) + (replace 'install + (lambda* (#:key inputs outputs #:allow-other-keys) + (let* ((out (assoc-ref outputs "out")) + (bin (string-append out "/bin")) + (exe (string-append bin "/chromium")) + (lib (string-append out "/lib")) + (man (string-append out "/share/man/man1")) + (applications (string-append out "/share/application= s")) + (install-regexp (make-regexp "\\.(so|bin|pak)$")) + (locales (string-append lib "/locales")) + (resources (string-append lib "/resources")) + (gtk+ (assoc-ref inputs "gtk+")) + (mesa (assoc-ref inputs "mesa")) + (nss (assoc-ref inputs "nss")) + (udev (assoc-ref inputs "udev")) + (sh (which "sh"))) + + (mkdir-p applications) + (call-with-output-file (string-append applications + "/chromium.desktop") + (lambda (port) + (format port + "[Desktop Entry]~@ + Name=3DChromium~@ + Comment=3D~a~@ + Exec=3D~a~@ + Icon=3Dchromium.png~@ + Type=3DApplication~%" ,synopsis exe))) + + (with-directory-excursion "out/Release" + (for-each (lambda (file) + (install-file file lib)) + (scandir "." (cut regexp-exec install-regexp <>= ))) + (copy-file "chrome" (string-append lib "/chromium")) + + ;; TODO: Install icons from "../../chrome/app/themes" into + ;; "out/share/icons/hicolor/$size". + (install-file + "product_logo_48.png" + (string-append out "/share/icons/48x48/chromium.png")) + + (copy-recursively "locales" locales) + (copy-recursively "resources" resources) + + (mkdir-p man) + (copy-file "chrome.1" (string-append man "/chromium.1")) + + (mkdir-p bin) + ;; Add a thin wrapper to prevent the user from inadverten= tly + ;; installing non-free software through the Web Store. + ;; TODO: Discover extensions from the profile and pass + ;; something like "--disable-extensions-except=3D...". + (call-with-output-file exe + (lambda (port) + (format port + "#!~a~@ + CHROMIUM_FLAGS=3D\"--disable-background-netwo= rking\"~@ + if [ -z \"$CHROMIUM_ENABLE_WEB_STORE\" ]~@ + then~@ + CHROMIUM_FLAGS=3D\"$CHROMIUM_FLAGS --disa= ble-extensions\"~@ + fi~@ + exec ~a $CHROMIUM_FLAGS \"$@\"~%" + sh (string-append lib "/chromium")))) + (chmod exe #o755) + + (wrap-program exe + ;; TODO: Get these in RUNPATH. + `("LD_LIBRARY_PATH" ":" prefix + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib:" + mesa "/lib:" udev "/lib"))) + ;; Avoid file manager crash. See . + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/sh= are")))) + #t))))))) + (native-inputs + `(("bison" ,bison) + ("git" ,git) ;last_commit_position.py + ("gperf" ,gperf) + ("ninja" ,ninja) + ("node" ,node) + ("pkg-config" ,pkg-config) + ("which" ,which) + ("yasm" ,yasm) + + ("python-beautifulsoup4" ,python2-beautifulsoup4) + ("python-html5lib" ,python2-html5lib) + ("python" ,python-2))) + (inputs + `(("alsa-lib" ,alsa-lib) + ("atk" ,atk) + ("cups" ,cups) + ("curl" ,curl) + ("dbus" ,dbus) + ("dbus-glib" ,dbus-glib) + ("expat" ,expat) + ("flac" ,flac) + ("ffmpeg" ,ffmpeg) + ("fontconfig" ,fontconfig) + ("freetype" ,freetype) + ("gdk-pixbuf" ,gdk-pixbuf) + ("glib" ,glib) + ("gtk+-2" ,gtk+-2) + ("gtk+" ,gtk+) + ("harfbuzz" ,harfbuzz) + ("icu4c" ,icu4c) + ("jsoncpp" ,jsoncpp) + ("libevent" ,libevent) + ("libffi" ,libffi) + ("libjpeg-turbo" ,libjpeg-turbo) + ("libpng" ,libpng) + ("libusb" ,libusb) + ("libvpx" ,libvpx+experimental) + ("libwebp" ,libwebp) + ("libx11" ,libx11) + ("libxcb" ,libxcb) + ("libxcomposite" ,libxcomposite) + ("libxcursor" ,libxcursor) + ("libxdamage" ,libxdamage) + ("libxext" ,libxext) + ("libxfixes" ,libxfixes) + ("libxi" ,libxi) + ("libxkbcommon" ,libxkbcommon) + ("libxml2" ,libxml2) + ("libxrandr" ,libxrandr) + ("libxrender" ,libxrender) + ("libxscrnsaver" ,libxscrnsaver) + ("libxslt" ,libxslt) + ("libxtst" ,libxtst) + ("mesa" ,mesa) + ("minizip" ,minizip) + ("mit-krb5" ,mit-krb5) + ("nss" ,nss) + ("openh264" ,openh264) + ("openssl" ,openssl) + ("opus" ,opus+custom) + ("pango" ,pango) + ("pciutils" ,pciutils) + ("protobuf" ,protobuf) + ("pulseaudio" ,pulseaudio) + ("re2" ,re2) + ("snappy" ,snappy) + ("speech-dispatcher" ,speech-dispatcher) + ("sqlite" ,sqlite) + ("udev" ,eudev) + ("valgrind" ,valgrind))) + (home-page "https://www.chromium.org/") + (description + "Chromium is a web browser using the @code{Blink} rendering engine.") + ;; Chromium is developed as BSD-3, but bundles a large number of third= -party + ;; software with other licenses. For full information, see chrome://cr= edits. + (license (list license:bsd-3 + license:bsd-2 + license:expat + license:asl2.0 + license:mpl2.0 + license:public-domain + license:lgpl2.1+)))) diff --git a/gnu/packages/patches/chromium-disable-api-keys-warning.patch b= /gnu/packages/patches/chromium-disable-api-keys-warning.patch new file mode 100644 index 000000000..c7e219f40 =2D-- /dev/null +++ b/gnu/packages/patches/chromium-disable-api-keys-warning.patch @@ -0,0 +1,17 @@ +Disable warning about missing API keys. + +Copied from: + +https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/tree/debian/= patches/disable/google-api-warning.patch + +--- a/chrome/browser/ui/startup/startup_browser_creator_impl.cc ++++ b/chrome/browser/ui/startup/startup_browser_creator_impl.cc +@@ -816,8 +816,6 @@ void StartupBrowserCreatorImpl::AddInfoB + !command_line_.HasSwitch(switches::kTestType) && + !command_line_.HasSwitch(switches::kEnableAutomation)) { + chrome::ShowBadFlagsPrompt(browser); +- GoogleApiKeysInfoBarDelegate::Create(InfoBarService::FromWebContents( +- browser->tab_strip_model()->GetActiveWebContents())); + ObsoleteSystemInfoBarDelegate::Create(InfoBarService::FromWebContents( + browser->tab_strip_model()->GetActiveWebContents())); +=20 diff --git a/gnu/packages/patches/chromium-disable-third-party-cookies.patc= h b/gnu/packages/patches/chromium-disable-third-party-cookies.patch new file mode 100644 index 000000000..0694c35f3 =2D-- /dev/null +++ b/gnu/packages/patches/chromium-disable-third-party-cookies.patch @@ -0,0 +1,13 @@ +Disable third party cookies by default. + +--- a/components/content_settings/core/browser/cookie_settings.cc ++++ b/components/content_settings/core/browser/cookie_settings.cc +@@ -101,7 +101,7 @@ void CookieSettings::GetCookieSettings( + void CookieSettings::RegisterProfilePrefs( + user_prefs::PrefRegistrySyncable* registry) { + registry->RegisterBooleanPref( +- prefs::kBlockThirdPartyCookies, false, ++ prefs::kBlockThirdPartyCookies, true, + user_prefs::PrefRegistrySyncable::SYNCABLE_PREF); + } +=20 diff --git a/gnu/packages/patches/chromium-system-icu.patch b/gnu/packages/= patches/chromium-system-icu.patch new file mode 100644 index 000000000..c35c1b75c =2D-- /dev/null +++ b/gnu/packages/patches/chromium-system-icu.patch @@ -0,0 +1,15 @@ +description: maintain compatibility with system icu library +author: Michael Gilbert + +--- a/BUILD.gn ++++ b/BUILD.gn +@@ -657,8 +657,7 @@ group("gn_all") { + } + } +=20 +- if ((is_linux && !is_chromeos && !is_chromecast) || (is_win && use_drfu= zz) || +- (use_libfuzzer && is_mac)) { ++ if (false) { + deps +=3D [ + "//testing/libfuzzer/fuzzers", + "//testing/libfuzzer/tests:libfuzzer_tests", =2D-=20 2.14.2 --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlnn2H0ACgkQoqBt8qM6 VPpwOwf/UD+ihwoQbrbiP0UE8gzYMbFb35Xnsc5klnFLYaqBsZiz1fCLYq6KGYhQ T7GLDQjdb88Hftlw/byGgbLUAsAC62StpwxZtLjYf2RffF88YYZCe6PP/RBy+1LK r56iTWGF/+wEJ5WkkWabRkc+msvQAfO71qYDXNoTcHZ+fpzG0Z2iPvbGOAByRcyM NyR3oaEX4y6LT0SpbmMBZm25VBwtko9rjZDx7PllJRYPuYwJV3ErYJ9LFfwuGZW/ lR+qOSFQYjgpvTfYio5ujFwFLaNRQ8esXmkR34uQC3tsdYpO7Lb/9wIcmsS/7q5j nRdSYO9O1fA+Rq6muVY4qvFBzch+4g== =KE1Q -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Thu Oct 19 01:48:53 2017 Received: (at 28004) by debbugs.gnu.org; 19 Oct 2017 05:48:53 +0000 Received: from localhost ([127.0.0.1]:49016 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e53hM-0006Nc-Oi for submit@debbugs.gnu.org; Thu, 19 Oct 2017 01:48:52 -0400 Received: from aibo.runbox.com ([91.220.196.211]:52600) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e53hJ-0006NR-J1 for 28004@debbugs.gnu.org; Thu, 19 Oct 2017 01:48:51 -0400 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit03.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1e53hE-0003JW-Sd; Thu, 19 Oct 2017 07:48:44 +0200 Received: from [78.109.23.1] (helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1e53gv-0001dX-PB; Thu, 19 Oct 2017 07:48:26 +0200 Date: Thu, 19 Oct 2017 05:48:22 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20171019054822.mka2hpj5bkgiuypd@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="pfilsqohjgqgqzmq" Content-Disposition: inline In-Reply-To: <87o9p45bb6.fsf@fastmail.com> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Ludovic =?utf-8?Q?Court=C3=A8s?= , ng0 , Leo Famulari X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --pfilsqohjgqgqzmq Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 37K bytes: > Ludovic Court=C3=A8s writes: >=20 > > I think we should make sure that our package does not call home in any > > way. That=E2=80=99s what I expect from a security- and privacy-conscio= us > > distro. >=20 > Currently, it calls home at first launch, prompting for a login. But > I've verified that it does not send any unsolicited requests for > subsequent startups, as long as the user does not change the > command-line flags. Could the first launch just be a matter of changing what gets displayed at first launch? At least that's my current plan for meissa (my fork of Pale Moon), where the default is to visit a tracker including homepage. --=20 ng0 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://dist.ng0.infotropique.org/dist/keys/ https://www.infotropique.org https://ng0.infotropique.org --pfilsqohjgqgqzmq Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlnoPKYACgkQ4i+bv+40 hYh09RAAhelOJx69ja+YavLTuyPLHv4mNVveB/Ul3UMgyuuxL8F6+VjNt8knIRj0 AH90jfv+/iR5S2nngpl1IZJVsF8BZaRwueCSRgcDzlNrT0/YuT7Kh9wC9LCNLUXC FHsGPLIr6Qbu8nV0lGdYgMn+fKn3iGUDFWwHG6JkYrA7/H/s1ZC/Rmb+SQY4y71H 2AEI1PmZ3H4E0MbMN4RQviXb82E6SeAh2DU8xWWEgI9u6w7FFj+zA5qLMG2aPvDa egl/t7+FghWalo906BcwhmKQB7NZ9CqXqOGeoPjsFyvGxN3ORr0oWS+gd5k9hv5s BpTfifCr7p3SHqwGNGos07eorO9sD/7L9hUQa3Oc+I3Bp5WCBSDDXzmtFYOoTKXw rD3xntMTGDaN68K0MNm4EPffIZZZcVfgQd+/LjIyTLlyD0KxfDJT9jfFjDOk2F2O R5CNuzhjD6S266Jga4LaAo0AHXHh3Oli7Nwcf+J97WY5IQ6jr6Uu99pqhbSocMrb fZWnw6KKRkJ3ib+pBi7Ua1GxoV+FdtRgu0vXR4ZbRKutmAVELPA/PSu/YZGV3zl8 02B9aZVGLYsEU5JJ3+WdsHUDpFYcDbhtIqCRL2BZgbxds1XR60mHn5lWxQptmaDe X+ozafIk2XdYN/XNBfrWSsfdTMOhvYsWRfEorIjDcAWnBrB6ds4= =jfkQ -----END PGP SIGNATURE----- --pfilsqohjgqgqzmq-- From debbugs-submit-bounces@debbugs.gnu.org Tue Oct 24 17:11:28 2017 Received: (at 28004) by debbugs.gnu.org; 24 Oct 2017 21:11:29 +0000 Received: from localhost ([127.0.0.1]:60304 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e76To-0003qF-RS for submit@debbugs.gnu.org; Tue, 24 Oct 2017 17:11:28 -0400 Received: from out4-smtp.messagingengine.com ([66.111.4.28]:51889) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1e76Ti-0003q0-Va for 28004@debbugs.gnu.org; Tue, 24 Oct 2017 17:11:19 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 52B1C20D82; Tue, 24 Oct 2017 17:11:13 -0400 (EDT) Received: from frontend1 ([10.202.2.160]) by compute5.internal (MEProxy); Tue, 24 Oct 2017 17:11:13 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=lNZsqpl0v/BGO6ZIiyZn+j/MogwkxIMaBqp2zZA5L5M=; b=yNyPRIfo wroUnJXVPbaFhhItXQ73OSFJlrOJAhvlFGGMhYm27xbYTIbIOJBl/iHjNm853GJB M1Rj0ykJOS6vzKTL1Mv1STMJrO3Uc69z82rUtU2FDnq2J3P7OFCRW1NOSgVCl88F dBF27kFSodm9i9C+0GKaJQJ+YXh05H8DMQC1XB8NTAwcVsSXbpOSyAYhTDV/45fy r0AiYMYled7jl4ycp0oedyH3HtLVybb3E/zBP54wwk9JZvp9XYFPGQbC+udiU9N+ h1rr0eu4P0yAw7FLYNtOmQmZ/GPIdB3q24tC6VLqvUacnuDBFbq6CH7bpD9Q9YBW od3U/dgEleYmmA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm1; bh=lNZsqpl0v/BGO6ZIiyZn+j/Mogwkx IMaBqp2zZA5L5M=; b=IJp/vxTonEbExDi85HdShfLVGnlQARAuqE1c81PDf0G/7 K139o4hulKRe4V9ZvLnfDCChw6fyn0oaOYYASPlNNjU/yKbcM99EZecLrb2n5TAh LKH7o+H8cImZWdwW9YWnyrohaNrV1yz8gZ9aQa20pnMKKTxzad/kLqpyaw6y3Gca SDLSMdpPTdlNqZZsCYH9cbLDNtGTSKyqe+Yp4GQzXfxtWum9Rxg1r7g5qGcscZCn LqNM6x1OGiFrdwDciB0C+likwt3qEoD7CsRYaptu8JirDwR7VRXtlUigaphbG3LT k8RjRLZxAGj0Ink+EGQt4qYrg58xltdhCdcFu/J2w== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id 356B47FA6B; Tue, 24 Oct 2017 17:11:12 -0400 (EDT) From: Marius Bakke To: Leo Famulari Subject: Re: [bug#28004] Chromium In-Reply-To: <87o9p45bb6.fsf@fastmail.com> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> User-Agent: Notmuch/0.25.1 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Tue, 24 Oct 2017 23:11:10 +0200 Message-ID: <87efpsz1xt.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.0 (/) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain Marius Bakke writes: > Anyway I'm attaching the current iteration of this patch. Chromium 62 > is out today, I'll try to update this weekend and will push it after > that in lieu of other feedback. Here is the interdiff for the 62 upgrade. I mixed in some unrelated changes after reading through Debians 61 refresh[0] and Archs 62 update[1], but overall it was straightforward (apart from the slow hack-test-fix cycle). --=-=-= Content-Type: text/x-patch Content-Disposition: inline; filename=chromium-62.diff Content-Transfer-Encoding: quoted-printable diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm index 5693b70ff..f5ee95c2f 100644 =2D-- a/gnu/packages/chromium.scm +++ b/gnu/packages/chromium.scm @@ -32,6 +32,7 @@ #:use-module (gnu packages curl) #:use-module (gnu packages databases) #:use-module (gnu packages fontutils) + #:use-module (gnu packages ghostscript) #:use-module (gnu packages gl) #:use-module (gnu packages glib) #:use-module (gnu packages gnome) @@ -84,7 +85,7 @@ HTTP(S) URI that returns a file with the given HASH." ,@(package-arguments opus))))) =20 ;; Chromium since 58 depends on an unreleased libvpx. So, we =2D;; package the latest master branch as of 2017-10-12. +;; package the latest master branch as of 2017-10-22. (define libvpx+experimental (package (inherit libvpx) @@ -92,11 +93,11 @@ HTTP(S) URI that returns a file with the given HASH." (method git-fetch) (uri (git-reference (url "https://chromium.googlesource.com/webm/libvpx") =2D (commit "175b36cb6d2811c721d63277ba953ea817f32361"))) + (commit "b58259ab55674cb028898a0ac9e8fdd3cf1d4b39"))) (file-name "libvpx-for-chromium-checkout") (sha256 (base32 =2D "1j8ni29mcj74lfsc0hsha22zzp24ig53iki0id5bdfhzl8q1rpyk"))= )) + "0grx2p7add0qyycqvqiv3djk0i37xrg75phszg5mwnwd3ijv3qzj")))) ;; TODO: Make libvpx configure flags overrideable. (arguments `(#:phases @@ -122,27 +123,15 @@ HTTP(S) URI that returns a file with the given HASH." (define %chromium-gn-bootstrap.patch (remote-patch "chromium-gn-bootstrap.patch" "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-clien= t/\ =2Dchromium/files/chromium-gn-bootstrap-r14.patch?id=3D\ =2D900e6203d4015711887137bcd03c913361dbf41f" =2D "1050abvq24s1a5vd97d5ljb8bmv0wcdgkj3vk0scygkr1954qy4q")) =2D =2D(define %chromium-gcc-compat.patch =2D (remote-patch "chromium-gcc-compat.patch" =2D "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-cli= ent/\ =2Dchromium/files/chromium-gcc-r1.patch?id=3D506399c6ac2ace6501429925a608db= 9d7e502bde" =2D "0n5bc1ckq83vlfzh5k3frh7cp7hyhxii89iq2v4jg46lblqgxkqi")) +chromium/files/chromium-gn-bootstrap-r17.patch?id=3D\ +5c9cf110bd61fa287a5c536760b5d8ed13f65d52" + "12wsq3bs46mvr7cinxvqjmbzymigm8yzf478r08y9l6sd3qij4yq")) =20 (define %chromium-gcc-5-compat.patch (remote-patch "chromium-gcc-5-compat.patch" "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-clien= t/\ =2Dchromium/files/chromium-gcc5-r1.patch?id=3D506399c6ac2ace6501429925a608d= b9d7e502bde" =2D "0jz9sg24yzimcass3c3myynp3sf2c1rasrcwh7jn1gbbj4yp7j8v")) =2D =2D(define %chromium-atk-compat.patch =2D (remote-patch "chromium-atk-compat.patch" =2D "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-cli= ent/\ =2Dchromium/files/chromium-atk-r1.patch?id=3D506399c6ac2ace6501429925a608db= 9d7e502bde" =2D "13g9g1k9f3fqpgjhnlqvf5np6m58czr57zq1fqdf5y5nfyxrl3pw")) +chromium/files/chromium-gcc5-r3.patch?id=3D5c9cf110bd61fa287a5c536760b5d8e= d13f65d52" + "0qwl396w2bnc4ww71q3621chh9rfnw1m3w6nbd55sbhq8yz6jnx0")) =20 (define %chromium-system-nspr.patch (remote-patch "chromium-system-nspr.patch" @@ -159,7 +148,7 @@ plain/debian/patches/system/event.patch?id=3D64458c4216= edd82503dc9366e2f4d80ae7c76 (define-public chromium (package (name "chromium") =2D (version "61.0.3163.100") + (version "62.0.3202.62") (synopsis "Graphical web browser") (source (origin (method url-fetch) @@ -168,13 +157,12 @@ plain/debian/patches/system/event.patch?id=3D64458c42= 16edd82503dc9366e2f4d80ae7c76 version ".tar.xz")) (sha256 (base32 =2D "06r89jim9cq87668ya8wwk69hh17rl04cj94nb9c28v6mj69cda1")) + "0qn3pjq5n3ri3qh25wg5gd2as5a8wlkncqvi975xsab771833pz8")) (patches (append (list %chromium-gn-bootstrap.patch =2D %chromium-atk-compat.patch =2D %chromium-gcc-compat.patch %chromium-gcc-5-compat.patch %chromium-system-nspr.patch =2D %chromium-system-libevent.patch) + %chromium-system-libevent.patch + ) (search-patches "chromium-system-icu.patch" "chromium-disable-api-keys-warning.patch" @@ -271,6 +259,7 @@ plain/debian/patches/system/event.patch?id=3D64458c4216= edd82503dc9366e2f4d80ae7c76 "third_party/catapult/tracing/third_party/oboe" "third_party/ced" "third_party/cld_3" + "third_party/crc32c" "third_party/cros_system_api" "third_party/dom_distiller_js" "third_party/fips181" @@ -307,7 +296,7 @@ plain/debian/patches/system/event.patch?id=3D64458c4216= edd82503dc9366e2f4d80ae7c76 "third_party/modp_b64" "third_party/mt19937ar" "third_party/node" =2D "third_party/node/node_modules/vulcanize/third_part= y/UglifyJS2" + "third_party/node/node_modules/polymer-bundler/lib/th= ird_party/UglifyJS2" "third_party/openmax_dl" "third_party/ots" "third_party/pdfium" ;TODO: can be built standalone. @@ -320,6 +309,7 @@ plain/debian/patches/system/event.patch?id=3D64458c4216= edd82503dc9366e2f4d80ae7c76 "third_party/sfntly" "third_party/skia" "third_party/skia/third_party/vulkan" + "third_party/skia/third_party/gif" "third_party/smhasher" ;; XXX the sources that include this are generated. "third_party/speech-dispatcher" @@ -419,9 +409,14 @@ plain/debian/patches/system/event.patch?id=3D64458c421= 6edd82503dc9366e2f4d80ae7c76 "linux_use_bundled_binutils=3Dfalse" "use_custom_libcxx=3Dfalse" "use_sysroot=3Dfalse" + "goma_dir=3D\"\"" + "use_jumbo_build=3Dtrue" ;speeds up compilation + "enable_precompiled_headers=3Dfalse" "remove_webcore_debug_symbols=3Dtrue" "enable_iterator_debugging=3Dfalse" + "exclude_unwind_tables=3Dtrue" "override_build_date=3D\"01 01 2000 05:00:00\"" + "use_unofficial_version_number=3Dfalse" ;; Don't fail when using deprecated ffmpeg features. "treat_warnings_as_errors=3Dfalse" "enable_nacl=3Dfalse" @@ -433,8 +428,14 @@ plain/debian/patches/system/event.patch?id=3D64458c421= 6edd82503dc9366e2f4d80ae7c76 "use_official_google_api_keys=3Dfalse" ;; Disable "field trials". "fieldtrial_testing_like_official_build=3Dtrue" + "enable_reading_list=3Dfalse" + ;;"enable_reporting=3Dfalse" ;XXX breaks the build =20 + "use_openh264=3Dtrue" + "use_system_freetype=3Dtrue" "use_system_libjpeg=3Dtrue" + "use_system_lcms2=3Dtrue" + "use_system_zlib=3Dtrue" ;; This is currently not supported on Linux: ;; https://bugs.chromium.org/p/chromium/issues/detail= ?id=3D22208 ;; "use_system_sqlite=3Dtrue" @@ -443,7 +444,6 @@ plain/debian/patches/system/event.patch?id=3D64458c4216= edd82503dc9366e2f4d80ae7c76 "use_gnome_keyring=3Dfalse" ; deprecated by libsecret "use_xkbcommon=3Dtrue" "link_pulseaudio=3Dtrue" =2D "use_openh264=3Dtrue" =20 ;; Don't arbitrarily restrict formats supported by sy= stem ffmpeg. "proprietary_codecs=3Dtrue" @@ -454,7 +454,6 @@ plain/debian/patches/system/event.patch?id=3D64458c4216= edd82503dc9366e2f4d80ae7c76 ;; Don't use bundled sources. "rtc_build_json=3Dfalse" "rtc_build_libevent=3Dfalse" =2D "rtc_build_libjpeg=3Dfalse" "rtc_build_libvpx=3Dfalse" "rtc_build_opus=3Dfalse" "rtc_build_ssl=3Dfalse" @@ -595,8 +594,9 @@ plain/debian/patches/system/event.patch?id=3D64458c4216= edd82503dc9366e2f4d80ae7c76 ("gtk+-2" ,gtk+-2) ("gtk+" ,gtk+) ("harfbuzz" ,harfbuzz) =2D ("icu4c" ,icu4c) + ("icu4c" ,icu4c-59.1) ("jsoncpp" ,jsoncpp) + ("lcms" ,lcms) ("libevent" ,libevent) ("libffi" ,libffi) ("libjpeg-turbo" ,libjpeg-turbo) diff --git a/gnu/packages/icu4c.scm b/gnu/packages/icu4c.scm index 55bc9f203..b12de6ff0 100644 =2D-- a/gnu/packages/icu4c.scm +++ b/gnu/packages/icu4c.scm @@ -80,6 +81,23 @@ C/C++ part.") (origin-patches (package-source icu4c)) (search-patches "icu4c-CVE-2017-14952.patch")))))= )) =20 +(define-public icu4c-59.1 + (package + (inherit icu4c) + (version "59.1") + (source (origin + (method url-fetch) + (uri (string-append + "http://download.icu-project.org/files/icu4c/" + version + "/icu4c-" + (string-map (lambda (x) (if (char=3D? x #\.) #\_ x)) v= ersion) + "-src.tgz")) + (patches (search-patches "icu4c-CVE-2017-14952.patch")) + (sha256 + (base32 + "1zkmbg2932ggvpgjp8pys0cj6z8bw087y8858009shkrjfpzscki"))))= )) + (define-public java-icu4j (package (name "java-icu4j") --=-=-= Content-Type: text/plain Below is the full patch for convenience. I plan to commit it on Friday or Saturday, after a cosmetic check. Especially the description could use some work, and the grouping of "configure flags". One final note for future contributors is that Gentoo[2] is kind-of upstream for Chromium, as ChromiumOS is based on Portage and I've seen several Gentoo developers on the Chromium bug tracker. They often have early compatibility patches (e.g. when it invariably breaks with GCC). [0] https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/commit/?id=794aa1820460727711e534ea1042db7eebc1601d [1] https://git.archlinux.org/svntogit/packages.git/commit/trunk?h=packages/chromium&id=6ebdd8085de0b7c8bbc66e47b937271ab4a85fbd [2] https://gitweb.gentoo.org/repo/gentoo.git/tree/www-client/chromium --=-=-= Content-Type: text/x-patch; charset=utf-8 Content-Disposition: attachment; filename=0001-gnu-Add-chromium.patch Content-Transfer-Encoding: quoted-printable From=20021bccfd3fc3bf0e912d27cef9ca2de36346a379 Mon Sep 17 00:00:00 2001 From: Marius Bakke Date: Wed, 12 Oct 2016 17:25:05 +0100 Subject: [PATCH] gnu: Add chromium. * gnu/packages/chromium.scm: New file. * gnu/packages/patches/chromium-disable-api-keys-warning.patch, gnu/packages/patches/chromium-disable-third-party-cookies.patch, gnu/packages/patches/chromium-system-icu.patch: New files. * gnu/local.mk: Record it. * gnu/packages/icu4c.scm (icu-59.1): New variable. =2D-- gnu/local.mk | 4 + gnu/packages/chromium.scm | 650 +++++++++++++++++= ++++ gnu/packages/icu4c.scm | 18 + .../chromium-disable-api-keys-warning.patch | 17 + .../chromium-disable-third-party-cookies.patch | 13 + gnu/packages/patches/chromium-system-icu.patch | 15 + 6 files changed, 717 insertions(+) create mode 100644 gnu/packages/chromium.scm create mode 100644 gnu/packages/patches/chromium-disable-api-keys-warning.= patch create mode 100644 gnu/packages/patches/chromium-disable-third-party-cooki= es.patch create mode 100644 gnu/packages/patches/chromium-system-icu.patch diff --git a/gnu/local.mk b/gnu/local.mk index f2044c985..274dcc87f 100644 =2D-- a/gnu/local.mk +++ b/gnu/local.mk @@ -87,6 +87,7 @@ GNU_SYSTEM_MODULES =3D \ %D%/packages/certs.scm \ %D%/packages/check.scm \ %D%/packages/chez.scm \ + %D%/packages/chromium.scm \ %D%/packages/ci.scm \ %D%/packages/cinnamon.scm \ %D%/packages/cmake.scm \ @@ -560,6 +561,9 @@ dist_patch_DATA =3D \ %D%/packages/patches/chicken-CVE-2017-6949.patch \ %D%/packages/patches/chicken-CVE-2017-11343.patch \ %D%/packages/patches/chmlib-inttypes.patch \ + %D%/packages/patches/chromium-disable-api-keys-warning.patch \ + %D%/packages/patches/chromium-disable-third-party-cookies.patch \ + %D%/packages/patches/chromium-system-icu.patch \ %D%/packages/patches/clang-libc-search-path.patch \ %D%/packages/patches/clang-3.8-libc-search-path.patch \ %D%/packages/patches/clisp-remove-failing-test.patch \ diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm new file mode 100644 index 000000000..f5ee95c2f =2D-- /dev/null +++ b/gnu/packages/chromium.scm @@ -0,0 +1,650 @@ +;;; GNU Guix --- Functional package management for GNU +;;; Copyright =C2=A9 2016, 2017 Marius Bakke +;;; +;;; This file is part of GNU Guix. +;;; +;;; GNU Guix is free software; you can redistribute it and/or modify it +;;; under the terms of the GNU General Public License as published by +;;; the Free Software Foundation; either version 3 of the License, or (at +;;; your option) any later version. +;;; +;;; GNU Guix is distributed in the hope that it will be useful, but +;;; WITHOUT ANY WARRANTY; without even the implied warranty of +;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +;;; GNU General Public License for more details. +;;; +;;; You should have received a copy of the GNU General Public License +;;; along with GNU Guix. If not, see . + +(define-module (gnu packages chromium) + #:use-module ((guix licenses) #:prefix license:) + #:use-module (guix packages) + #:use-module (guix download) + #:use-module (guix git-download) + #:use-module (guix utils) + #:use-module (guix build-system gnu) + #:use-module (gnu packages) + #:use-module (gnu packages assembly) + #:use-module (gnu packages base) + #:use-module (gnu packages bison) + #:use-module (gnu packages compression) + #:use-module (gnu packages cups) + #:use-module (gnu packages curl) + #:use-module (gnu packages databases) + #:use-module (gnu packages fontutils) + #:use-module (gnu packages ghostscript) + #:use-module (gnu packages gl) + #:use-module (gnu packages glib) + #:use-module (gnu packages gnome) + #:use-module (gnu packages gnuzilla) + #:use-module (gnu packages gperf) + #:use-module (gnu packages gtk) + #:use-module (gnu packages icu4c) + #:use-module (gnu packages image) + #:use-module (gnu packages libevent) + #:use-module (gnu packages libffi) + #:use-module (gnu packages libusb) + #:use-module (gnu packages linux) + #:use-module (gnu packages kerberos) + #:use-module (gnu packages ninja) + #:use-module (gnu packages node) + #:use-module (gnu packages pciutils) + #:use-module (gnu packages photo) + #:use-module (gnu packages pkg-config) + #:use-module (gnu packages protobuf) + #:use-module (gnu packages pulseaudio) + #:use-module (gnu packages python) + #:use-module (gnu packages regex) + #:use-module (gnu packages serialization) + #:use-module (gnu packages speech) + #:use-module (gnu packages tls) + #:use-module (gnu packages valgrind) + #:use-module (gnu packages version-control) + #:use-module (gnu packages video) + #:use-module (gnu packages xiph) + #:use-module (gnu packages xml) + #:use-module (gnu packages xdisorg) + #:use-module (gnu packages xorg)) + +(define (remote-patch file-name uri hash) + "Return an object with the given FILE-NAME. URI must be a FTP = or +HTTP(S) URI that returns a file with the given HASH." + (origin + (method url-fetch) + (uri uri) + (sha256 (base32 hash)) + (file-name file-name))) + +(define opus+custom + (package (inherit opus) + (arguments + `(;; Opus Custom is an optional extension of the Opus + ;; specification that allows for unsupported frame + ;; sizes. Chromium requires that this is enabled. + #:configure-flags '("--enable-custom-modes") + ,@(package-arguments opus))))) + +;; Chromium since 58 depends on an unreleased libvpx. So, we +;; package the latest master branch as of 2017-10-22. +(define libvpx+experimental + (package + (inherit libvpx) + (source (origin + (method git-fetch) + (uri (git-reference + (url "https://chromium.googlesource.com/webm/libvpx") + (commit "b58259ab55674cb028898a0ac9e8fdd3cf1d4b39"))) + (file-name "libvpx-for-chromium-checkout") + (sha256 + (base32 + "0grx2p7add0qyycqvqiv3djk0i37xrg75phszg5mwnwd3ijv3qzj")))) + ;; TODO: Make libvpx configure flags overrideable. + (arguments + `(#:phases + (modify-phases %standard-phases + (replace 'configure + (lambda* (#:key outputs #:allow-other-keys) + (setenv "CONFIG_SHELL" (which "bash")) + (let ((out (assoc-ref outputs "out"))) + (setenv "LDFLAGS" + (string-append "-Wl,-rpath=3D" out "/lib")) + (zero? (system* "./configure" + "--enable-shared" + "--as=3Dyasm" + ;; Limit size to avoid CVE-2015-1258 + "--size-limit=3D16384x16384" + ;; Spatial SVC is an experimental VP9 encod= er + ;; used by some packages (i.e. Chromium). + "--enable-experimental" + "--enable-spatial-svc" + (string-append "--prefix=3D" out))))))) + #:tests? #f)))) ; No tests. + +(define %chromium-gn-bootstrap.patch + (remote-patch "chromium-gn-bootstrap.patch" + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-clien= t/\ +chromium/files/chromium-gn-bootstrap-r17.patch?id=3D\ +5c9cf110bd61fa287a5c536760b5d8ed13f65d52" + "12wsq3bs46mvr7cinxvqjmbzymigm8yzf478r08y9l6sd3qij4yq")) + +(define %chromium-gcc-5-compat.patch + (remote-patch "chromium-gcc-5-compat.patch" + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-clien= t/\ +chromium/files/chromium-gcc5-r3.patch?id=3D5c9cf110bd61fa287a5c536760b5d8e= d13f65d52" + "0qwl396w2bnc4ww71q3621chh9rfnw1m3w6nbd55sbhq8yz6jnx0")) + +(define %chromium-system-nspr.patch + (remote-patch "chromium-system-nspr.patch" + "https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium= .git/\ +plain/debian/patches/system/nspr.patch?id=3D64458c4216edd82503dc9366e2f4d8= 0ae7c763b0" + "0l69sq3w9n5zygykf1gfzp1zfb7gkjk62nnvbrmkn00gzq6cc643")) + +(define %chromium-system-libevent.patch + (remote-patch "chromium-system-libevent.patch" + "https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium= .git/\ +plain/debian/patches/system/event.patch?id=3D64458c4216edd82503dc9366e2f4d= 80ae7c763b0" + "0vibc92kwycm8jlyfa49135nq0flm6gkrf8ic76m5rkraclijvn9")) + +(define-public chromium + (package + (name "chromium") + (version "62.0.3202.62") + (synopsis "Graphical web browser") + (source (origin + (method url-fetch) + (uri (string-append "https://commondatastorage.googleapis.co= m/" + "chromium-browser-official/chromium-" + version ".tar.xz")) + (sha256 + (base32 + "0qn3pjq5n3ri3qh25wg5gd2as5a8wlkncqvi975xsab771833pz8")) + (patches (append (list %chromium-gn-bootstrap.patch + %chromium-gcc-5-compat.patch + %chromium-system-nspr.patch + %chromium-system-libevent.patch + ) + (search-patches + "chromium-system-icu.patch" + "chromium-disable-api-keys-warning.patch" + "chromium-disable-third-party-cookies.patc= h"))) + (modules '((srfi srfi-1) + (guix build utils))) + (snippet + '(begin + ;; Replace GN files from third_party with shims for buil= ding + ;; against system libraries. Keep this list in sync with + ;; "build/linux/unbundle/replace_gn_files.py". + (for-each (lambda (pair) + (let ((source (string-append + "build/linux/unbundle/" (car = pair))) + (dest (cdr pair))) + (copy-file source dest))) + (list + '("ffmpeg.gn" . "third_party/ffmpeg/BUILD.gn") + '("flac.gn" . "third_party/flac/BUILD.gn") + '("freetype.gn" . "third_party/freetype/BUILD= .gn") + '("harfbuzz-ng.gn" . "third_party/harfbuzz-ng= /BUILD.gn") + '("icu.gn" . "third_party/icu/BUILD.gn") + '("libdrm.gn" . "third_party/libdrm/BUILD.gn") + '("libevent.gn" . "base/third_party/libevent/= BUILD.gn") + '("libjpeg.gn" . + "build/secondary/third_party/libjpeg_turbo/= BUILD.gn") + '("libpng.gn" . "third_party/libpng/BUILD.gn") + '("libvpx.gn" . "third_party/libvpx/BUILD.gn") + '("libwebp.gn" . "third_party/libwebp/BUILD.g= n") + ;;'("libxml.gn" . "third_party/libxml/BUILD.g= n") ;TODO + '("libxslt.gn" . "third_party/libxslt/BUILD.g= n") + '("openh264.gn" . "third_party/openh264/BUILD= .gn") + '("opus.gn" . "third_party/opus/BUILD.gn") + '("re2.gn" . "third_party/re2/BUILD.gn") + '("snappy.gn" . "third_party/snappy/BUILD.gn") + '("yasm.gn" . "third_party/yasm/yasm_assemble= .gni") + '("zlib.gn" . "third_party/zlib/BUILD.gn"))) + #t)))) + (build-system gnu-build-system) + (arguments + `(#:tests? #f ; TODO: Maybe run --headless or something. + ;; FIXME: There is a "gn" option specifically for setting -rpath, b= ut + ;; it's not recognized when passed. + #:validate-runpath? #f + #:modules ((srfi srfi-26) + (ice-9 ftw) + (ice-9 regex) + (guix build gnu-build-system) + (guix build utils)) + #:phases + (modify-phases %standard-phases + (add-after 'unpack 'remove-bundled-software + (lambda _ + (let ((keep-libs + (list + ;; Third party folders that cannot be deleted yet. + "base/third_party/dmg_fp" + "base/third_party/dynamic_annotations" + "base/third_party/icu" + "base/third_party/libevent" + "base/third_party/nspr" + "base/third_party/superfasthash" + "base/third_party/symbolize" ; glog + "base/third_party/xdg_mime" + "base/third_party/xdg_user_dirs" + "buildtools/third_party/libc++" + "chrome/third_party/mozilla_security_manager" + "courgette/third_party" + "net/third_party/mozilla_security_manager" + "net/third_party/nss" + "third_party/adobe/flash/flapper_version.h" + ;; FIXME: This is used in: + ;; * ui/webui/resources/js/analytics.js + ;; * ui/file_manager/ + "third_party/analytics" + "third_party/angle" + "third_party/angle/src/common/third_party/base" + "third_party/angle/src/common/third_party/murmurhash" + "third_party/angle/src/third_party/compiler" + "third_party/angle/src/third_party/libXNVCtrl" + "third_party/angle/src/third_party/trace_event" + "third_party/boringssl" + "third_party/brotli" + "third_party/cacheinvalidation" + "third_party/catapult" + "third_party/catapult/third_party/polymer" + "third_party/catapult/third_party/py_vulcanize" + "third_party/catapult/third_party/py_vulcanize/third_= party/rcssmin" + "third_party/catapult/third_party/py_vulcanize/third_= party/rjsmin" + "third_party/catapult/tracing/third_party/d3" + "third_party/catapult/tracing/third_party/gl-matrix" + "third_party/catapult/tracing/third_party/jszip" + "third_party/catapult/tracing/third_party/mannwhitney= u" + "third_party/catapult/tracing/third_party/oboe" + "third_party/ced" + "third_party/cld_3" + "third_party/crc32c" + "third_party/cros_system_api" + "third_party/dom_distiller_js" + "third_party/fips181" + "third_party/flatbuffers" + ;; XXX Needed by pdfium since 59. + "third_party/freetype" + "third_party/glslang-angle" + "third_party/google_input_tools" + "third_party/google_input_tools/third_party/closure_l= ibrary" + (string-append "third_party/google_input_tools/third_= party" + "/closure_library/third_party/closure") + "third_party/googletest" + "third_party/hunspell" + "third_party/iccjpeg" + "third_party/inspector_protocol" + "third_party/jinja2" + "third_party/jstemplate" + "third_party/khronos" + "third_party/leveldatabase" + "third_party/libXNVCtrl" + "third_party/libaddressinput" + "third_party/libjingle_xmpp" + "third_party/libphonenumber" + "third_party/libsecret" ;FIXME: needs pkg-config supp= ort. + "third_party/libsrtp" ;TODO: Requires libsrtp@2. + "third_party/libudev" + "third_party/libwebm" + "third_party/libxml" ;FIXME: Unbundle (again). + "third_party/libyuv" + "third_party/lss" + "third_party/lzma_sdk" + "third_party/markupsafe" + "third_party/mesa" + "third_party/modp_b64" + "third_party/mt19937ar" + "third_party/node" + "third_party/node/node_modules/polymer-bundler/lib/th= ird_party/UglifyJS2" + "third_party/openmax_dl" + "third_party/ots" + "third_party/pdfium" ;TODO: can be built standalone. + "third_party/pdfium/third_party" + "third_party/ply" + "third_party/polymer" + "third_party/protobuf" + "third_party/protobuf/third_party/six" + "third_party/qcms" + "third_party/sfntly" + "third_party/skia" + "third_party/skia/third_party/vulkan" + "third_party/skia/third_party/gif" + "third_party/smhasher" + ;; XXX the sources that include this are generated. + "third_party/speech-dispatcher" + "third_party/spirv-headers" + "third_party/spirv-tools-angle" + "third_party/sqlite" + "third_party/swiftshader" + "third_party/swiftshader/third_party" + "third_party/usb_ids" + "third_party/usrsctp" + "third_party/vulkan" + "third_party/vulkan-validation-layers" + "third_party/WebKit" + "third_party/web-animations-js" + "third_party/webrtc" + "third_party/widevine/cdm/widevine_cdm_version.h" + "third_party/widevine/cdm/widevine_cdm_common.h" + "third_party/woff2" + "third_party/xdg-utils" + "third_party/yasm/run_yasm.py" + "third_party/zlib/google" + "url/third_party/mozilla" + "v8/src/third_party/valgrind" + "v8/third_party/inspector_protocol"))) + ;; FIXME: implement as source snippet. This traverses + ;; any "third_party" directory and deletes files that are: + ;; * not ending with ".gn" or ".gni"; or + ;; * not explicitly named as argument (folder or file). + (zero? (apply system* "python" + "build/linux/unbundle/remove_bundled_librarie= s.py" + "--do-remove" keep-libs))))) + (add-after 'remove-bundled-software 'patch-stuff + (lambda* (#:key inputs #:allow-other-keys) + (substitute* "printing/cups_config_helper.py" + (("cups_config =3D.*") + (string-append "cups_config =3D '" (assoc-ref inputs "cups= ") + "/bin/cups-config'\n"))) + + (substitute* + '("base/process/launch_posix.cc" + "base/tracked_objects.cc" + "base/third_party/dynamic_annotations/dynamic_annotatio= ns.c" + "sandbox/linux/seccomp-bpf/sandbox_bpf.cc" + "sandbox/linux/services/credentials.cc" + "sandbox/linux/services/namespace_utils.cc" + "sandbox/linux/services/syscall_wrappers.cc" + "sandbox/linux/syscall_broker/broker_host.cc") + (("include \"base/third_party/valgrind/") "include \"valgri= nd/")) + + (for-each (lambda (file) + (substitute* file + ;; Fix opus include path. + ;; Do not substitute opus_private.h. + (("#include \"opus\\.h\"") + "#include \"opus/opus.h\"") + (("#include \"opus_custom\\.h\"") + "#include \"opus/opus_custom.h\"") + (("#include \"opus_defines\\.h\"") + "#include \"opus/opus_defines.h\"") + (("#include \"opus_multistream\\.h\"") + "#include \"opus/opus_multistream.h\"") + (("#include \"opus_types\\.h\"") + "#include \"opus/opus_types.h\""))) + (append (find-files "third_party/opus/src/celt") + (find-files "third_party/opus/src/src") + (find-files (string-append "third_party/web= rtc/modules" + "/audio_coding/c= odecs/opus")))) + + (substitute* "chrome/common/chrome_paths.cc" + (("/usr/share/chromium/extensions") + ;; TODO: Add ~/.guix-profile. + "/run/current-system/profile/share/chromium/extensions")) + + (substitute* "breakpad/src/common/linux/libcurl_wrapper.h" + (("include \"third_party/curl") "include \"curl")) + (substitute* "media/base/decode_capabilities.cc" + (("third_party/libvpx/source/libvpx/") "")) + + ;; We don't cross compile most packages, so get rid of the + ;; unnecessary ARCH-linux-gnu* prefix. + (substitute* "build/toolchain/linux/BUILD.gn" + (("aarch64-linux-gnu-") "") + (("arm-linux-gnueabihf-") "")) + #t)) + (replace 'configure + (lambda* (#:key inputs outputs #:allow-other-keys) + (let ((gn-flags + (list + ;; See tools/gn/docs/cookbook.md and + ;; https://www.chromium.org/developers/gn-build-confi= guration + ;; for usage. Run "./gn args . --list" in the Release + ;; directory for an exhaustive list of supported flag= s. + "is_debug=3Dfalse" + "is_official_build=3Dfalse" + "is_clang=3Dfalse" + "use_gold=3Dfalse" + "linux_use_bundled_binutils=3Dfalse" + "use_custom_libcxx=3Dfalse" + "use_sysroot=3Dfalse" + "goma_dir=3D\"\"" + "use_jumbo_build=3Dtrue" ;speeds up compilation + "enable_precompiled_headers=3Dfalse" + "remove_webcore_debug_symbols=3Dtrue" + "enable_iterator_debugging=3Dfalse" + "exclude_unwind_tables=3Dtrue" + "override_build_date=3D\"01 01 2000 05:00:00\"" + "use_unofficial_version_number=3Dfalse" + ;; Don't fail when using deprecated ffmpeg features. + "treat_warnings_as_errors=3Dfalse" + "enable_nacl=3Dfalse" + "enable_nacl_nonsfi=3Dfalse" + "use_allocator=3D\"none\"" ; Don't use tcmalloc. + ;; Don't add any API keys. End users can set them in = the + ;; environment if necessary. + ;; https://www.chromium.org/developers/how-tos/api-ke= ys + "use_official_google_api_keys=3Dfalse" + ;; Disable "field trials". + "fieldtrial_testing_like_official_build=3Dtrue" + "enable_reading_list=3Dfalse" + ;;"enable_reporting=3Dfalse" ;XXX breaks the build + + "use_openh264=3Dtrue" + "use_system_freetype=3Dtrue" + "use_system_libjpeg=3Dtrue" + "use_system_lcms2=3Dtrue" + "use_system_zlib=3Dtrue" + ;; This is currently not supported on Linux: + ;; https://bugs.chromium.org/p/chromium/issues/detail= ?id=3D22208 + ;; "use_system_sqlite=3Dtrue" + "use_gtk3=3Dtrue" + "use_gconf=3Dfalse" ; deprecated by gsettings + "use_gnome_keyring=3Dfalse" ; deprecated by libsecret + "use_xkbcommon=3Dtrue" + "link_pulseaudio=3Dtrue" + + ;; Don't arbitrarily restrict formats supported by sy= stem ffmpeg. + "proprietary_codecs=3Dtrue" + "ffmpeg_branding=3D\"Chrome\"" + + ;; WebRTC stuff. + "rtc_use_h264=3Dtrue" + ;; Don't use bundled sources. + "rtc_build_json=3Dfalse" + "rtc_build_libevent=3Dfalse" + "rtc_build_libvpx=3Dfalse" + "rtc_build_opus=3Dfalse" + "rtc_build_ssl=3Dfalse" + ;; TODO: Package these. + "rtc_build_libsrtp=3Dtrue" ; 2.0 + "rtc_build_libyuv=3Dtrue" + "rtc_build_openmax_dl=3Dtrue" + "rtc_build_usrsctp=3Dtrue" + (string-append "rtc_jsoncpp_root=3D\"" + (assoc-ref inputs "jsoncpp") + "/include/jsoncpp/json\"") + (string-append "rtc_ssl_root=3D\"" + (assoc-ref inputs "openssl") + "/include/openssl\"")))) + + ;; XXX: How portable is this. + (mkdir-p "third_party/node/linux/node-linux-x64") + (symlink (string-append (assoc-ref inputs "node") "/bin") + "third_party/node/linux/node-linux-x64/bin") + + (setenv "CC" "gcc") + (setenv "CXX" "g++") + ;; TODO: pre-compile instead. Avoids a race condition. + (setenv "PYTHONDONTWRITEBYTECODE" "1") + (and + ;; Build the "gn" tool. + (zero? (system* "python" + "tools/gn/bootstrap/bootstrap.py" "-s" "-v= ")) + ;; Generate ninja build files. + (zero? (system* "./out/Release/gn" "gen" "out/Release" + (string-append "--args=3D" + (string-join gn-flags " "))= )))))) + (replace 'build + (lambda* (#:key outputs #:allow-other-keys) + (zero? (system* "ninja" "-C" "out/Release" + "-j" (number->string (parallel-job-count)) + "chrome")))) + (replace 'install + (lambda* (#:key inputs outputs #:allow-other-keys) + (let* ((out (assoc-ref outputs "out")) + (bin (string-append out "/bin")) + (exe (string-append bin "/chromium")) + (lib (string-append out "/lib")) + (man (string-append out "/share/man/man1")) + (applications (string-append out "/share/application= s")) + (install-regexp (make-regexp "\\.(so|bin|pak)$")) + (locales (string-append lib "/locales")) + (resources (string-append lib "/resources")) + (gtk+ (assoc-ref inputs "gtk+")) + (mesa (assoc-ref inputs "mesa")) + (nss (assoc-ref inputs "nss")) + (udev (assoc-ref inputs "udev")) + (sh (which "sh"))) + + (mkdir-p applications) + (call-with-output-file (string-append applications + "/chromium.desktop") + (lambda (port) + (format port + "[Desktop Entry]~@ + Name=3DChromium~@ + Comment=3D~a~@ + Exec=3D~a~@ + Icon=3Dchromium.png~@ + Type=3DApplication~%" ,synopsis exe))) + + (with-directory-excursion "out/Release" + (for-each (lambda (file) + (install-file file lib)) + (scandir "." (cut regexp-exec install-regexp <>= ))) + (copy-file "chrome" (string-append lib "/chromium")) + + ;; TODO: Install icons from "../../chrome/app/themes" into + ;; "out/share/icons/hicolor/$size". + (install-file + "product_logo_48.png" + (string-append out "/share/icons/48x48/chromium.png")) + + (copy-recursively "locales" locales) + (copy-recursively "resources" resources) + + (mkdir-p man) + (copy-file "chrome.1" (string-append man "/chromium.1")) + + (mkdir-p bin) + ;; Add a thin wrapper to prevent the user from inadverten= tly + ;; installing non-free software through the Web Store. + ;; TODO: Discover extensions from the profile and pass + ;; something like "--disable-extensions-except=3D...". + (call-with-output-file exe + (lambda (port) + (format port + "#!~a~@ + CHROMIUM_FLAGS=3D\"--disable-background-netwo= rking\"~@ + if [ -z \"$CHROMIUM_ENABLE_WEB_STORE\" ]~@ + then~@ + CHROMIUM_FLAGS=3D\"$CHROMIUM_FLAGS --disa= ble-extensions\"~@ + fi~@ + exec ~a $CHROMIUM_FLAGS \"$@\"~%" + sh (string-append lib "/chromium")))) + (chmod exe #o755) + + (wrap-program exe + ;; TODO: Get these in RUNPATH. + `("LD_LIBRARY_PATH" ":" prefix + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib:" + mesa "/lib:" udev "/lib"))) + ;; Avoid file manager crash. See . + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/sh= are")))) + #t))))))) + (native-inputs + `(("bison" ,bison) + ("git" ,git) ;last_commit_position.py + ("gperf" ,gperf) + ("ninja" ,ninja) + ("node" ,node) + ("pkg-config" ,pkg-config) + ("which" ,which) + ("yasm" ,yasm) + + ("python-beautifulsoup4" ,python2-beautifulsoup4) + ("python-html5lib" ,python2-html5lib) + ("python" ,python-2))) + (inputs + `(("alsa-lib" ,alsa-lib) + ("atk" ,atk) + ("cups" ,cups) + ("curl" ,curl) + ("dbus" ,dbus) + ("dbus-glib" ,dbus-glib) + ("expat" ,expat) + ("flac" ,flac) + ("ffmpeg" ,ffmpeg) + ("fontconfig" ,fontconfig) + ("freetype" ,freetype) + ("gdk-pixbuf" ,gdk-pixbuf) + ("glib" ,glib) + ("gtk+-2" ,gtk+-2) + ("gtk+" ,gtk+) + ("harfbuzz" ,harfbuzz) + ("icu4c" ,icu4c-59.1) + ("jsoncpp" ,jsoncpp) + ("lcms" ,lcms) + ("libevent" ,libevent) + ("libffi" ,libffi) + ("libjpeg-turbo" ,libjpeg-turbo) + ("libpng" ,libpng) + ("libusb" ,libusb) + ("libvpx" ,libvpx+experimental) + ("libwebp" ,libwebp) + ("libx11" ,libx11) + ("libxcb" ,libxcb) + ("libxcomposite" ,libxcomposite) + ("libxcursor" ,libxcursor) + ("libxdamage" ,libxdamage) + ("libxext" ,libxext) + ("libxfixes" ,libxfixes) + ("libxi" ,libxi) + ("libxkbcommon" ,libxkbcommon) + ("libxml2" ,libxml2) + ("libxrandr" ,libxrandr) + ("libxrender" ,libxrender) + ("libxscrnsaver" ,libxscrnsaver) + ("libxslt" ,libxslt) + ("libxtst" ,libxtst) + ("mesa" ,mesa) + ("minizip" ,minizip) + ("mit-krb5" ,mit-krb5) + ("nss" ,nss) + ("openh264" ,openh264) + ("openssl" ,openssl) + ("opus" ,opus+custom) + ("pango" ,pango) + ("pciutils" ,pciutils) + ("protobuf" ,protobuf) + ("pulseaudio" ,pulseaudio) + ("re2" ,re2) + ("snappy" ,snappy) + ("speech-dispatcher" ,speech-dispatcher) + ("sqlite" ,sqlite) + ("udev" ,eudev) + ("valgrind" ,valgrind))) + (home-page "https://www.chromium.org/") + (description + "Chromium is a web browser using the @code{Blink} rendering engine.") + ;; Chromium is developed as BSD-3, but bundles a large number of third= -party + ;; software with other licenses. For full information, see chrome://cr= edits. + (license (list license:bsd-3 + license:bsd-2 + license:expat + license:asl2.0 + license:mpl2.0 + license:public-domain + license:lgpl2.1+)))) diff --git a/gnu/packages/icu4c.scm b/gnu/packages/icu4c.scm index 55bc9f203..b12de6ff0 100644 =2D-- a/gnu/packages/icu4c.scm +++ b/gnu/packages/icu4c.scm @@ -4,6 +4,7 @@ ;;; Copyright =C2=A9 2016 Efraim Flashner ;;; Copyright =C2=A9 2017 Cl=C3=A9ment Lassieur ;;; Copyright =C2=A9 2017 Ricardo Wurmus +;;; Copyright =C2=A9 2017 Marius Bakke ;;; ;;; This file is part of GNU Guix. ;;; @@ -80,6 +81,23 @@ C/C++ part.") (origin-patches (package-source icu4c)) (search-patches "icu4c-CVE-2017-14952.patch")))))= )) =20 +(define-public icu4c-59.1 + (package + (inherit icu4c) + (version "59.1") + (source (origin + (method url-fetch) + (uri (string-append + "http://download.icu-project.org/files/icu4c/" + version + "/icu4c-" + (string-map (lambda (x) (if (char=3D? x #\.) #\_ x)) v= ersion) + "-src.tgz")) + (patches (search-patches "icu4c-CVE-2017-14952.patch")) + (sha256 + (base32 + "1zkmbg2932ggvpgjp8pys0cj6z8bw087y8858009shkrjfpzscki"))))= )) + (define-public java-icu4j (package (name "java-icu4j") diff --git a/gnu/packages/patches/chromium-disable-api-keys-warning.patch b= /gnu/packages/patches/chromium-disable-api-keys-warning.patch new file mode 100644 index 000000000..c7e219f40 =2D-- /dev/null +++ b/gnu/packages/patches/chromium-disable-api-keys-warning.patch @@ -0,0 +1,17 @@ +Disable warning about missing API keys. + +Copied from: + +https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/tree/debian/= patches/disable/google-api-warning.patch + +--- a/chrome/browser/ui/startup/startup_browser_creator_impl.cc ++++ b/chrome/browser/ui/startup/startup_browser_creator_impl.cc +@@ -816,8 +816,6 @@ void StartupBrowserCreatorImpl::AddInfoB + !command_line_.HasSwitch(switches::kTestType) && + !command_line_.HasSwitch(switches::kEnableAutomation)) { + chrome::ShowBadFlagsPrompt(browser); +- GoogleApiKeysInfoBarDelegate::Create(InfoBarService::FromWebContents( +- browser->tab_strip_model()->GetActiveWebContents())); + ObsoleteSystemInfoBarDelegate::Create(InfoBarService::FromWebContents( + browser->tab_strip_model()->GetActiveWebContents())); +=20 diff --git a/gnu/packages/patches/chromium-disable-third-party-cookies.patc= h b/gnu/packages/patches/chromium-disable-third-party-cookies.patch new file mode 100644 index 000000000..0694c35f3 =2D-- /dev/null +++ b/gnu/packages/patches/chromium-disable-third-party-cookies.patch @@ -0,0 +1,13 @@ +Disable third party cookies by default. + +--- a/components/content_settings/core/browser/cookie_settings.cc ++++ b/components/content_settings/core/browser/cookie_settings.cc +@@ -101,7 +101,7 @@ void CookieSettings::GetCookieSettings( + void CookieSettings::RegisterProfilePrefs( + user_prefs::PrefRegistrySyncable* registry) { + registry->RegisterBooleanPref( +- prefs::kBlockThirdPartyCookies, false, ++ prefs::kBlockThirdPartyCookies, true, + user_prefs::PrefRegistrySyncable::SYNCABLE_PREF); + } +=20 diff --git a/gnu/packages/patches/chromium-system-icu.patch b/gnu/packages/= patches/chromium-system-icu.patch new file mode 100644 index 000000000..c35c1b75c =2D-- /dev/null +++ b/gnu/packages/patches/chromium-system-icu.patch @@ -0,0 +1,15 @@ +description: maintain compatibility with system icu library +author: Michael Gilbert + +--- a/BUILD.gn ++++ b/BUILD.gn +@@ -657,8 +657,7 @@ group("gn_all") { + } + } +=20 +- if ((is_linux && !is_chromeos && !is_chromecast) || (is_win && use_drfu= zz) || +- (use_libfuzzer && is_mac)) { ++ if (false) { + deps +=3D [ + "//testing/libfuzzer/fuzzers", + "//testing/libfuzzer/tests:libfuzzer_tests", =2D-=20 2.14.3 --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlnvrG4ACgkQoqBt8qM6 VPoBVAf/UbHKaag7cX0rOfVE+gMfe7MhXHLHsOI8gDTx5UXKqvta+hg5iWiEX2Of AE0prNmx/u7DQc0MXVi3USpC1fmC8W6W/wI4L0rrgYDQzAyGqayNjVqiTIDB0CH/ iFaFSAMLoyy+oB5+IAAp7P0pLeCufIPxUcorMlzJ+snC7HEKtEItGLDFFkx6jWr4 MEaLLGVnd7RfgZmbO5bGei4sd8uLLwQ3xyPP4hBwLKBhgmcNsw8Ep6bHS0eMLzrn bugXnAzrqzNcobUnFPvYDBXUe7RhfVJlY+2U378Kw/jpPq95qx+tyDBffWXY+U1x fiFTjxeGlE/ezAdBOwxs2QWltSPb0w== =IUER -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sun Nov 05 18:52:39 2017 Received: (at 28004) by debbugs.gnu.org; 5 Nov 2017 23:52:39 +0000 Received: from localhost ([127.0.0.1]:52784 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eBUiU-0008Ht-0l for submit@debbugs.gnu.org; Sun, 05 Nov 2017 18:52:38 -0500 Received: from out4-smtp.messagingengine.com ([66.111.4.28]:48325) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eBUiR-0008Hk-IV for 28004@debbugs.gnu.org; Sun, 05 Nov 2017 18:52:36 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 98A872098B; Sun, 5 Nov 2017 18:52:34 -0500 (EST) Received: from frontend2 ([10.202.2.161]) by compute5.internal (MEProxy); Sun, 05 Nov 2017 18:52:34 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=QkjyRDmu/VK68ei00aDDdCT/1bWbhSSeZfDPWsz7Be4=; b=Od0M/8s2 W13aBNvF0ocvcXN4hIZyzA5xTsntxSj9bOGmoZ/KJZ9npiu4EZA7LeOUScQ6uJHd W1lwS4ikM4ttjmSSGpD1LoMEbAJ0rb0fM3+ka4uT1x6pzLrcNoJtgywnBaR1K4hN r9gtjwa/Y77nDeuLXGBHkKvu37orsB9axhw6BqZRhXFPx1Z/mGe9CNPzAjf0GSEp 96738pB6pPnMIAIYjyeeKT78JLWo0BcUJAwvqrhDGkTjzf34qjk06qH1y645PE8x 1BbE5g4Xm18c3572l0NQ6Tq98If2oo6EX/J1qNYfVH3v6zzLepU+z6YHItQiBzLe g5dxrggFUW/xAA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm1; bh=QkjyRDmu/VK68ei00aDDdCT/1bWbh SSeZfDPWsz7Be4=; b=bCKmy0mnEESbBwbsbXjGXoD7TCwGhjAFE3BgufTUwxbmO 2EbfNgZyR8OJ9zbdu5udfIbGuDre9tnpziIN2VpLmxGMZXSSX1IeyrhINA4uGGuT Db972G+hTQnWCU+D8bjNAgL3jXS3FYD+btdpbKnauYi03HTuho4h9/sy7ACiGfNg aM/9Imz0r0DmmdKSKpwIXObCQg4tdfrZuBnVP2un6KSsGfePgWUks5ivxQwGw43Y LnF+fNoKpMvIVr5lKp9uSHvxNisZbnTZsvCxHeYg6Se0Lyd7+oJe880SWBWeNmFE 8kxzaMQOsB11dNgZH7uSlG0iaskmnQMmXUunLLm0g== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id 25D47248BA; Sun, 5 Nov 2017 18:52:34 -0500 (EST) From: Marius Bakke To: Ludovic =?utf-8?Q?Court=C3=A8s?= , Leo Famulari Subject: Re: [bug#28004] Chromium In-Reply-To: <87o9p45bb6.fsf@fastmail.com> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> User-Agent: Notmuch/0.25.1 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Mon, 06 Nov 2017 00:52:32 +0100 Message-ID: <87o9og4727.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Marius Bakke writes: > Ludovic Court=C3=A8s writes: > >> I think we should make sure that our package does not call home in any >> way. That=E2=80=99s what I expect from a security- and privacy-conscious >> distro. > > Currently, it calls home at first launch, prompting for a login. But > I've verified that it does not send any unsolicited requests for > subsequent startups, as long as the user does not change the > command-line flags. I tried picking two other Debian patches[0][1] to see if it helped with the annoying splash screen and decided to verify whether the browser still "calls home" from a clean profile. The last time I checked was many versions ago. After dismissing the sign-in dialog, the "New Tab Page" loads a regular Google search bar, and "pre-fills" two of the "most commonly used" slots with Chrome URLs, (still) downloading a bunch of data in the process. Not great, but maybe we could live with that if it was just for the first run (it wasn't; had to change search engine to prevent the New Tab Page from calling the mothership). To my great surprise, while watching tcpdump from a different window, it also called home *when I switched windows*. Every time the Chromium window was activated, some data was sent to Google servers. Going into settings and toggling the "Use a prediction service to help complete searches and URLs typed in the address bar" option (to off) disabled that behaviour. Not very confidence-instilling. I'm going to try to incorporate the "Inox Patchset"[2], which is a set of patches that attempts to remove all such misfeatures from Chromium. They seem to have managed to stay on top of recent Chromium development, unlike two other prominent privacy-focused "forks", so I'm optimistic. But it might take some weeks before the next update. Stay tuned.. [0] [1] [2] --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAln/pEAACgkQoqBt8qM6 VPq3VwgAycCAXzPEfUOb40FCNfmgCvYld4O8BdaTtDXhFj6DzMqdVXq3jNddGpDn xMKRHZPCEKFAzNeh2a+YAW2m1isPnw6EQywJl4jXnMSUVhFUSZiNQB4NTTVxYeCL Z51yjQcYBBfJvcS0b40V2Lq0Ij8LRu4rasrLQICiHtypFxoOToy5640P3KVP9nAL re1Y6IUL57YUzc0kEkgpspb0hh2gNOQb7/tW9H5v15Ecd0vhF57SYil1H+GNRbac 7hCK5D4MbDeYobrXo4pwjh4FPjwwA66/jPU0xV9C7YLLok7Upxa448P40qxhg95G BtMhSAlvts54B7X1RPcLY0gaSE8CIg== =1ceO -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Fri Nov 10 06:33:29 2017 Received: (at submit) by debbugs.gnu.org; 10 Nov 2017 11:33:29 +0000 Received: from localhost ([127.0.0.1]:33236 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eD7Yr-0005C5-DY for submit@debbugs.gnu.org; Fri, 10 Nov 2017 06:33:29 -0500 Received: from eggs.gnu.org ([208.118.235.92]:40379) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eD7Yn-0005Bk-Eg for submit@debbugs.gnu.org; Fri, 10 Nov 2017 06:33:21 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1eD7Yh-0006Sl-BB for submit@debbugs.gnu.org; Fri, 10 Nov 2017 06:33:16 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=0.8 required=5.0 tests=BAYES_50 autolearn=disabled version=3.3.2 Received: from lists.gnu.org ([2001:4830:134:3::11]:45937) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1eD7Yh-0006SR-7p for submit@debbugs.gnu.org; Fri, 10 Nov 2017 06:33:15 -0500 Received: from eggs.gnu.org ([2001:4830:134:3::10]:59568) by lists.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1eD7Yf-0002zl-Vn for guix-patches@gnu.org; Fri, 10 Nov 2017 06:33:15 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1eD7Yc-0006OG-QF for guix-patches@gnu.org; Fri, 10 Nov 2017 06:33:13 -0500 Received: from relay3-d.mail.gandi.net ([217.70.183.195]:34562) by eggs.gnu.org with esmtps (TLS1.0:DHE_RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1eD7Yc-0006Mo-K6 for guix-patches@gnu.org; Fri, 10 Nov 2017 06:33:10 -0500 X-Originating-IP: 181.221.145.22 Received: from adfeno-pc1 (unknown [181.221.145.22]) (Authenticated sender: adfeno@hyperbola.info) by relay3-d.mail.gandi.net (Postfix) with ESMTPSA id 8F891A80D7 for ; Fri, 10 Nov 2017 12:33:08 +0100 (CET) From: Adonay Felipe Nogueira To: guix-patches@gnu.org Subject: Re: [bug#28004] Chromium References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <87o9og4727.fsf@fastmail.com> Date: Fri, 10 Nov 2017 09:33:05 -0200 In-Reply-To: <87o9og4727.fsf@fastmail.com> (Marius Bakke's message of "Mon, 06 Nov 2017 00:52:32 +0100") Message-ID: <877euy8j2m.fsf@hyperbola.info> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/25.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] [fuzzy] X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.6.x X-Received-From: 2001:4830:134:3::11 X-Spam-Score: -4.1 (----) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -4.1 (----) As a continuation, directory-discuss started to discuss the Chromium issue once again ([1]). [1] . Marius Bakke writes: > I tried picking two other Debian patches[0][1] to see if it helped with > the annoying splash screen and decided to verify whether the browser > still "calls home" from a clean profile. The last time I checked was > many versions ago. > > After dismissing the sign-in dialog, the "New Tab Page" loads a regular > Google search bar, and "pre-fills" two of the "most commonly used" slots > with Chrome URLs, (still) downloading a bunch of data in the process. > > Not great, but maybe we could live with that if it was just for the > first run (it wasn't; had to change search engine to prevent the New Tab > Page from calling the mothership). > > To my great surprise, while watching tcpdump from a different window, it > also called home *when I switched windows*. Every time the Chromium > window was activated, some data was sent to Google servers. > > Going into settings and toggling the "Use a prediction service to help > complete searches and URLs typed in the address bar" option (to off) > disabled that behaviour. > > Not very confidence-instilling. > > I'm going to try to incorporate the "Inox Patchset"[2], which is a set > of patches that attempts to remove all such misfeatures from Chromium. > They seem to have managed to stay on top of recent Chromium development, > unlike two other prominent privacy-focused "forks", so I'm optimistic. > > But it might take some weeks before the next update. Stay tuned.. > > [0] > > [1] > > [2] From debbugs-submit-bounces@debbugs.gnu.org Thu Jan 04 14:17:13 2018 Received: (at 28004) by debbugs.gnu.org; 4 Jan 2018 19:17:13 +0000 Received: from localhost ([127.0.0.1]:35994 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eXB0k-0007E1-On for submit@debbugs.gnu.org; Thu, 04 Jan 2018 14:17:13 -0500 Received: from aibo.runbox.com ([91.220.196.211]:54030) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eXB0b-0007DP-CR for 28004@debbugs.gnu.org; Thu, 04 Jan 2018 14:17:04 -0500 Received: from [10.9.9.211] (helo=mailfront11.runbox.com) by mailtransmit03.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1eXB0V-0008KO-Lw; Thu, 04 Jan 2018 20:16:51 +0100 Received: from dslb-178-001-158-034.178.001.pools.vodafone-ip.de ([178.1.158.34] helo=localhost) by mailfront11.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1eXB0T-0003QV-Pn; Thu, 04 Jan 2018 20:16:50 +0100 Date: Thu, 4 Jan 2018 19:16:48 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180104191648.custe7w3l57fvbac@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="a4wtjznlvype5xp3" Content-Disposition: inline In-Reply-To: <87o9p45bb6.fsf@fastmail.com> X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Ludovic =?utf-8?Q?Court=C3=A8s?= , ng0 , Leo Famulari X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.0 (/) --a4wtjznlvype5xp3 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 37K bytes: > Ludovic Court=C3=A8s writes: >=20 > > I think we should make sure that our package does not call home in any > > way. That=E2=80=99s what I expect from a security- and privacy-conscio= us > > distro. >=20 > Currently, it calls home at first launch, prompting for a login. But > I've verified that it does not send any unsolicited requests for > subsequent startups, as long as the user does not change the > command-line flags. >=20 > Anyway I'm attaching the current iteration of this patch. Chromium 62 > is out today, I'll try to update this weekend and will push it after > that in lieu of other feedback. >=20 > I would be very happy if someone managed to complete the 62 upgrade > before me, however! ;-) >=20 > From d6e3ef7f28a9bc4ace0c52e09b1e4bdde84e01e0 Mon Sep 17 00:00:00 2001 > From: Marius Bakke > Date: Wed, 12 Oct 2016 17:25:05 +0100 > Subject: [PATCH] gnu: Add chromium. =2E.. > +(define-public chromium > + (package > + (name "chromium") =2E.. > + (substitute* "chrome/common/chrome_paths.cc" > + (("/usr/share/chromium/extensions") > + ;; TODO: Add ~/.guix-profile. > + "/run/current-system/profile/share/chromium/extensions")) What's the idea behind this? Did you test it? Do you have any guix build-sy= stem using Chromium extensions as an example? So far this completely disables the installation of any plugins and addons. > + > + (substitute* "breakpad/src/common/linux/libcurl_wrapper.h" > + (("include \"third_party/curl") "include \"curl")) > + (substitute* "media/base/decode_capabilities.cc" > + (("third_party/libvpx/source/libvpx/") "")) > + > + ;; We don't cross compile most packages, so get rid of the > + ;; unnecessary ARCH-linux-gnu* prefix. > + (substitute* "build/toolchain/linux/BUILD.gn" > + (("aarch64-linux-gnu-") "") > + (("arm-linux-gnueabihf-") "")) > + #t)) > + (replace 'configure > + (lambda* (#:key inputs outputs #:allow-other-keys) > + (let ((gn-flags > + (list > + ;; See tools/gn/docs/cookbook.md and > + ;; https://www.chromium.org/developers/gn-build-con= figuration > + ;; for usage. Run "./gn args . --list" in the Relea= se > + ;; directory for an exhaustive list of supported fl= ags. > + "is_debug=3Dfalse" > + "is_official_build=3Dfalse" > + "is_clang=3Dfalse" > + "use_gold=3Dfalse" > + "linux_use_bundled_binutils=3Dfalse" > + "use_custom_libcxx=3Dfalse" > + "use_sysroot=3Dfalse" > + "remove_webcore_debug_symbols=3Dtrue" > + "enable_iterator_debugging=3Dfalse" > + "override_build_date=3D\"01 01 2000 05:00:00\"" > + ;; Don't fail when using deprecated ffmpeg features. > + "treat_warnings_as_errors=3Dfalse" > + "enable_nacl=3Dfalse" > + "enable_nacl_nonsfi=3Dfalse" > + "use_allocator=3D\"none\"" ; Don't use tcmalloc. > + ;; Don't add any API keys. End users can set them i= n the > + ;; environment if necessary. > + ;; https://www.chromium.org/developers/how-tos/api-= keys > + "use_official_google_api_keys=3Dfalse" > + ;; Disable "field trials". > + "fieldtrial_testing_like_official_build=3Dtrue" > + > + "use_system_libjpeg=3Dtrue" > + ;; This is currently not supported on Linux: > + ;; https://bugs.chromium.org/p/chromium/issues/deta= il?id=3D22208 > + ;; "use_system_sqlite=3Dtrue" > + "use_gtk3=3Dtrue" > + "use_gconf=3Dfalse" ; deprecated by gsettin= gs > + "use_gnome_keyring=3Dfalse" ; deprecated by libsecr= et > + "use_xkbcommon=3Dtrue" > + "link_pulseaudio=3Dtrue" > + "use_openh264=3Dtrue" > + > + ;; Don't arbitrarily restrict formats supported by = system ffmpeg. > + "proprietary_codecs=3Dtrue" > + "ffmpeg_branding=3D\"Chrome\"" > + > + ;; WebRTC stuff. > + "rtc_use_h264=3Dtrue" > + ;; Don't use bundled sources. > + "rtc_build_json=3Dfalse" > + "rtc_build_libevent=3Dfalse" > + "rtc_build_libjpeg=3Dfalse" > + "rtc_build_libvpx=3Dfalse" > + "rtc_build_opus=3Dfalse" > + "rtc_build_ssl=3Dfalse" > + ;; TODO: Package these. > + "rtc_build_libsrtp=3Dtrue" ; 2.0 > + "rtc_build_libyuv=3Dtrue" > + "rtc_build_openmax_dl=3Dtrue" > + "rtc_build_usrsctp=3Dtrue" > + (string-append "rtc_jsoncpp_root=3D\"" > + (assoc-ref inputs "jsoncpp") > + "/include/jsoncpp/json\"") > + (string-append "rtc_ssl_root=3D\"" > + (assoc-ref inputs "openssl") > + "/include/openssl\"")))) > + > + ;; XXX: How portable is this. > + (mkdir-p "third_party/node/linux/node-linux-x64") > + (symlink (string-append (assoc-ref inputs "node") "/bin") > + "third_party/node/linux/node-linux-x64/bin") > + > + (setenv "CC" "gcc") > + (setenv "CXX" "g++") > + ;; TODO: pre-compile instead. Avoids a race condition. > + (setenv "PYTHONDONTWRITEBYTECODE" "1") > + (and > + ;; Build the "gn" tool. > + (zero? (system* "python" > + "tools/gn/bootstrap/bootstrap.py" "-s" "= -v")) > + ;; Generate ninja build files. > + (zero? (system* "./out/Release/gn" "gen" "out/Release" > + (string-append "--args=3D" > + (string-join gn-flags " "= )))))))) > + (replace 'build > + (lambda* (#:key outputs #:allow-other-keys) > + (zero? (system* "ninja" "-C" "out/Release" > + "-j" (number->string (parallel-job-count)) > + "chrome")))) > + (replace 'install > + (lambda* (#:key inputs outputs #:allow-other-keys) > + (let* ((out (assoc-ref outputs "out")) > + (bin (string-append out "/bin")) > + (exe (string-append bin "/chromium")) > + (lib (string-append out "/lib")) > + (man (string-append out "/share/man/man1"= )) > + (applications (string-append out "/share/applicati= ons")) > + (install-regexp (make-regexp "\\.(so|bin|pak)$")) > + (locales (string-append lib "/locales")) > + (resources (string-append lib "/resources")) > + (gtk+ (assoc-ref inputs "gtk+")) > + (mesa (assoc-ref inputs "mesa")) > + (nss (assoc-ref inputs "nss")) > + (udev (assoc-ref inputs "udev")) > + (sh (which "sh"))) > + > + (mkdir-p applications) > + (call-with-output-file (string-append applications > + "/chromium.desktop") > + (lambda (port) > + (format port > + "[Desktop Entry]~@ > + Name=3DChromium~@ > + Comment=3D~a~@ > + Exec=3D~a~@ > + Icon=3Dchromium.png~@ > + Type=3DApplication~%" ,synopsis exe))) > + > + (with-directory-excursion "out/Release" > + (for-each (lambda (file) > + (install-file file lib)) > + (scandir "." (cut regexp-exec install-regexp = <>))) > + (copy-file "chrome" (string-append lib "/chromium")) > + > + ;; TODO: Install icons from "../../chrome/app/themes" i= nto > + ;; "out/share/icons/hicolor/$size". > + (install-file > + "product_logo_48.png" > + (string-append out "/share/icons/48x48/chromium.png")) > + > + (copy-recursively "locales" locales) > + (copy-recursively "resources" resources) > + > + (mkdir-p man) > + (copy-file "chrome.1" (string-append man "/chromium.1")) > + > + (mkdir-p bin) > + ;; Add a thin wrapper to prevent the user from inadvert= ently > + ;; installing non-free software through the Web Store. > + ;; TODO: Discover extensions from the profile and pass > + ;; something like "--disable-extensions-except=3D...". Same question here. If you need help, there's at least 3 users of Chromium now. I'd like to read your ideas on how to solve the TODOs, aswell as: Do you have any unpushed progress? Maybe we can team collaborate on this huge browser. > + (call-with-output-file exe > + (lambda (port) > + (format port > + "#!~a~@ > + CHROMIUM_FLAGS=3D\"--disable-background-net= working\"~@ > + if [ -z \"$CHROMIUM_ENABLE_WEB_STORE\" ]~@ > + then~@ > + CHROMIUM_FLAGS=3D\"$CHROMIUM_FLAGS --di= sable-extensions\"~@ > + fi~@ > + exec ~a $CHROMIUM_FLAGS \"$@\"~%" > + sh (string-append lib "/chromium")))) > + (chmod exe #o755) > + > + (wrap-program exe > + ;; TODO: Get these in RUNPATH. > + `("LD_LIBRARY_PATH" ":" prefix > + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib= :" > + mesa "/lib:" udev "/lib"))) > + ;; Avoid file manager crash. See . > + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/= share")))) > + #t))))))) --=20 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://c.n0.is/ng0_pubkeys/tree/keys WWW: https://n0.is/a/ :: https://ea.n0.is --a4wtjznlvype5xp3 Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlpOfaAACgkQ4i+bv+40 hYgbwA/+MkmSWzs84ZAEAJC0cI8nvwE+cSplcQReUxebkDacVOykqBHti2cds3+l cO7ovSd8U0VifKZ3j3HkR7UGxdRIfbwwrdQzcpm4TBe34LO0iXMGnRv26EgQ7HZQ 9cHjDHVaB8vmlH5IFZJu95K7dkgYiPu+BxbD9dYlr4V7c1KLs/aQflCnh9Ymcknd 7SyTfxr5XXgMd4BDZKerDTqa0ccdH57WujybEuzOmfRnH7L9Wr3tzQ7njh2qRLMZ Aiz+P6KWfnnKOb9iaxvaK7YGH0B3yCl6yz/9D+0JYmZLQiwA3t2obqr1cwcZLrOv OsZ+fwSPLqUaRvXlCskeZbmCT20XW142p5q9eo/BuMB38p99IgoiXKFnzrDDjWxv mK8X56rodgjMdHI3HwEFDJ1E4MnLzfBQdMNusCTqrzTNd7SsgnYDChRFZc1Yshif +J/83Izu4M7Aq6XXYzNMXLCmdtnGFCxBnYvkbImbvnEeK/WiSxHNbIVZsLUWudw1 QWyE4sJDT6K0lq9yOh0Bpm7v2AkgT4XprFIw61Ps4C8vj3pwcqhaw8DBera7GHQh ZSJ5uf8GHSGGP1b7Ah8H6XAFEXveXaGFaKFSsJ7KwdGgOXVLjfMElAozfzTe8KJq 3UE+VwuoCTOnsGM5HMHOS2/c8gGriQ6Wf4YPC7uPeoODGthYzRk= =J5lQ -----END PGP SIGNATURE----- --a4wtjznlvype5xp3-- From debbugs-submit-bounces@debbugs.gnu.org Mon Jan 08 16:56:46 2018 Received: (at 28004) by debbugs.gnu.org; 8 Jan 2018 21:56:46 +0000 Received: from localhost ([127.0.0.1]:41818 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eYfPG-0000eN-Rm for submit@debbugs.gnu.org; Mon, 08 Jan 2018 16:56:44 -0500 Received: from out3-smtp.messagingengine.com ([66.111.4.27]:54459) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eYfPB-0000eB-Jj for 28004@debbugs.gnu.org; Mon, 08 Jan 2018 16:56:33 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 1ED8720DCC; Mon, 8 Jan 2018 16:56:29 -0500 (EST) Received: from frontend2 ([10.202.2.161]) by compute5.internal (MEProxy); Mon, 08 Jan 2018 16:56:29 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=D7CEKLBIO7ehVEO6ITsejBvNEDqC59NMK28C6HmL2Jo=; b=xr/BJcSs 8c8WjwU9nWDiNseUzTqwpyb5IAR4m7tO+sk2PbrC0vIhpdXkTFmQ//XUa5MJeilT 1bh/3JPU4tV8VBComs0OThcg91lEegdAPV8AXtxktfJrtRUQ4OfYdUr4mONPixMh HkOthVMFYEY7Z80aJtQLdKnmGD0y4rx+UmhApNViWXl8PqnecR42u5OSQ+Ot87dl 3MahriPNoQ1mSFICosqu6lgQCM7mbSUxI67Qxeh5ytyoTwWfHEetdf2iS9x2Sqlb pV+DAZNilJY0DMcNMhzT4Ekkw9ZsIqux+8OwYwrdDkfihpuez2PrbGqEreNyn2V8 NEiHgSxAcu/VTg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm1; bh=D7CEKLBIO7ehVEO6ITsejBvNEDqC5 9NMK28C6HmL2Jo=; b=TXQPDeIhFak0VhGlZHGxQy3xPCK4xOAiP8/L2DTH+iSrC CCvlQh7FsjaWAMHi6HDV0/AVk1habA7F1jcXAdpXZzH1pxz4OK22dzfcd0Y9GeL0 44ewM7FY1cb6RnReQ531dBFEHfEwtWFpI3IP97jPZfGNJkIYKo74fGNKtB0TSs3T nFrmHULLWzCbB8MsPwIZpEQX8ofNkvi37U0DBU5yo2Xbu/nHUkifPecFiuYgI7/7 ZVcvM5SkEtyVjB7hGBCgYjm6T04j9kX0iv7rayJjqXdt3j7awcvA2Jqa6t4Z80UD dj2eyYxB6TyXFuxLZr6YPFeqRAKFdJwbAPDHHt4eg== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id 61117247FC; Mon, 8 Jan 2018 16:56:28 -0500 (EST) From: Marius Bakke To: ng0 Subject: Re: [bug#28004] Chromium In-Reply-To: <20180104191648.custe7w3l57fvbac@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> User-Agent: Notmuch/0.25.3 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Mon, 08 Jan 2018 22:56:26 +0100 Message-ID: <87wp0s2ewl.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Ludovic =?utf-8?Q?Court=C3=A8s?= , ng0 , Leo Famulari X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.0 (/) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain ng0 writes: >> + (substitute* "chrome/common/chrome_paths.cc" >> + (("/usr/share/chromium/extensions") >> + ;; TODO: Add ~/.guix-profile. >> + "/run/current-system/profile/share/chromium/extensions")) > > What's the idea behind this? Did you test it? Do you have any guix build-system > using Chromium extensions as an example? So far this completely disables the > installation of any plugins and addons. The idea is to eventually be able to distribute extensions with Guix. I added this path mostly to document it, but don't see how keeping the default makes a difference. If you can place an extension in /usr/share, you can also copy it to the system profile through your config.scm, or symlink this location on a foreign distribution. >> + (mkdir-p bin) >> + ;; Add a thin wrapper to prevent the user from inadvertently >> + ;; installing non-free software through the Web Store. >> + ;; TODO: Discover extensions from the profile and pass >> + ;; something like "--disable-extensions-except=...". > > Same question here. The Web Store has serious freedom issues, thus we can not enable it by default. Enabling it *must* be a conscious choice by the end user. The TODO here is inspired by Debians wrapper script, which enumerates the location where apt places extensions, and gives that list to "--disable-extensions-except". > If you need help, there's at least 3 users of Chromium now. I'd like to read > your ideas on how to solve the TODOs, aswell as: Do you have any unpushed > progress? Maybe we can team collaborate on this huge browser. I do maintain this patch, but unfortunately not in a public repository. I've attached the latest iteration here (sorry for squashed). New since the last time are some fixes from the "Inox patchset" that resolves most of the privacy issues. Namely removing the "login wizard", changing to sensible defaults, and forcing the "classic" New Tab Page that does not load a search engine. Also, all patches have been moved to remote origins. Testing and feedback welcome! Currently there are two "important" (blocking?) TODOs left: * Move the 'delete-bundled-software' phase to a source snippet. Repacking the ~500MiB compressed tarball is *really* expensive. It should also aid the licensing situation. * Delete the two default entries from the "most used" list on the New Tab page. The first run will download thumbnails for these sites, leaking data. One of them also leads to the disabled-by-default store, promoting non-free software. I'm optimistic that fixing the second item will make the browser not leak *any* data at launch with the default configuration. Which leads to a third item: writing a system test that verifies that launching Chromium does indeed not initiate any network traffic. Anyway, here is the latest patch: --=-=-= Content-Type: text/x-patch; charset=utf-8 Content-Disposition: attachment; filename=0001-gnu-Add-chromium.patch Content-Transfer-Encoding: quoted-printable From=20f813b2d7ec0728a906720fa74bf9f442af6ab10d Mon Sep 17 00:00:00 2001 From: Marius Bakke Date: Wed, 12 Oct 2016 17:25:05 +0100 Subject: [PATCH] gnu: Add chromium. * gnu/packages/chromium.scm: New file. * gnu/local.mk: Record it. =2D-- gnu/local.mk | 1 + gnu/packages/chromium.scm | 733 ++++++++++++++++++++++++++++++++++++++++++= ++++ 2 files changed, 734 insertions(+) create mode 100644 gnu/packages/chromium.scm diff --git a/gnu/local.mk b/gnu/local.mk index d4e841921..529fdd2be 100644 =2D-- a/gnu/local.mk +++ b/gnu/local.mk @@ -89,6 +89,7 @@ GNU_SYSTEM_MODULES =3D \ %D%/packages/check.scm \ %D%/packages/chemistry.scm \ %D%/packages/chez.scm \ + %D%/packages/chromium.scm \ %D%/packages/ci.scm \ %D%/packages/cinnamon.scm \ %D%/packages/cmake.scm \ diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm new file mode 100644 index 000000000..78cfb3097 =2D-- /dev/null +++ b/gnu/packages/chromium.scm @@ -0,0 +1,733 @@ +;;; GNU Guix --- Functional package management for GNU +;;; Copyright =C2=A9 2016, 2017 Marius Bakke +;;; +;;; This file is part of GNU Guix. +;;; +;;; GNU Guix is free software; you can redistribute it and/or modify it +;;; under the terms of the GNU General Public License as published by +;;; the Free Software Foundation; either version 3 of the License, or (at +;;; your option) any later version. +;;; +;;; GNU Guix is distributed in the hope that it will be useful, but +;;; WITHOUT ANY WARRANTY; without even the implied warranty of +;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +;;; GNU General Public License for more details. +;;; +;;; You should have received a copy of the GNU General Public License +;;; along with GNU Guix. If not, see . + +(define-module (gnu packages chromium) + #:use-module ((guix licenses) #:prefix license:) + #:use-module (guix packages) + #:use-module (guix download) + #:use-module (guix git-download) + #:use-module (guix utils) + #:use-module (guix build-system gnu) + #:use-module (gnu packages) + #:use-module (gnu packages assembly) + #:use-module (gnu packages base) + #:use-module (gnu packages bison) + #:use-module (gnu packages compression) + #:use-module (gnu packages cups) + #:use-module (gnu packages curl) + #:use-module (gnu packages databases) + #:use-module (gnu packages fontutils) + #:use-module (gnu packages ghostscript) + #:use-module (gnu packages gl) + #:use-module (gnu packages glib) + #:use-module (gnu packages gnome) + #:use-module (gnu packages gnuzilla) + #:use-module (gnu packages gperf) + #:use-module (gnu packages gtk) + #:use-module (gnu packages icu4c) + #:use-module (gnu packages image) + #:use-module (gnu packages libevent) + #:use-module (gnu packages libffi) + #:use-module (gnu packages libusb) + #:use-module (gnu packages linux) + #:use-module (gnu packages kerberos) + #:use-module (gnu packages ninja) + #:use-module (gnu packages node) + #:use-module (gnu packages pciutils) + #:use-module (gnu packages photo) + #:use-module (gnu packages pkg-config) + #:use-module (gnu packages protobuf) + #:use-module (gnu packages pulseaudio) + #:use-module (gnu packages python) + #:use-module (gnu packages python-web) + #:use-module (gnu packages regex) + #:use-module (gnu packages serialization) + #:use-module (gnu packages speech) + #:use-module (gnu packages tls) + #:use-module (gnu packages valgrind) + #:use-module (gnu packages version-control) + #:use-module (gnu packages video) + #:use-module (gnu packages xiph) + #:use-module (gnu packages xml) + #:use-module (gnu packages xdisorg) + #:use-module (gnu packages xorg)) + +(define (strip-directory-prefix pathspec) + "Return everything after the last '/' in PATHSPEC." + (let ((index (string-rindex pathspec #\/))) + (if index (string-drop pathspec (+ 1 index)) + pathspec))) + +(define (chromium-patch-file-name pathspec) + (let ((patch-name (strip-directory-prefix pathspec))) + (if (string-prefix? "chromium-" patch-name) + patch-name + (string-append "chromium-" patch-name)))) + +;; https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/tree/debi= an/patches +(define (debian-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append + "https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git" + "/plain/debian/patches/" pathspec "?id=3D" revision)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://gitweb.gentoo.org/repo/gentoo.git/tree/www-client/chromium/files +(define (gentoo-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-client" + "/chromium/files/" pathspec "?id=3D" revision)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://github.com/gcarq/inox-patchset +(define (inox-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append "https://raw.githubusercontent.com/gcarq/inox-patc= hset/" + revision "/" pathspec)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +(define opus+custom + (package (inherit opus) + (arguments + `(;; Opus Custom is an optional extension of the Opus + ;; specification that allows for unsupported frame + ;; sizes. Chromium requires that this is enabled. + #:configure-flags '("--enable-custom-modes") + ,@(package-arguments opus))))) + +;; Chromium since 58 depends on an unreleased libvpx. So, we +;; package the latest master branch as of 2018-01-07. +(define libvpx+experimental + (package + (inherit libvpx) + (source (origin + (method git-fetch) + (uri (git-reference + (url "https://chromium.googlesource.com/webm/libvpx") + (commit "bed28a55f593efd3a71a3a9d05cf8bb25d15fa44"))) + (file-name "libvpx-for-chromium-checkout") + (sha256 + (base32 + "0h01vmb8awzrb2xwqaz215v73yjdjf67hzdm2yfcz4h4qrvwf817")))) + ;; TODO: Make libvpx configure flags overrideable. + (arguments + `(#:phases + (modify-phases %standard-phases + (replace 'configure + (lambda* (#:key outputs #:allow-other-keys) + (setenv "CONFIG_SHELL" (which "bash")) + (let ((out (assoc-ref outputs "out"))) + (setenv "LDFLAGS" + (string-append "-Wl,-rpath=3D" out "/lib")) + (zero? (system* "./configure" + "--enable-shared" + "--as=3Dyasm" + ;; Limit size to avoid CVE-2015-1258 + "--size-limit=3D16384x16384" + ;; Spatial SVC is an experimental VP9 encod= er + ;; used by some packages (i.e. Chromium). + "--enable-experimental" + "--enable-spatial-svc" + (string-append "--prefix=3D" out))))))) + #:tests? #f)))) ; No tests. + +(define %chromium-gn-bootstrap.patch + (gentoo-patch "chromium-gn-bootstrap-r17.patch" + "5c9cf110bd61fa287a5c536760b5d8ed13f65d52" + "12wsq3bs46mvr7cinxvqjmbzymigm8yzf478r08y9l6sd3qij4yq")) + +(define %chromium-gcc-compat.patch + (gentoo-patch "chromium-gcc5-r4.patch" + "1c5423aab094796b3da7a2905f02cbdcdd6a7742" + "18s152pkqzzw6grxj1m6mp3pc2x3ha2gyayw5hf2nhranak5wlkg")) + +(define %chromium-webkit-gcc-compat.patch + (gentoo-patch "chromium-gcc5-r5.patch" + "1c5423aab094796b3da7a2905f02cbdcdd6a7742" + "0z7rggizzg85wfr8zhw0yfwd3q69lsh3yp297s939jgzp66cwwkw")) + +(define %chromium-webrtc-gcc-compat.patch + (gentoo-patch "chromium-webrtc-r0.patch" + "1c5423aab094796b3da7a2905f02cbdcdd6a7742" + "0qj5b4w9kav51ylpdf38vm5w7p2gx4qp8p45vrfggp7miicg9cmw")) + +(define %chromium-system-nspr.patch + (debian-patch "system/nspr.patch" + "debian/63.0.3239.40-1" + "07a0q3khz77gk0rxzp965pjzhly5r08k019pinss18xc1caj971s")) + +(define %chromium-system-libevent.patch + (debian-patch "system/event.patch" + "debian/63.0.3239.40-1" + "0604ia06w40zn66d85in03xg3hd6144y8b222kzyc9nzhq3xm2pc")) + +(define %chromium-system-icu.patch + (debian-patch "system/icu.patch" + "debian/63.0.3239.40-1" + "0kf77d8lyma3w0xpgfv2k0c741zp6ii08gzllfja6d5s59c15ylv")) + +(define %chromium-disable-api-keys-warning.patch + (debian-patch "disable/google-api-warning.patch" + "36794e57f1f97068640c6845dbeb9291155893c0" + "11llghxm0a75kb8fnpy6ky8ix4f1kk7n0c0zfcpwxsx05pask11m")) + +(define %chromium-external-components.patch + (debian-patch "disable/external-components.patch" + "debian/63.0.3239.40-1" + "1i3b801hjafxv7djk7cl7nj2skxid0vysf12yjr364db949f164l")) + +(define %chromium-duckduckgo.patch + (inox-patch "0011-add-duckduckgo-search-engine.patch" + "5af0e6187c22471b8cb803f6dda6738f23a530e7" + "0p8x98g71ngkd3wbl5q36wrl18ff185sfrr5fcwjbgrv3v7r6ra7")) + +;; Don't start a "Login Wizard" at first launch. +(define %chromium-first-run.patch + (inox-patch "0018-disable-first-run-behaviour.patch" + "3336bb286ea054271ac2199cf374e96c64ed53cf" + "1y4zsqqf2125jkb1phwy9g5hcbd9xhyv5lr4xcaly66rpdzx2ayb")) + +;; Use privacy-preserving defaults. +(define %chromium-default-preferences.patch + (inox-patch "0006-modify-default-prefs.patch" + "3336bb286ea054271ac2199cf374e96c64ed53cf" + "1h8ycmn00yvciq3r5jcdqmsl4grqv8izgwi6a20kijz2baxxr888")) + +;; Recent versions of Chromium may load a remote search engine on the +;; New Tab Page, causing unnecessary and involuntary network traffic. +(define %chromium-restore-classic-ntp.patch + (inox-patch "0008-restore-classic-ntp.patch" + "2f60b788bff89bde11ac802d4c19093661cd23f7" + "00icvb0r1p3s7i2xy8kv1lpam96cxgn6c3s9bc6wv3dpi3d722p2")) + +(define-public chromium + (package + (name "chromium") + (version "63.0.3239.132") + (synopsis "Graphical web browser") + (source (origin + (method url-fetch) + (uri (string-append "https://commondatastorage.googleapis.co= m/" + "chromium-browser-official/chromium-" + version ".tar.xz")) + (sha256 + (base32 + "139x3cbc5pa14x69493ic8i2ank12c9fwiq6pqm11aps88n6ri44")) + (patches (list ;%chromium-gn-bootstrap.patch + %chromium-gcc-compat.patch + %chromium-webkit-gcc-compat.patch + %chromium-webrtc-gcc-compat.patch + %chromium-duckduckgo.patch + %chromium-default-preferences.patch + %chromium-first-run.patch + %chromium-restore-classic-ntp.patch + %chromium-system-icu.patch + %chromium-system-nspr.patch + %chromium-system-libevent.patch + %chromium-disable-api-keys-warning.patch)) + (modules '((srfi srfi-1) + (guix build utils))) + (snippet + '(begin + ;; Replace GN files from third_party with shims for buil= ding + ;; against system libraries. Keep this list in sync with + ;; "build/linux/unbundle/replace_gn_files.py". + (for-each (lambda (pair) + (let ((source (string-append + "build/linux/unbundle/" (car = pair))) + (dest (cdr pair))) + (copy-file source dest))) + (list + '("ffmpeg.gn" . "third_party/ffmpeg/BUILD.gn") + '("flac.gn" . "third_party/flac/BUILD.gn") + '("freetype.gn" . "third_party/freetype/BUILD= .gn") + ;; XXX: This broke in 63. + ;;'("harfbuzz-ng.gn" . "third_party/harfbuzz-= ng/BUILD.gn") + '("icu.gn" . "third_party/icu/BUILD.gn") + '("libdrm.gn" . "third_party/libdrm/BUILD.gn") + '("libevent.gn" . "base/third_party/libevent/= BUILD.gn") + '("libjpeg.gn" . + "build/secondary/third_party/libjpeg_turbo/= BUILD.gn") + '("libpng.gn" . "third_party/libpng/BUILD.gn") + '("libvpx.gn" . "third_party/libvpx/BUILD.gn") + '("libwebp.gn" . "third_party/libwebp/BUILD.g= n") + ;;'("libxml.gn" . "third_party/libxml/BUILD.g= n") ;TODO + '("libxslt.gn" . "third_party/libxslt/BUILD.g= n") + '("openh264.gn" . "third_party/openh264/BUILD= .gn") + '("opus.gn" . "third_party/opus/BUILD.gn") + '("re2.gn" . "third_party/re2/BUILD.gn") + '("snappy.gn" . "third_party/snappy/BUILD.gn") + '("yasm.gn" . "third_party/yasm/yasm_assemble= .gni") + '("zlib.gn" . "third_party/zlib/BUILD.gn"))) + #t)))) + (build-system gnu-build-system) + (arguments + `(#:tests? #f + ;; FIXME: There is a "gn" option specifically for setting -rpath, b= ut + ;; it's not recognized when passed. + #:validate-runpath? #f + #:modules ((srfi srfi-26) + (ice-9 ftw) + (ice-9 regex) + (guix build gnu-build-system) + (guix build utils)) + #:phases + (modify-phases %standard-phases + (add-after 'unpack 'remove-bundled-software + (lambda _ + (let ((keep-libs + (list + ;; Third party folders that cannot be deleted yet. + "base/third_party/dmg_fp" + "base/third_party/dynamic_annotations" + "base/third_party/icu" + "base/third_party/libevent" + "base/third_party/nspr" + "base/third_party/superfasthash" + "base/third_party/symbolize" ; glog + "base/third_party/xdg_mime" + "base/third_party/xdg_user_dirs" + "buildtools/third_party/libc++" + "chrome/third_party/mozilla_security_manager" + "courgette/third_party" + "net/third_party/mozilla_security_manager" + "net/third_party/nss" + "third_party/adobe/flash/flapper_version.h" + ;; FIXME: This is used in: + ;; * ui/webui/resources/js/analytics.js + ;; * ui/file_manager/ + "third_party/analytics" + "third_party/angle" + "third_party/angle/src/common/third_party/base" + "third_party/angle/src/common/third_party/smhasher" + "third_party/angle/src/third_party/compiler" + "third_party/angle/src/third_party/libXNVCtrl" + "third_party/angle/src/third_party/trace_event" + "third_party/blink" + "third_party/boringssl" + "third_party/breakpad" + "third_party/brotli" + "third_party/cacheinvalidation" + "third_party/catapult" + "third_party/catapult/common/py_vulcanize/third_party= /rcssmin" + "third_party/catapult/common/py_vulcanize/third_party= /rjsmin" + "third_party/catapult/third_party/polymer" + "third_party/catapult/tracing/third_party/d3" + "third_party/catapult/tracing/third_party/gl-matrix" + "third_party/catapult/tracing/third_party/jszip" + "third_party/catapult/tracing/third_party/mannwhitney= u" + "third_party/catapult/tracing/third_party/oboe" + "third_party/catapult/tracing/third_party/pako" + "third_party/ced" + "third_party/cld_3" + "third_party/crc32c" + "third_party/cros_system_api" + "third_party/dom_distiller_js" + "third_party/fips181" + "third_party/flatbuffers" + ;; XXX Needed by pdfium since 59. + "third_party/freetype" + "third_party/glslang-angle" + "third_party/google_input_tools" + "third_party/google_input_tools/third_party/closure_l= ibrary" + (string-append "third_party/google_input_tools/third_= party" + "/closure_library/third_party/closure") + "third_party/googletest" + "third_party/harfbuzz-ng" ;XXX why is this required i= n 63+ + "third_party/hunspell" + "third_party/iccjpeg" + "third_party/inspector_protocol" + "third_party/jinja2" + "third_party/jstemplate" + "third_party/khronos" + "third_party/leveldatabase" + "third_party/libXNVCtrl" + "third_party/libaddressinput" + "third_party/libjingle_xmpp" + "third_party/libphonenumber" + "third_party/libsecret" ;FIXME: needs pkg-config supp= ort. + "third_party/libsrtp" ;TODO: Requires libsrtp@2. + "third_party/libudev" + "third_party/libwebm" + "third_party/libxml" ;FIXME: Unbundle (again). + "third_party/libyuv" + "third_party/lss" + "third_party/lzma_sdk" + "third_party/markupsafe" + "third_party/mesa" + "third_party/modp_b64" + "third_party/mt19937ar" + "third_party/node" + "third_party/node/node_modules/polymer-bundler/lib/th= ird_party/UglifyJS2" + "third_party/openmax_dl" + "third_party/ots" + "third_party/pdfium" + "third_party/pdfium/third_party" + "third_party/ply" + "third_party/polymer" + "third_party/protobuf" + "third_party/protobuf/third_party/six" + "third_party/qcms" + "third_party/sfntly" + "third_party/skia" + "third_party/skia/third_party/vulkan" + "third_party/skia/third_party/gif" + "third_party/smhasher" + "third_party/speech-dispatcher" + "third_party/spirv-headers" + "third_party/spirv-tools-angle" + "third_party/sqlite" + "third_party/swiftshader" + "third_party/swiftshader/third_party" + "third_party/usb_ids" + "third_party/usrsctp" + "third_party/vulkan" + "third_party/vulkan-validation-layers" + "third_party/WebKit" + "third_party/web-animations-js" + "third_party/webrtc" + "third_party/widevine/cdm/widevine_cdm_version.h" + "third_party/widevine/cdm/widevine_cdm_common.h" + "third_party/woff2" + "third_party/xdg-utils" + "third_party/yasm/run_yasm.py" + "third_party/zlib/google" + "url/third_party/mozilla" + "v8/src/third_party/valgrind" + "v8/third_party/inspector_protocol"))) + ;; FIXME: implement as source snippet. This traverses + ;; any "third_party" directory and deletes files that are: + ;; * not ending with ".gn" or ".gni"; or + ;; * not explicitly named as argument (folder or file). + (zero? (apply system* "python" + "build/linux/unbundle/remove_bundled_librarie= s.py" + "--do-remove" keep-libs))))) + (add-after 'remove-bundled-software 'patch-stuff + (lambda* (#:key inputs #:allow-other-keys) + (substitute* "printing/cups_config_helper.py" + (("cups_config =3D.*") + (string-append "cups_config =3D '" (assoc-ref inputs "cups= ") + "/bin/cups-config'\n"))) + + (substitute* + '("base/process/launch_posix.cc" + "base/third_party/dynamic_annotations/dynamic_annotatio= ns.c" + "sandbox/linux/seccomp-bpf/sandbox_bpf.cc" + "sandbox/linux/services/credentials.cc" + "sandbox/linux/services/namespace_utils.cc" + "sandbox/linux/services/syscall_wrappers.cc" + "sandbox/linux/syscall_broker/broker_host.cc") + (("include \"base/third_party/valgrind/") "include \"valgri= nd/")) + + (for-each (lambda (file) + (substitute* file + ;; Fix opus include path. + ;; Do not substitute opus_private.h. + (("#include \"opus\\.h\"") + "#include \"opus/opus.h\"") + (("#include \"opus_custom\\.h\"") + "#include \"opus/opus_custom.h\"") + (("#include \"opus_defines\\.h\"") + "#include \"opus/opus_defines.h\"") + (("#include \"opus_multistream\\.h\"") + "#include \"opus/opus_multistream.h\"") + (("#include \"opus_types\\.h\"") + "#include \"opus/opus_types.h\""))) + (append (find-files "third_party/opus/src/celt") + (find-files "third_party/opus/src/src") + (find-files (string-append "third_party/web= rtc/modules" + "/audio_coding/c= odecs/opus")))) + + (substitute* "chrome/common/chrome_paths.cc" + (("/usr/share/chromium/extensions") + ;; TODO: Add ~/.guix-profile. + "/run/current-system/profile/share/chromium/extensions")) + + (substitute* + "third_party/breakpad/breakpad/src/common/linux/libcurl_w= rapper.h" + (("include \"third_party/curl") "include \"curl")) + (substitute* "media/base/decode_capabilities.cc" + (("third_party/libvpx/source/libvpx/") "")) + + ;; We don't cross compile most packages, so get rid of the + ;; unnecessary ARCH-linux-gnu* prefix. + (substitute* "build/toolchain/linux/BUILD.gn" + (("aarch64-linux-gnu-") "") + (("arm-linux-gnueabihf-") "")) + #t)) + (replace 'configure + (lambda* (#:key inputs outputs #:allow-other-keys) + (let ((gn-flags + (list + ;; See tools/gn/docs/cookbook.md and + ;; https://www.chromium.org/developers/gn-build-confi= guration + ;; for usage. Run "./gn args . --list" in the Release + ;; directory for an exhaustive list of supported flag= s. + "is_debug=3Dfalse" + "is_official_build=3Dfalse" + "is_clang=3Dfalse" + "use_gold=3Dfalse" + "linux_use_bundled_binutils=3Dfalse" + "use_custom_libcxx=3Dfalse" + "use_sysroot=3Dfalse" + "goma_dir=3D\"\"" + "enable_precompiled_headers=3Dfalse" + "use_jumbo_build=3Dtrue" ;speeds up build + ;; Use a deterministic version identifier. + "override_build_date=3D\"01 01 2000 05:00:00\"" + "use_unofficial_version_number=3Dfalse" + ;; Disable debugging features to save space. + "remove_webcore_debug_symbols=3Dtrue" + "enable_iterator_debugging=3Dfalse" + ;; Don't fail when using deprecated ffmpeg features. + "treat_warnings_as_errors=3Dfalse" + "enable_nacl=3Dfalse" + "enable_nacl_nonsfi=3Dfalse" + "use_allocator=3D\"none\"" ;don't use tcmalloc + ;; Don't add any API keys. End users can set them in = the + ;; environment if necessary. + ;; https://www.chromium.org/developers/how-tos/api-ke= ys + "use_official_google_api_keys=3Dfalse" + ;; Disable "field trials". + "fieldtrial_testing_like_official_build=3Dtrue" + + "use_system_freetype=3Dtrue" + ;; FIXME: Try enabling this for 63+. + ;;"use_system_harfbuzz=3Dtrue" + "use_system_libjpeg=3Dtrue" + "use_system_lcms2=3Dtrue" + "use_system_zlib=3Dtrue" + ;; This is currently not supported on Linux: + ;; https://bugs.chromium.org/p/chromium/issues/detail= ?id=3D22208 + ;; "use_system_sqlite=3Dtrue" + "use_gconf=3Dfalse" ; deprecated by gsettings + "use_gnome_keyring=3Dfalse" ; deprecated by libsecret + "use_gtk3=3Dtrue" + "use_openh264=3Dtrue" + "use_xkbcommon=3Dtrue" + "link_pulseaudio=3Dtrue" + + ;; Don't arbitrarily restrict formats supported by sy= stem ffmpeg. + "proprietary_codecs=3Dtrue" + "ffmpeg_branding=3D\"Chrome\"" + + ;; WebRTC stuff. + "rtc_use_h264=3Dtrue" + ;; Don't use bundled sources. + "rtc_build_json=3Dfalse" + "rtc_build_libevent=3Dfalse" + "rtc_build_libvpx=3Dfalse" + "rtc_build_opus=3Dfalse" + "rtc_build_ssl=3Dfalse" + ;; TODO: Package these. + "rtc_build_libsrtp=3Dtrue" ; 2.0 + "rtc_build_libyuv=3Dtrue" + "rtc_build_openmax_dl=3Dtrue" + "rtc_build_usrsctp=3Dtrue" + (string-append "rtc_jsoncpp_root=3D\"" + (assoc-ref inputs "jsoncpp") + "/include/jsoncpp/json\"") + (string-append "rtc_ssl_root=3D\"" + (assoc-ref inputs "openssl") + "/include/openssl\"")))) + + ;; XXX: How portable is this. + (mkdir-p "third_party/node/linux/node-linux-x64") + (symlink (string-append (assoc-ref inputs "node") "/bin") + "third_party/node/linux/node-linux-x64/bin") + + (setenv "CC" "gcc") + (setenv "CXX" "g++") + ;; TODO: pre-compile instead. Avoids a race condition. + (setenv "PYTHONDONTWRITEBYTECODE" "1") + (and + ;; Build the "gn" tool. + (zero? (system* "python" + "tools/gn/bootstrap/bootstrap.py" "-s" "-v= ")) + ;; Generate ninja build files. + (zero? (system* "./out/Release/gn" "gen" "out/Release" + (string-append "--args=3D" + (string-join gn-flags " "))= )))))) + (replace 'build + (lambda* (#:key outputs #:allow-other-keys) + (zero? (system* "ninja" "-C" "out/Release" + "-j" (number->string (parallel-job-count)) + "chrome")))) + (replace 'install + (lambda* (#:key inputs outputs #:allow-other-keys) + (let* ((out (assoc-ref outputs "out")) + (bin (string-append out "/bin")) + (exe (string-append bin "/chromium")) + (lib (string-append out "/lib")) + (man (string-append out "/share/man/man1")) + (applications (string-append out "/share/application= s")) + (install-regexp (make-regexp "\\.(bin|pak)$")) + (locales (string-append lib "/locales")) + (resources (string-append lib "/resources")) + (gtk+ (assoc-ref inputs "gtk+")) + (mesa (assoc-ref inputs "mesa")) + (nss (assoc-ref inputs "nss")) + (udev (assoc-ref inputs "udev")) + (sh (which "sh"))) + + (substitute* '("chrome/app/resources/manpage.1.in" + "chrome/installer/linux/common/desktop.templ= ate") + (("@@MENUNAME@@") "Chromium") + (("@@PACKAGE@@") "chromium") + (("/usr/bin/@@USR_BIN_SYMLINK_NAME@@") exe)) + (mkdir-p man) + (copy-file "chrome/app/resources/manpage.1.in" + (string-append man "/chromium.1")) + (mkdir-p applications) + (copy-file "chrome/installer/linux/common/desktop.template" + (string-append applications "/chromium.desktop")) + + (with-directory-excursion "out/Release" + (for-each (lambda (file) + (install-file file lib)) + (scandir "." (cut regexp-exec install-regexp <>= ))) + (copy-file "chrome" (string-append lib "/chromium")) + + ;; TODO: Install icons from "../../chrome/app/themes" into + ;; "out/share/icons/hicolor/$size". + (install-file + "product_logo_48.png" + (string-append out "/share/icons/48x48/chromium.png")) + + (copy-recursively "locales" locales) + (copy-recursively "resources" resources) + + (mkdir-p bin) + ;; Add a thin wrapper to prevent the user from inadverten= tly + ;; installing non-free software through the Web Store. + ;; TODO: Discover extensions from the profile and pass + ;; something like "--disable-extensions-except=3D...". + (call-with-output-file exe + (lambda (port) + (format port + "#!~a~@ + if [ -z \"$CHROMIUM_ENABLE_WEB_STORE\" ]~@ + then~@ + CHROMIUM_FLAGS=3D\" \\~@ + --disable-background-networking \\~@ + --disable-extensions \\~@ + \"~@ + fi~@ + exec ~a $CHROMIUM_FLAGS \"$@\"~%" + sh (string-append lib "/chromium")))) + (chmod exe #o755) + + (wrap-program exe + ;; TODO: Get these in RUNPATH. + `("LD_LIBRARY_PATH" ":" prefix + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib:" + mesa "/lib:" udev "/lib"))) + ;; Avoid file manager crash. See . + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/sh= are")))) + #t))))))) + (native-inputs + `(("bison" ,bison) + ("git" ,git) ;last_commit_position.py + ("gperf" ,gperf) + ("ninja" ,ninja) + ("node" ,node) + ("pkg-config" ,pkg-config) + ("which" ,which) + ("yasm" ,yasm) + + ("python-beautifulsoup4" ,python2-beautifulsoup4) + ("python-html5lib" ,python2-html5lib) + ("python" ,python-2))) + (inputs + `(("alsa-lib" ,alsa-lib) + ("atk" ,atk) + ("cups" ,cups) + ("curl" ,curl) + ("dbus" ,dbus) + ("dbus-glib" ,dbus-glib) + ("expat" ,expat) + ("flac" ,flac) + ("ffmpeg" ,ffmpeg) + ("fontconfig" ,fontconfig) + ("freetype" ,freetype) + ("gdk-pixbuf" ,gdk-pixbuf) + ("glib" ,glib) + ("gtk+-2" ,gtk+-2) + ("gtk+" ,gtk+) + ("harfbuzz" ,harfbuzz) + ("icu4c" ,icu4c-59.1) + ("jsoncpp" ,jsoncpp) + ("lcms" ,lcms) + ("libevent" ,libevent) + ("libffi" ,libffi) + ("libjpeg-turbo" ,libjpeg-turbo) + ("libpng" ,libpng) + ("libusb" ,libusb) + ("libvpx" ,libvpx+experimental) + ("libwebp" ,libwebp) + ("libx11" ,libx11) + ("libxcb" ,libxcb) + ("libxcomposite" ,libxcomposite) + ("libxcursor" ,libxcursor) + ("libxdamage" ,libxdamage) + ("libxext" ,libxext) + ("libxfixes" ,libxfixes) + ("libxi" ,libxi) + ("libxkbcommon" ,libxkbcommon) + ("libxml2" ,libxml2) + ("libxrandr" ,libxrandr) + ("libxrender" ,libxrender) + ("libxscrnsaver" ,libxscrnsaver) + ("libxslt" ,libxslt) + ("libxtst" ,libxtst) + ("mesa" ,mesa) + ("minizip" ,minizip) + ("mit-krb5" ,mit-krb5) + ("nss" ,nss) + ("openh264" ,openh264) + ("openssl" ,openssl) + ("opus" ,opus+custom) + ("pango" ,pango) + ("pciutils" ,pciutils) + ("protobuf" ,protobuf) + ("pulseaudio" ,pulseaudio) + ("re2" ,re2) + ("snappy" ,snappy) + ("speech-dispatcher" ,speech-dispatcher) + ("sqlite" ,sqlite) + ("udev" ,eudev) + ("valgrind" ,valgrind))) + (home-page "https://www.chromium.org/") + (description + "Chromium is a web browser using the @code{Blink} rendering engine.") + ;; Chromium is developed as BSD-3, but bundles a large number of third= -party + ;; software with other licenses. For full information, see chrome://cr= edits. + (license (list license:bsd-3 + license:bsd-2 + license:expat + license:asl2.0 + license:mpl2.0 + license:public-domain + license:lgpl2.1+)))) =2D-=20 2.15.1 --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlpT6QoACgkQoqBt8qM6 VPpUtwgAq+kfYJHXhUn4kFeWpKffMt3woWyztcTHYrKaoqGIwpnR41+/tom/8yf2 qsdcmoD7p632w/ZrFtuDKhq28IriFi0cHZqmnacZU2Y1/9+UlQf7DmQYO2RdV5Rl RNlAFVSO+vhuAzMTwhXePAg1vDHWUGpF/vuy6GTyzhehoG/bKIY+t0xIaAL4ViBI 6/Lw/Fh/+QfCruGHs4x58sG0CMQM38xdrsK4hQS/ywX1Sz0zPSzckXlnthb0E18q VzHqBAh80EOGZ3NubX9u46gW0d+n4vlgtGlY4RirUBJ3TZKVsrN604bpV+LNSs4p pY7dXovy62hkYISj0J3Ax3e3ZbrOTg== =u9L2 -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Mon Jan 08 18:21:12 2018 Received: (at 28004) by debbugs.gnu.org; 8 Jan 2018 23:21:12 +0000 Received: from localhost ([127.0.0.1]:41880 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eYgj1-0002eu-Ev for submit@debbugs.gnu.org; Mon, 08 Jan 2018 18:21:12 -0500 Received: from aibo.runbox.com ([91.220.196.211]:37208) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eYgiu-0002e1-1q for 28004@debbugs.gnu.org; Mon, 08 Jan 2018 18:21:02 -0500 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit03.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1eYgio-00013T-5r; Tue, 09 Jan 2018 00:20:50 +0100 Received: from dslb-178-001-037-057.178.001.pools.vodafone-ip.de ([178.1.37.57] helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1eYgih-0000Dd-UT; Tue, 09 Jan 2018 00:20:45 +0100 Date: Mon, 8 Jan 2018 23:20:42 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180108232042.nqjurjr2bcfl2yyc@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="iszsxhleyobozczu" Content-Disposition: inline In-Reply-To: <87wp0s2ewl.fsf@fastmail.com> X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Ludovic =?utf-8?Q?Court=C3=A8s?= , ng0 , Leo Famulari X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.0 (/) --iszsxhleyobozczu Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 39K bytes: > ng0 writes: >=20 > >> + (substitute* "chrome/common/chrome_paths.cc" > >> + (("/usr/share/chromium/extensions") > >> + ;; TODO: Add ~/.guix-profile. > >> + "/run/current-system/profile/share/chromium/extension= s")) > > > > What's the idea behind this? Did you test it? Do you have any guix buil= d-system > > using Chromium extensions as an example? So far this completely disable= s the > > installation of any plugins and addons. >=20 > The idea is to eventually be able to distribute extensions with Guix. I > added this path mostly to document it, but don't see how keeping the > default makes a difference. If you can place an extension in > /usr/share, you can also copy it to the system profile through your > config.scm, or symlink this location on a foreign distribution. >=20 > >> + (mkdir-p bin) > >> + ;; Add a thin wrapper to prevent the user from inadv= ertently > >> + ;; installing non-free software through the Web Stor= e. > >> + ;; TODO: Discover extensions from the profile and pa= ss > >> + ;; something like "--disable-extensions-except=3D...= ". > > > > Same question here. >=20 > The Web Store has serious freedom issues, thus we can not enable it by > default. Enabling it *must* be a conscious choice by the end user. >=20 > The TODO here is inspired by Debians wrapper script, which enumerates > the location where apt places extensions, and gives that list to > "--disable-extensions-except". >=20 > > If you need help, there's at least 3 users of Chromium now. I'd like to= read Actually more than 3: I have to make chromium accessible for work we agreed on in GNU Taler (where the "How should we package extensions in a way that works" comes in important, not just as a PoC/TODO). > > your ideas on how to solve the TODOs, aswell as: Do you have any unpush= ed > > progress? Maybe we can team collaborate on this huge browser. >=20 > I do maintain this patch, but unfortunately not in a public repository. Ah, ok. > I've attached the latest iteration here (sorry for squashed). Thanks > New since the last time are some fixes from the "Inox patchset" that > resolves most of the privacy issues. Namely removing the "login > wizard", changing to sensible defaults, and forcing the "classic" New > Tab Page that does not load a search engine. Cool! > Also, all patches have been moved to remote origins. >=20 > Testing and feedback welcome! I'll build it tomorrow or tonight (whenever my build of linux-mainline to search for fixes for the i915 issue finishes) and report back. So far I'um using your version 58and it works for me :) > Currently there are two "important" (blocking?) TODOs left: >=20 > * Move the 'delete-bundled-software' phase to a source snippet. > Repacking the ~500MiB compressed tarball is *really* expensive. It Yep. It takes a verrry long time, I've noticed this when I started working on Chromium. > should also aid the licensing situation. > * Delete the two default entries from the "most used" list on the New > Tab page. The first run will download thumbnails for these sites, > leaking data. One of them also leads to the disabled-by-default > store, promoting non-free software. >=20 > I'm optimistic that fixing the second item will make the browser not > leak *any* data at launch with the default configuration. Which leads > to a third item: writing a system test that verifies that launching > Chromium does indeed not initiate any network traffic. >=20 > Anyway, here is the latest patch: >=20 > From f813b2d7ec0728a906720fa74bf9f442af6ab10d Mon Sep 17 00:00:00 2001 > From: Marius Bakke > Date: Wed, 12 Oct 2016 17:25:05 +0100 > Subject: [PATCH] gnu: Add chromium. >=20 > * gnu/packages/chromium.scm: New file. > * gnu/local.mk: Record it. > --- > gnu/local.mk | 1 + > gnu/packages/chromium.scm | 733 ++++++++++++++++++++++++++++++++++++++++= ++++++ > 2 files changed, 734 insertions(+) > create mode 100644 gnu/packages/chromium.scm >=20 > diff --git a/gnu/local.mk b/gnu/local.mk > index d4e841921..529fdd2be 100644 > --- a/gnu/local.mk > +++ b/gnu/local.mk > @@ -89,6 +89,7 @@ GNU_SYSTEM_MODULES =3D \ > %D%/packages/check.scm \ > %D%/packages/chemistry.scm \ > %D%/packages/chez.scm \ > + %D%/packages/chromium.scm \ > %D%/packages/ci.scm \ > %D%/packages/cinnamon.scm \ > %D%/packages/cmake.scm \ > diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm > new file mode 100644 > index 000000000..78cfb3097 > --- /dev/null > +++ b/gnu/packages/chromium.scm > @@ -0,0 +1,733 @@ > +;;; GNU Guix --- Functional package management for GNU > +;;; Copyright =C2=A9 2016, 2017 Marius Bakke > +;;; > +;;; This file is part of GNU Guix. > +;;; > +;;; GNU Guix is free software; you can redistribute it and/or modify it > +;;; under the terms of the GNU General Public License as published by > +;;; the Free Software Foundation; either version 3 of the License, or (at > +;;; your option) any later version. > +;;; > +;;; GNU Guix is distributed in the hope that it will be useful, but > +;;; WITHOUT ANY WARRANTY; without even the implied warranty of > +;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the > +;;; GNU General Public License for more details. > +;;; > +;;; You should have received a copy of the GNU General Public License > +;;; along with GNU Guix. If not, see . > + > +(define-module (gnu packages chromium) > + #:use-module ((guix licenses) #:prefix license:) > + #:use-module (guix packages) > + #:use-module (guix download) > + #:use-module (guix git-download) > + #:use-module (guix utils) > + #:use-module (guix build-system gnu) > + #:use-module (gnu packages) > + #:use-module (gnu packages assembly) > + #:use-module (gnu packages base) > + #:use-module (gnu packages bison) > + #:use-module (gnu packages compression) > + #:use-module (gnu packages cups) > + #:use-module (gnu packages curl) > + #:use-module (gnu packages databases) > + #:use-module (gnu packages fontutils) > + #:use-module (gnu packages ghostscript) > + #:use-module (gnu packages gl) > + #:use-module (gnu packages glib) > + #:use-module (gnu packages gnome) > + #:use-module (gnu packages gnuzilla) > + #:use-module (gnu packages gperf) > + #:use-module (gnu packages gtk) > + #:use-module (gnu packages icu4c) > + #:use-module (gnu packages image) > + #:use-module (gnu packages libevent) > + #:use-module (gnu packages libffi) > + #:use-module (gnu packages libusb) > + #:use-module (gnu packages linux) > + #:use-module (gnu packages kerberos) > + #:use-module (gnu packages ninja) > + #:use-module (gnu packages node) > + #:use-module (gnu packages pciutils) > + #:use-module (gnu packages photo) > + #:use-module (gnu packages pkg-config) > + #:use-module (gnu packages protobuf) > + #:use-module (gnu packages pulseaudio) > + #:use-module (gnu packages python) > + #:use-module (gnu packages python-web) > + #:use-module (gnu packages regex) > + #:use-module (gnu packages serialization) > + #:use-module (gnu packages speech) > + #:use-module (gnu packages tls) > + #:use-module (gnu packages valgrind) > + #:use-module (gnu packages version-control) > + #:use-module (gnu packages video) > + #:use-module (gnu packages xiph) > + #:use-module (gnu packages xml) > + #:use-module (gnu packages xdisorg) > + #:use-module (gnu packages xorg)) > + > +(define (strip-directory-prefix pathspec) > + "Return everything after the last '/' in PATHSPEC." > + (let ((index (string-rindex pathspec #\/))) > + (if index (string-drop pathspec (+ 1 index)) > + pathspec))) > + > +(define (chromium-patch-file-name pathspec) > + (let ((patch-name (strip-directory-prefix pathspec))) > + (if (string-prefix? "chromium-" patch-name) > + patch-name > + (string-append "chromium-" patch-name)))) > + > +;; https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/tree/de= bian/patches > +(define (debian-patch pathspec revision hash) > + (origin > + (method url-fetch) > + (uri (string-append > + "https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git" > + "/plain/debian/patches/" pathspec "?id=3D" revision)) > + (sha256 (base32 hash)) > + (file-name (chromium-patch-file-name pathspec)))) > + > +;; https://gitweb.gentoo.org/repo/gentoo.git/tree/www-client/chromium/fi= les > +(define (gentoo-patch pathspec revision hash) > + (origin > + (method url-fetch) > + (uri (string-append > + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-client" > + "/chromium/files/" pathspec "?id=3D" revision)) > + (sha256 (base32 hash)) > + (file-name (chromium-patch-file-name pathspec)))) > + > +;; https://github.com/gcarq/inox-patchset > +(define (inox-patch pathspec revision hash) > + (origin > + (method url-fetch) > + (uri (string-append "https://raw.githubusercontent.com/gcarq/inox-pa= tchset/" > + revision "/" pathspec)) > + (sha256 (base32 hash)) > + (file-name (chromium-patch-file-name pathspec)))) > + > +(define opus+custom > + (package (inherit opus) > + (arguments > + `(;; Opus Custom is an optional extension of the Opus > + ;; specification that allows for unsupported frame > + ;; sizes. Chromium requires that this is enabled. > + #:configure-flags '("--enable-custom-modes") > + ,@(package-arguments opus))))) > + > +;; Chromium since 58 depends on an unreleased libvpx. So, we > +;; package the latest master branch as of 2018-01-07. > +(define libvpx+experimental > + (package > + (inherit libvpx) > + (source (origin > + (method git-fetch) > + (uri (git-reference > + (url "https://chromium.googlesource.com/webm/libvpx") > + (commit "bed28a55f593efd3a71a3a9d05cf8bb25d15fa44"))) > + (file-name "libvpx-for-chromium-checkout") > + (sha256 > + (base32 > + "0h01vmb8awzrb2xwqaz215v73yjdjf67hzdm2yfcz4h4qrvwf817"))= )) > + ;; TODO: Make libvpx configure flags overrideable. > + (arguments > + `(#:phases > + (modify-phases %standard-phases > + (replace 'configure > + (lambda* (#:key outputs #:allow-other-keys) > + (setenv "CONFIG_SHELL" (which "bash")) > + (let ((out (assoc-ref outputs "out"))) > + (setenv "LDFLAGS" > + (string-append "-Wl,-rpath=3D" out "/lib")) > + (zero? (system* "./configure" > + "--enable-shared" > + "--as=3Dyasm" > + ;; Limit size to avoid CVE-2015-1258 > + "--size-limit=3D16384x16384" > + ;; Spatial SVC is an experimental VP9 enc= oder > + ;; used by some packages (i.e. Chromium). > + "--enable-experimental" > + "--enable-spatial-svc" > + (string-append "--prefix=3D" out))))))) > + #:tests? #f)))) ; No tests. > + > +(define %chromium-gn-bootstrap.patch > + (gentoo-patch "chromium-gn-bootstrap-r17.patch" > + "5c9cf110bd61fa287a5c536760b5d8ed13f65d52" > + "12wsq3bs46mvr7cinxvqjmbzymigm8yzf478r08y9l6sd3qij4yq")) > + > +(define %chromium-gcc-compat.patch > + (gentoo-patch "chromium-gcc5-r4.patch" > + "1c5423aab094796b3da7a2905f02cbdcdd6a7742" > + "18s152pkqzzw6grxj1m6mp3pc2x3ha2gyayw5hf2nhranak5wlkg")) > + > +(define %chromium-webkit-gcc-compat.patch > + (gentoo-patch "chromium-gcc5-r5.patch" > + "1c5423aab094796b3da7a2905f02cbdcdd6a7742" > + "0z7rggizzg85wfr8zhw0yfwd3q69lsh3yp297s939jgzp66cwwkw")) > + > +(define %chromium-webrtc-gcc-compat.patch > + (gentoo-patch "chromium-webrtc-r0.patch" > + "1c5423aab094796b3da7a2905f02cbdcdd6a7742" > + "0qj5b4w9kav51ylpdf38vm5w7p2gx4qp8p45vrfggp7miicg9cmw")) > + > +(define %chromium-system-nspr.patch > + (debian-patch "system/nspr.patch" > + "debian/63.0.3239.40-1" > + "07a0q3khz77gk0rxzp965pjzhly5r08k019pinss18xc1caj971s")) > + > +(define %chromium-system-libevent.patch > + (debian-patch "system/event.patch" > + "debian/63.0.3239.40-1" > + "0604ia06w40zn66d85in03xg3hd6144y8b222kzyc9nzhq3xm2pc")) > + > +(define %chromium-system-icu.patch > + (debian-patch "system/icu.patch" > + "debian/63.0.3239.40-1" > + "0kf77d8lyma3w0xpgfv2k0c741zp6ii08gzllfja6d5s59c15ylv")) > + > +(define %chromium-disable-api-keys-warning.patch > + (debian-patch "disable/google-api-warning.patch" > + "36794e57f1f97068640c6845dbeb9291155893c0" > + "11llghxm0a75kb8fnpy6ky8ix4f1kk7n0c0zfcpwxsx05pask11m")) > + > +(define %chromium-external-components.patch > + (debian-patch "disable/external-components.patch" > + "debian/63.0.3239.40-1" > + "1i3b801hjafxv7djk7cl7nj2skxid0vysf12yjr364db949f164l")) > + > +(define %chromium-duckduckgo.patch > + (inox-patch "0011-add-duckduckgo-search-engine.patch" > + "5af0e6187c22471b8cb803f6dda6738f23a530e7" > + "0p8x98g71ngkd3wbl5q36wrl18ff185sfrr5fcwjbgrv3v7r6ra7")) > + > +;; Don't start a "Login Wizard" at first launch. > +(define %chromium-first-run.patch > + (inox-patch "0018-disable-first-run-behaviour.patch" > + "3336bb286ea054271ac2199cf374e96c64ed53cf" > + "1y4zsqqf2125jkb1phwy9g5hcbd9xhyv5lr4xcaly66rpdzx2ayb")) > + > +;; Use privacy-preserving defaults. > +(define %chromium-default-preferences.patch > + (inox-patch "0006-modify-default-prefs.patch" > + "3336bb286ea054271ac2199cf374e96c64ed53cf" > + "1h8ycmn00yvciq3r5jcdqmsl4grqv8izgwi6a20kijz2baxxr888")) > + > +;; Recent versions of Chromium may load a remote search engine on the > +;; New Tab Page, causing unnecessary and involuntary network traffic. > +(define %chromium-restore-classic-ntp.patch > + (inox-patch "0008-restore-classic-ntp.patch" > + "2f60b788bff89bde11ac802d4c19093661cd23f7" > + "00icvb0r1p3s7i2xy8kv1lpam96cxgn6c3s9bc6wv3dpi3d722p2")) > + > +(define-public chromium > + (package > + (name "chromium") > + (version "63.0.3239.132") > + (synopsis "Graphical web browser") > + (source (origin > + (method url-fetch) > + (uri (string-append "https://commondatastorage.googleapis.= com/" > + "chromium-browser-official/chromium-" > + version ".tar.xz")) > + (sha256 > + (base32 > + "139x3cbc5pa14x69493ic8i2ank12c9fwiq6pqm11aps88n6ri44")) > + (patches (list ;%chromium-gn-bootstrap.patch > + %chromium-gcc-compat.patch > + %chromium-webkit-gcc-compat.patch > + %chromium-webrtc-gcc-compat.patch > + %chromium-duckduckgo.patch > + %chromium-default-preferences.patch > + %chromium-first-run.patch > + %chromium-restore-classic-ntp.patch > + %chromium-system-icu.patch > + %chromium-system-nspr.patch > + %chromium-system-libevent.patch > + %chromium-disable-api-keys-warning.patch)) > + (modules '((srfi srfi-1) > + (guix build utils))) > + (snippet > + '(begin > + ;; Replace GN files from third_party with shims for bu= ilding > + ;; against system libraries. Keep this list in sync w= ith > + ;; "build/linux/unbundle/replace_gn_files.py". > + (for-each (lambda (pair) > + (let ((source (string-append > + "build/linux/unbundle/" (ca= r pair))) > + (dest (cdr pair))) > + (copy-file source dest))) > + (list > + '("ffmpeg.gn" . "third_party/ffmpeg/BUILD.g= n") > + '("flac.gn" . "third_party/flac/BUILD.gn") > + '("freetype.gn" . "third_party/freetype/BUI= LD.gn") > + ;; XXX: This broke in 63. > + ;;'("harfbuzz-ng.gn" . "third_party/harfbuz= z-ng/BUILD.gn") > + '("icu.gn" . "third_party/icu/BUILD.gn") > + '("libdrm.gn" . "third_party/libdrm/BUILD.g= n") > + '("libevent.gn" . "base/third_party/libeven= t/BUILD.gn") > + '("libjpeg.gn" . > + "build/secondary/third_party/libjpeg_turb= o/BUILD.gn") > + '("libpng.gn" . "third_party/libpng/BUILD.g= n") > + '("libvpx.gn" . "third_party/libvpx/BUILD.g= n") > + '("libwebp.gn" . "third_party/libwebp/BUILD= =2Egn") > + ;;'("libxml.gn" . "third_party/libxml/BUILD= =2Egn") ;TODO > + '("libxslt.gn" . "third_party/libxslt/BUILD= =2Egn") > + '("openh264.gn" . "third_party/openh264/BUI= LD.gn") > + '("opus.gn" . "third_party/opus/BUILD.gn") > + '("re2.gn" . "third_party/re2/BUILD.gn") > + '("snappy.gn" . "third_party/snappy/BUILD.g= n") > + '("yasm.gn" . "third_party/yasm/yasm_assemb= le.gni") > + '("zlib.gn" . "third_party/zlib/BUILD.gn"))) > + #t)))) > + (build-system gnu-build-system) > + (arguments > + `(#:tests? #f > + ;; FIXME: There is a "gn" option specifically for setting -rpath,= but > + ;; it's not recognized when passed. > + #:validate-runpath? #f > + #:modules ((srfi srfi-26) > + (ice-9 ftw) > + (ice-9 regex) > + (guix build gnu-build-system) > + (guix build utils)) > + #:phases > + (modify-phases %standard-phases > + (add-after 'unpack 'remove-bundled-software > + (lambda _ > + (let ((keep-libs > + (list > + ;; Third party folders that cannot be deleted yet. > + "base/third_party/dmg_fp" > + "base/third_party/dynamic_annotations" > + "base/third_party/icu" > + "base/third_party/libevent" > + "base/third_party/nspr" > + "base/third_party/superfasthash" > + "base/third_party/symbolize" ; glog > + "base/third_party/xdg_mime" > + "base/third_party/xdg_user_dirs" > + "buildtools/third_party/libc++" > + "chrome/third_party/mozilla_security_manager" > + "courgette/third_party" > + "net/third_party/mozilla_security_manager" > + "net/third_party/nss" > + "third_party/adobe/flash/flapper_version.h" > + ;; FIXME: This is used in: > + ;; * ui/webui/resources/js/analytics.js > + ;; * ui/file_manager/ > + "third_party/analytics" > + "third_party/angle" > + "third_party/angle/src/common/third_party/base" > + "third_party/angle/src/common/third_party/smhasher" > + "third_party/angle/src/third_party/compiler" > + "third_party/angle/src/third_party/libXNVCtrl" > + "third_party/angle/src/third_party/trace_event" > + "third_party/blink" > + "third_party/boringssl" > + "third_party/breakpad" > + "third_party/brotli" > + "third_party/cacheinvalidation" > + "third_party/catapult" > + "third_party/catapult/common/py_vulcanize/third_par= ty/rcssmin" > + "third_party/catapult/common/py_vulcanize/third_par= ty/rjsmin" > + "third_party/catapult/third_party/polymer" > + "third_party/catapult/tracing/third_party/d3" > + "third_party/catapult/tracing/third_party/gl-matrix" > + "third_party/catapult/tracing/third_party/jszip" > + "third_party/catapult/tracing/third_party/mannwhitn= eyu" > + "third_party/catapult/tracing/third_party/oboe" > + "third_party/catapult/tracing/third_party/pako" > + "third_party/ced" > + "third_party/cld_3" > + "third_party/crc32c" > + "third_party/cros_system_api" > + "third_party/dom_distiller_js" > + "third_party/fips181" > + "third_party/flatbuffers" > + ;; XXX Needed by pdfium since 59. > + "third_party/freetype" > + "third_party/glslang-angle" > + "third_party/google_input_tools" > + "third_party/google_input_tools/third_party/closure= _library" > + (string-append "third_party/google_input_tools/thir= d_party" > + "/closure_library/third_party/closur= e") > + "third_party/googletest" > + "third_party/harfbuzz-ng" ;XXX why is this required= in 63+ > + "third_party/hunspell" > + "third_party/iccjpeg" > + "third_party/inspector_protocol" > + "third_party/jinja2" > + "third_party/jstemplate" > + "third_party/khronos" > + "third_party/leveldatabase" > + "third_party/libXNVCtrl" > + "third_party/libaddressinput" > + "third_party/libjingle_xmpp" > + "third_party/libphonenumber" > + "third_party/libsecret" ;FIXME: needs pkg-config su= pport. > + "third_party/libsrtp" ;TODO: Requires libsrtp@2. > + "third_party/libudev" > + "third_party/libwebm" > + "third_party/libxml" ;FIXME: Unbundle (again). > + "third_party/libyuv" > + "third_party/lss" > + "third_party/lzma_sdk" > + "third_party/markupsafe" > + "third_party/mesa" > + "third_party/modp_b64" > + "third_party/mt19937ar" > + "third_party/node" > + "third_party/node/node_modules/polymer-bundler/lib/= third_party/UglifyJS2" > + "third_party/openmax_dl" > + "third_party/ots" > + "third_party/pdfium" > + "third_party/pdfium/third_party" > + "third_party/ply" > + "third_party/polymer" > + "third_party/protobuf" > + "third_party/protobuf/third_party/six" > + "third_party/qcms" > + "third_party/sfntly" > + "third_party/skia" > + "third_party/skia/third_party/vulkan" > + "third_party/skia/third_party/gif" > + "third_party/smhasher" > + "third_party/speech-dispatcher" > + "third_party/spirv-headers" > + "third_party/spirv-tools-angle" > + "third_party/sqlite" > + "third_party/swiftshader" > + "third_party/swiftshader/third_party" > + "third_party/usb_ids" > + "third_party/usrsctp" > + "third_party/vulkan" > + "third_party/vulkan-validation-layers" > + "third_party/WebKit" > + "third_party/web-animations-js" > + "third_party/webrtc" > + "third_party/widevine/cdm/widevine_cdm_version.h" > + "third_party/widevine/cdm/widevine_cdm_common.h" > + "third_party/woff2" > + "third_party/xdg-utils" > + "third_party/yasm/run_yasm.py" > + "third_party/zlib/google" > + "url/third_party/mozilla" > + "v8/src/third_party/valgrind" > + "v8/third_party/inspector_protocol"))) > + ;; FIXME: implement as source snippet. This traverses > + ;; any "third_party" directory and deletes files that are: > + ;; * not ending with ".gn" or ".gni"; or > + ;; * not explicitly named as argument (folder or file). > + (zero? (apply system* "python" > + "build/linux/unbundle/remove_bundled_librar= ies.py" > + "--do-remove" keep-libs))))) > + (add-after 'remove-bundled-software 'patch-stuff > + (lambda* (#:key inputs #:allow-other-keys) > + (substitute* "printing/cups_config_helper.py" > + (("cups_config =3D.*") > + (string-append "cups_config =3D '" (assoc-ref inputs "cu= ps") > + "/bin/cups-config'\n"))) > + > + (substitute* > + '("base/process/launch_posix.cc" > + "base/third_party/dynamic_annotations/dynamic_annotat= ions.c" > + "sandbox/linux/seccomp-bpf/sandbox_bpf.cc" > + "sandbox/linux/services/credentials.cc" > + "sandbox/linux/services/namespace_utils.cc" > + "sandbox/linux/services/syscall_wrappers.cc" > + "sandbox/linux/syscall_broker/broker_host.cc") > + (("include \"base/third_party/valgrind/") "include \"valg= rind/")) > + > + (for-each (lambda (file) > + (substitute* file > + ;; Fix opus include path. > + ;; Do not substitute opus_private.h. > + (("#include \"opus\\.h\"") > + "#include \"opus/opus.h\"") > + (("#include \"opus_custom\\.h\"") > + "#include \"opus/opus_custom.h\"") > + (("#include \"opus_defines\\.h\"") > + "#include \"opus/opus_defines.h\"") > + (("#include \"opus_multistream\\.h\"") > + "#include \"opus/opus_multistream.h\"") > + (("#include \"opus_types\\.h\"") > + "#include \"opus/opus_types.h\""))) > + (append (find-files "third_party/opus/src/celt") > + (find-files "third_party/opus/src/src") > + (find-files (string-append "third_party/w= ebrtc/modules" > + "/audio_coding= /codecs/opus")))) > + > + (substitute* "chrome/common/chrome_paths.cc" > + (("/usr/share/chromium/extensions") > + ;; TODO: Add ~/.guix-profile. > + "/run/current-system/profile/share/chromium/extensions")) > + > + (substitute* > + "third_party/breakpad/breakpad/src/common/linux/libcurl= _wrapper.h" > + (("include \"third_party/curl") "include \"curl")) > + (substitute* "media/base/decode_capabilities.cc" > + (("third_party/libvpx/source/libvpx/") "")) > + > + ;; We don't cross compile most packages, so get rid of the > + ;; unnecessary ARCH-linux-gnu* prefix. > + (substitute* "build/toolchain/linux/BUILD.gn" > + (("aarch64-linux-gnu-") "") > + (("arm-linux-gnueabihf-") "")) > + #t)) > + (replace 'configure > + (lambda* (#:key inputs outputs #:allow-other-keys) > + (let ((gn-flags > + (list > + ;; See tools/gn/docs/cookbook.md and > + ;; https://www.chromium.org/developers/gn-build-con= figuration > + ;; for usage. Run "./gn args . --list" in the Relea= se > + ;; directory for an exhaustive list of supported fl= ags. > + "is_debug=3Dfalse" > + "is_official_build=3Dfalse" > + "is_clang=3Dfalse" > + "use_gold=3Dfalse" > + "linux_use_bundled_binutils=3Dfalse" > + "use_custom_libcxx=3Dfalse" > + "use_sysroot=3Dfalse" > + "goma_dir=3D\"\"" > + "enable_precompiled_headers=3Dfalse" > + "use_jumbo_build=3Dtrue" ;speeds up build > + ;; Use a deterministic version identifier. > + "override_build_date=3D\"01 01 2000 05:00:00\"" > + "use_unofficial_version_number=3Dfalse" > + ;; Disable debugging features to save space. > + "remove_webcore_debug_symbols=3Dtrue" > + "enable_iterator_debugging=3Dfalse" > + ;; Don't fail when using deprecated ffmpeg features. > + "treat_warnings_as_errors=3Dfalse" > + "enable_nacl=3Dfalse" > + "enable_nacl_nonsfi=3Dfalse" > + "use_allocator=3D\"none\"" ;don't use tcmalloc > + ;; Don't add any API keys. End users can set them i= n the > + ;; environment if necessary. > + ;; https://www.chromium.org/developers/how-tos/api-= keys > + "use_official_google_api_keys=3Dfalse" > + ;; Disable "field trials". > + "fieldtrial_testing_like_official_build=3Dtrue" > + > + "use_system_freetype=3Dtrue" > + ;; FIXME: Try enabling this for 63+. > + ;;"use_system_harfbuzz=3Dtrue" > + "use_system_libjpeg=3Dtrue" > + "use_system_lcms2=3Dtrue" > + "use_system_zlib=3Dtrue" > + ;; This is currently not supported on Linux: > + ;; https://bugs.chromium.org/p/chromium/issues/deta= il?id=3D22208 > + ;; "use_system_sqlite=3Dtrue" > + "use_gconf=3Dfalse" ; deprecated by gsettin= gs > + "use_gnome_keyring=3Dfalse" ; deprecated by libsecr= et > + "use_gtk3=3Dtrue" > + "use_openh264=3Dtrue" > + "use_xkbcommon=3Dtrue" > + "link_pulseaudio=3Dtrue" > + > + ;; Don't arbitrarily restrict formats supported by = system ffmpeg. > + "proprietary_codecs=3Dtrue" > + "ffmpeg_branding=3D\"Chrome\"" > + > + ;; WebRTC stuff. > + "rtc_use_h264=3Dtrue" > + ;; Don't use bundled sources. > + "rtc_build_json=3Dfalse" > + "rtc_build_libevent=3Dfalse" > + "rtc_build_libvpx=3Dfalse" > + "rtc_build_opus=3Dfalse" > + "rtc_build_ssl=3Dfalse" > + ;; TODO: Package these. > + "rtc_build_libsrtp=3Dtrue" ; 2.0 > + "rtc_build_libyuv=3Dtrue" > + "rtc_build_openmax_dl=3Dtrue" > + "rtc_build_usrsctp=3Dtrue" > + (string-append "rtc_jsoncpp_root=3D\"" > + (assoc-ref inputs "jsoncpp") > + "/include/jsoncpp/json\"") > + (string-append "rtc_ssl_root=3D\"" > + (assoc-ref inputs "openssl") > + "/include/openssl\"")))) > + > + ;; XXX: How portable is this. > + (mkdir-p "third_party/node/linux/node-linux-x64") > + (symlink (string-append (assoc-ref inputs "node") "/bin") > + "third_party/node/linux/node-linux-x64/bin") > + > + (setenv "CC" "gcc") > + (setenv "CXX" "g++") > + ;; TODO: pre-compile instead. Avoids a race condition. > + (setenv "PYTHONDONTWRITEBYTECODE" "1") > + (and > + ;; Build the "gn" tool. > + (zero? (system* "python" > + "tools/gn/bootstrap/bootstrap.py" "-s" "= -v")) > + ;; Generate ninja build files. > + (zero? (system* "./out/Release/gn" "gen" "out/Release" > + (string-append "--args=3D" > + (string-join gn-flags " "= )))))))) > + (replace 'build > + (lambda* (#:key outputs #:allow-other-keys) > + (zero? (system* "ninja" "-C" "out/Release" > + "-j" (number->string (parallel-job-count)) > + "chrome")))) > + (replace 'install > + (lambda* (#:key inputs outputs #:allow-other-keys) > + (let* ((out (assoc-ref outputs "out")) > + (bin (string-append out "/bin")) > + (exe (string-append bin "/chromium")) > + (lib (string-append out "/lib")) > + (man (string-append out "/share/man/man1"= )) > + (applications (string-append out "/share/applicati= ons")) > + (install-regexp (make-regexp "\\.(bin|pak)$")) > + (locales (string-append lib "/locales")) > + (resources (string-append lib "/resources")) > + (gtk+ (assoc-ref inputs "gtk+")) > + (mesa (assoc-ref inputs "mesa")) > + (nss (assoc-ref inputs "nss")) > + (udev (assoc-ref inputs "udev")) > + (sh (which "sh"))) > + > + (substitute* '("chrome/app/resources/manpage.1.in" > + "chrome/installer/linux/common/desktop.tem= plate") > + (("@@MENUNAME@@") "Chromium") > + (("@@PACKAGE@@") "chromium") > + (("/usr/bin/@@USR_BIN_SYMLINK_NAME@@") exe)) > + (mkdir-p man) > + (copy-file "chrome/app/resources/manpage.1.in" > + (string-append man "/chromium.1")) > + (mkdir-p applications) > + (copy-file "chrome/installer/linux/common/desktop.templat= e" > + (string-append applications "/chromium.desktop= ")) > + > + (with-directory-excursion "out/Release" > + (for-each (lambda (file) > + (install-file file lib)) > + (scandir "." (cut regexp-exec install-regexp = <>))) > + (copy-file "chrome" (string-append lib "/chromium")) > + > + ;; TODO: Install icons from "../../chrome/app/themes" i= nto > + ;; "out/share/icons/hicolor/$size". > + (install-file > + "product_logo_48.png" > + (string-append out "/share/icons/48x48/chromium.png")) > + > + (copy-recursively "locales" locales) > + (copy-recursively "resources" resources) > + > + (mkdir-p bin) > + ;; Add a thin wrapper to prevent the user from inadvert= ently > + ;; installing non-free software through the Web Store. > + ;; TODO: Discover extensions from the profile and pass > + ;; something like "--disable-extensions-except=3D...". > + (call-with-output-file exe > + (lambda (port) > + (format port > + "#!~a~@ > + if [ -z \"$CHROMIUM_ENABLE_WEB_STORE\" ]~@ > + then~@ > + CHROMIUM_FLAGS=3D\" \\~@ > + --disable-background-networking \\~@ > + --disable-extensions \\~@ > + \"~@ > + fi~@ > + exec ~a $CHROMIUM_FLAGS \"$@\"~%" > + sh (string-append lib "/chromium")))) > + (chmod exe #o755) > + > + (wrap-program exe > + ;; TODO: Get these in RUNPATH. > + `("LD_LIBRARY_PATH" ":" prefix > + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib= :" > + mesa "/lib:" udev "/lib"))) > + ;; Avoid file manager crash. See . > + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/= share")))) > + #t))))))) > + (native-inputs > + `(("bison" ,bison) > + ("git" ,git) ;last_commit_position.py > + ("gperf" ,gperf) > + ("ninja" ,ninja) > + ("node" ,node) > + ("pkg-config" ,pkg-config) > + ("which" ,which) > + ("yasm" ,yasm) > + > + ("python-beautifulsoup4" ,python2-beautifulsoup4) > + ("python-html5lib" ,python2-html5lib) > + ("python" ,python-2))) > + (inputs > + `(("alsa-lib" ,alsa-lib) > + ("atk" ,atk) > + ("cups" ,cups) > + ("curl" ,curl) > + ("dbus" ,dbus) > + ("dbus-glib" ,dbus-glib) > + ("expat" ,expat) > + ("flac" ,flac) > + ("ffmpeg" ,ffmpeg) > + ("fontconfig" ,fontconfig) > + ("freetype" ,freetype) > + ("gdk-pixbuf" ,gdk-pixbuf) > + ("glib" ,glib) > + ("gtk+-2" ,gtk+-2) > + ("gtk+" ,gtk+) > + ("harfbuzz" ,harfbuzz) > + ("icu4c" ,icu4c-59.1) > + ("jsoncpp" ,jsoncpp) > + ("lcms" ,lcms) > + ("libevent" ,libevent) > + ("libffi" ,libffi) > + ("libjpeg-turbo" ,libjpeg-turbo) > + ("libpng" ,libpng) > + ("libusb" ,libusb) > + ("libvpx" ,libvpx+experimental) > + ("libwebp" ,libwebp) > + ("libx11" ,libx11) > + ("libxcb" ,libxcb) > + ("libxcomposite" ,libxcomposite) > + ("libxcursor" ,libxcursor) > + ("libxdamage" ,libxdamage) > + ("libxext" ,libxext) > + ("libxfixes" ,libxfixes) > + ("libxi" ,libxi) > + ("libxkbcommon" ,libxkbcommon) > + ("libxml2" ,libxml2) > + ("libxrandr" ,libxrandr) > + ("libxrender" ,libxrender) > + ("libxscrnsaver" ,libxscrnsaver) > + ("libxslt" ,libxslt) > + ("libxtst" ,libxtst) > + ("mesa" ,mesa) > + ("minizip" ,minizip) > + ("mit-krb5" ,mit-krb5) > + ("nss" ,nss) > + ("openh264" ,openh264) > + ("openssl" ,openssl) > + ("opus" ,opus+custom) > + ("pango" ,pango) > + ("pciutils" ,pciutils) > + ("protobuf" ,protobuf) > + ("pulseaudio" ,pulseaudio) > + ("re2" ,re2) > + ("snappy" ,snappy) > + ("speech-dispatcher" ,speech-dispatcher) > + ("sqlite" ,sqlite) > + ("udev" ,eudev) > + ("valgrind" ,valgrind))) > + (home-page "https://www.chromium.org/") > + (description > + "Chromium is a web browser using the @code{Blink} rendering engine.= ") > + ;; Chromium is developed as BSD-3, but bundles a large number of thi= rd-party > + ;; software with other licenses. For full information, see chrome://= credits. > + (license (list license:bsd-3 > + license:bsd-2 > + license:expat > + license:asl2.0 > + license:mpl2.0 > + license:public-domain > + license:lgpl2.1+)))) > --=20 > 2.15.1 >=20 Many thanks for your ongoing work with this (and the patience :)) As this is 63, you you are keeping track of Debian, right? I tried to package 64 a couple of days ago because I wanted the workaround for some of the recent security clusterfucks, but Debian is still on 63 :/ I hope they'll update their patchset soon. --=20 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://c.n0.is/ng0_pubkeys/tree/keys WWW: https://n0.is/a/ :: https://ea.n0.is --iszsxhleyobozczu Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlpT/MoACgkQ4i+bv+40 hYjbrQ//Zjn3rfUb3Q59OwOO0JE2rGEzFxTF3jCDI3vqiZSIMNcadFVh9bqovElj kyJSMznAPMt/tysticouvpO4nOe8mnPT15E6+LbYfHM1RIEvp/wlliUQhgGVbPQZ YA/Jn8PNpJmibh8EKVFzqvYH4eYZ7RvRChqPDpaDKTZpl6qjIwHe9lAzX+N8nky/ oSS3d+qYq1f8j3UzhbP/3qGHxkHS+mD/ee0NqrMd8kaQ4jUJ2cZFAlzuWrszaefF gSXw+hTPuXlv0lqGQEV9AFg5nrk86n3o1cNjfAIZpsbC3pZGnJ6mlnzlvdn/wLAm CZ7oeQStZEbvQcFAfsdc5IefZubMSLo+D5ha0toeQpBslmfzORep+3l/6ubN2Dgn q0lidy4mr6YWyTfzoMnBJFnkWyGUnUs8lxXwcizhT719pWNcTmxvgA6LRqIYZbhV ujIFb+VkzcuQw3wsm8Tn7+K8mFuKNS2rwQGKeuuo73IrvPAki4HylxpSJ5rpK2Rk kQTt78OaJbYpB1MfbarIknDJxmMBrLLX8emTwrhZk8BDKcn2WxRE6DT9a5V5Urw1 oBkOLQBT56nyRzRvPEFG5Uvi9uZUZzpJDnALKpU2Of0DE9GUuDWaXWNxcqyB7trc hf87C7YW4EbVE58uksIx2EZUX/QVTgNrOJVQHwM4WyQJSCDNu6M= =Lewy -----END PGP SIGNATURE----- --iszsxhleyobozczu-- From debbugs-submit-bounces@debbugs.gnu.org Mon Jan 08 18:40:15 2018 Received: (at 28004) by debbugs.gnu.org; 8 Jan 2018 23:40:15 +0000 Received: from localhost ([127.0.0.1]:41897 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eYh1a-00038l-Ob for submit@debbugs.gnu.org; Mon, 08 Jan 2018 18:40:14 -0500 Received: from out3-smtp.messagingengine.com ([66.111.4.27]:41361) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eYh1Z-00038d-Ip for 28004@debbugs.gnu.org; Mon, 08 Jan 2018 18:40:14 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 0D02020754; Mon, 8 Jan 2018 18:40:13 -0500 (EST) Received: from frontend1 ([10.202.2.160]) by compute5.internal (MEProxy); Mon, 08 Jan 2018 18:40:13 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=ly+/nCpppfCZ0+ujSwDzK91s4HPYbLSFOiPebTNkOjM=; b=zGvo4T5w XjQc6i0azv9/vDPoe99Cmi7mekkHpxXxZeBd578bn7/Rwy9Dx0GPbsNHe6axdUlR 6XbbhBpD/V/kyMO23AMuuecErYfpPudq1Soh7wJHyZLC0+PbWIw2cdnLBHYOr747 PrNwTv0n+m3aKp9QAXwVVmvLXx09wbk01RUschlm+XKAJBx6Y8FSqKbsG6RDipd6 oHzyvM0ysOC8mc+C8/9TyWPvPqAbeTHUSm4E6nbsGemaTwgTNYIebfHt2V+vTHfk 17okJl29NWaFZAANda1D6ctEzvB9aZP/aXimzGI4IaoYeDQXwqGp/yHbk9UvVryc OmM2/NU7NnBfDA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm1; bh=ly+/nCpppfCZ0+ujSwDzK91s4HPYb LSFOiPebTNkOjM=; b=RbzKRWQUAGKZZQDJoezl4Vc3id0U2b1bCCu4JtNAxWknd cuG5vPPw1OKg3MJDUX+IMBo6AldddSxL05faZ//eK/rydg7W/Recvfar/Tu0y/79 b5h74royFlTKYe8IYcs3LiLNsTA3OVc5DhOUHYhbRUCeMlz3hNbPk30+7fLPCy1h 4BoHzo0z0lxnWAvbmmLQTg97ZYJ9ZYR2pVmbEWSQbTi4ag31MwIy/AB8MszuIO6m EpEP2ETVHIHl5vpfCC+uuJTGI8XbnxHhIq8T/1STMDyKeU85L1sIQIcjY3uJeTyU KjBMI2EXVJaNguvnRj5zTg1q757cd5xoaoJRvQ8mg== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id 86CFE7E300; Mon, 8 Jan 2018 18:40:12 -0500 (EST) From: Marius Bakke To: ng0 Subject: Re: [bug#28004] Chromium In-Reply-To: <20180108232042.nqjurjr2bcfl2yyc@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> User-Agent: Notmuch/0.25.3 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Tue, 09 Jan 2018 00:40:09 +0100 Message-ID: <87vagb3oo6.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --=-=-= Content-Type: text/plain ng0 writes: > Many thanks for your ongoing work with this (and the patience :)) > As this is 63, you you are keeping track of Debian, right? I tried > to package 64 a couple of days ago because I wanted the workaround > for some of the recent security clusterfucks, but Debian is still > on 63 :/ > I hope they'll update their patchset soon. I track the upstream stable branch, which is currently 63. https://www.chromestatus.com/features/schedule (see also for updates) --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlpUAVoACgkQoqBt8qM6 VPok2QgAvDcEaANEPdl0Jmoy2Ds6ZVfs5dkkFNQ1CukK5rcp4SWpnM7kn5GEc+3m qLLFAmzLVpPjL6MVnw6/4FF4NFyZuDjNcfW1PkbMGU6F06dd9dclo3TsdfVvtSmQ qJ8r2uPiOUQgkcxfqt85YUjHbguPvLluusykN5HeuF85w4J8scIJ9l9ZbqJTj0Xz aMd83lx7x3ggd1RToPR5Y4rTHv6AvdQ4R3GQbU/ngnPXhEjSNyVvbGN2Id4PwRyd F7YYX0SgGrEn1P7SPvGfQWdcZfe5xea5BuIZ/3z9FQ9k61J3rU9nUga3FHTH+EGH Ne1FgA3HnXA6CDeUGJ6IZnVLQuxGtw== =DXgb -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Tue Jan 09 01:58:07 2018 Received: (at 28004) by debbugs.gnu.org; 9 Jan 2018 06:58:07 +0000 Received: from localhost ([127.0.0.1]:41994 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eYnrL-0005YB-FG for submit@debbugs.gnu.org; Tue, 09 Jan 2018 01:58:07 -0500 Received: from aibo.runbox.com ([91.220.196.211]:41966) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eYnrK-0005Y1-01 for 28004@debbugs.gnu.org; Tue, 09 Jan 2018 01:58:06 -0500 Received: from [10.9.9.211] (helo=mailfront11.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1eYnrI-0000IO-QY; Tue, 09 Jan 2018 07:58:04 +0100 Received: from dslb-088-078-094-182.088.078.pools.vodafone-ip.de ([88.78.94.182] helo=localhost) by mailfront11.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1eYnrF-0006lP-9E; Tue, 09 Jan 2018 07:58:01 +0100 Date: Tue, 9 Jan 2018 06:58:00 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180109065800.j2gfid7o6a6db2fv@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="q76mfb3shwiuk5qr" Content-Disposition: inline In-Reply-To: <87wp0s2ewl.fsf@fastmail.com> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --q76mfb3shwiuk5qr Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 39K bytes: > Testing and feedback welcome! >=20 > Currently there are two "important" (blocking?) TODOs left: >=20 > * Move the 'delete-bundled-software' phase to a source snippet. > Repacking the ~500MiB compressed tarball is *really* expensive. It > should also aid the licensing situation. > * Delete the two default entries from the "most used" list on the New > Tab page. The first run will download thumbnails for these sites, > leaking data. One of them also leads to the disabled-by-default > store, promoting non-free software. >=20 > I'm optimistic that fixing the second item will make the browser not > leak *any* data at launch with the default configuration. Which leads > to a third item: writing a system test that verifies that launching > Chromium does indeed not initiate any network traffic. >=20 > Anyway, here is the latest patch: >=20 > From f813b2d7ec0728a906720fa74bf9f442af6ab10d Mon Sep 17 00:00:00 2001 > From: Marius Bakke > Date: Wed, 12 Oct 2016 17:25:05 +0100 > Subject: [PATCH] gnu: Add chromium. >=20 > * gnu/packages/chromium.scm: New file. > * gnu/local.mk: Record it. I think you forgot a package: gnu/packages/chromium.scm:664:5: icu4c-59.1: unbound variable --=20 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://c.n0.is/ng0_pubkeys/tree/keys WWW: https://n0.is/a/ :: https://ea.n0.is --q76mfb3shwiuk5qr Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlpUZ/gACgkQ4i+bv+40 hYg+Xw/9HiYWwK9A98bhaH660mjWErXctm2ji130kuet22b/Y7KbyjL/ShmcOB/B Bz7q7QcCTqsU7e1WMlFoIeeBMi7wKcMQxY5EnM7F1DfQkiKpIJF7XhXgPNq/EOHy sHpUiI1pfbvtL+l6MVf7iCyzvveHC/iidt2eZczdAAGMTJoJ8psm3SK/Bg9kb24U Y3o/GyXXpa6jx5hKN65aGlp/Pl8iAtFhzPlgwiHv8FKDzpUjhMKS2nAG53or2CiK fvYwdVrxxkrgxqQnyg8ql42zY+O6YvT+xa26PyQUhnZW18NO2L3hDs6TnqCGB+kv WA+3rjVzpVjMDJpTK1HOfY9YgZx+op7TBBGRujLhexbV32Cuwb3zQgDfRZSHaWN6 nW0lGWrVixNsDE/M0l+liItjh97ogU0kApyOmqKGDrWgo9x4bbglZHhYXMMqRinH nLDvbPVNcmyKe71S92qdzZIPukwYpOCwpDsmZR9HHXdqCDpzOUQXhDb+leJBI2Bq vJUiHB/QEhxn0l/G1xadjNUaLmz/euL7Xo4MGwMc1wikvP/LTGH4GMD3OMMEJ517 3cV1w0bYULL4cBTKIzpZ1SaYEJCDun3b87r57foYXI2lO8gSekCz7ay63VUhq6fj 1ISeqsNrejJSGTfHHaNHqSAxdw/m5K/KOEZtLKIMcMICkfPBS5I= =OSHa -----END PGP SIGNATURE----- --q76mfb3shwiuk5qr-- From debbugs-submit-bounces@debbugs.gnu.org Thu Jan 11 19:03:04 2018 Received: (at 28004) by debbugs.gnu.org; 12 Jan 2018 00:03:04 +0000 Received: from localhost ([127.0.0.1]:52709 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eZmoK-0001Xh-AB for submit@debbugs.gnu.org; Thu, 11 Jan 2018 19:03:04 -0500 Received: from out3-smtp.messagingengine.com ([66.111.4.27]:47531) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eZmoJ-0001Xa-6w for 28004@debbugs.gnu.org; Thu, 11 Jan 2018 19:03:03 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id AA44C207CE; Thu, 11 Jan 2018 19:03:02 -0500 (EST) Received: from frontend1 ([10.202.2.160]) by compute5.internal (MEProxy); Thu, 11 Jan 2018 19:03:02 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=LCeldhoRwd0/iu3AkP0ITg+DDgNp2pvitXAfddBsMgY=; b=NcQqSH6d h3Fp4+leIb+c33yUIUs7EebcoURtdlSZlKZ7kl0UyYYIhII2fsEARm3atFBmAx2j W5h+t268Hc+s29dJE6tIGpJ3S2hkPF9w8F96zbNC5V84LUN8IbsLKJsptwfqUcpM ZX0QwCBm4gSnk09Njxb/WYmWwrZHAr1qeJzti+KzZAiKwyi8F2w+hOsLwU/+TrOC ppryp++QYiJ9AuXIBlAD/8NECQsM06MG5POkZiiBDATwZ1Frme2HLhtB6JmnOl6/ 0Pbmh/nO4rtvOq2CaR7Wu5m/H1Wi4tFgNodiUhPJ8rJ5jpvF/Bxt+2jRnEjjMQPO NXIx1uTbgaATgg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm1; bh=LCeldhoRwd0/iu3AkP0ITg+DDgNp2 pvitXAfddBsMgY=; b=Erdj9J1fASrDdKj5BZG2P+g094SUKnH4q8RG3xKLm4m31 T2gI/bLF857G0U/pPPGHWS0F24jkdoxW+qNV6aU9tGl8S+5jGddrR59F93upOasF gLBfCRbwA+zYFBWsRTkHcCHOSyffNTF4NOj/Ps1jpq1HRKYcgDNMG4gOY6+3ZGge wNWlEpLaBuOQ9iBVUwnDdoZb45zm774mYlkQRsQWWBOlxack/uvcqybUupatvu4t rM7xlk/4/SiR08PC64c437e3vmle9QkMlE6dmLeV1Fqm/zC6cSPXufguCFKSjSTP 3lT3dn2CHljY5jsW+cs00cBm7Sx5OmScBow3NDixQ== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id 388747E3D4; Thu, 11 Jan 2018 19:03:02 -0500 (EST) From: Marius Bakke To: ng0 Subject: Re: [bug#28004] Chromium In-Reply-To: <20180109065800.j2gfid7o6a6db2fv@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180109065800.j2gfid7o6a6db2fv@abyayala> User-Agent: Notmuch/0.26 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Fri, 12 Jan 2018 01:03:00 +0100 Message-ID: <876088eyff.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable ng0 writes: > Marius Bakke transcribed 39K bytes: > >> Testing and feedback welcome! >>=20 >> Currently there are two "important" (blocking?) TODOs left: >>=20 >> * Move the 'delete-bundled-software' phase to a source snippet. >> Repacking the ~500MiB compressed tarball is *really* expensive. It >> should also aid the licensing situation. >> * Delete the two default entries from the "most used" list on the New >> Tab page. The first run will download thumbnails for these sites, >> leaking data. One of them also leads to the disabled-by-default >> store, promoting non-free software. >>=20 >> I'm optimistic that fixing the second item will make the browser not >> leak *any* data at launch with the default configuration. Which leads >> to a third item: writing a system test that verifies that launching >> Chromium does indeed not initiate any network traffic. >>=20 >> Anyway, here is the latest patch: >>=20 > >> From f813b2d7ec0728a906720fa74bf9f442af6ab10d Mon Sep 17 00:00:00 2001 >> From: Marius Bakke >> Date: Wed, 12 Oct 2016 17:25:05 +0100 >> Subject: [PATCH] gnu: Add chromium. >>=20 >> * gnu/packages/chromium.scm: New file. >> * gnu/local.mk: Record it. > > I think you forgot a package: > > gnu/packages/chromium.scm:664:5: icu4c-59.1: unbound variable Indeed. This can now be changed to use the regular "icu4c" package. Tangentially, these kinds of problems are typical with new Chromium releases. In 63 or later, system harfbuzz had to be disabled. If we are going to carry this package, changes like these *will* be normal. Upstream only tests their releases with Clang, and with the bundled versions of packages, regardless of the unbundling script. Not great. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlpX+zQACgkQoqBt8qM6 VPqWtAgAvnDlgruvslsmvlTIZriBXiLl5VCYvD14DNcagotW/7W+BzT4ne5XdLcL 5vEtd0p8hwX2St2FpYGq8FpcKbazLDuA9qWAvFg3bGY8hyHCwLYHXFSHMoodAZbV wlKxTZuXlmEKek0Wn1FNuCgqbh/iDLsf6hJ0fGRzS04EupEwI2IWArhsalKzMSvC tKYynIDSNzMkRgfw6+MJKngqxahVyH31nTjB98RGVm4vYwzvZTKgpkdT9EIIVPIm jBG9DYwedeiSKFIF86ptVfmho/iV8D/XnzTSnCCC/k+tnJToMhK2eghyAshFIG4z Px/idB9WdG/XpMVmBgMfC1eLC01fdw== =4q8R -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Thu Jan 11 19:09:17 2018 Received: (at 28004) by debbugs.gnu.org; 12 Jan 2018 00:09:18 +0000 Received: from localhost ([127.0.0.1]:52719 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eZmuF-0001g6-9A for submit@debbugs.gnu.org; Thu, 11 Jan 2018 19:09:17 -0500 Received: from out3-smtp.messagingengine.com ([66.111.4.27]:58981) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eZmuA-0001ft-K9 for 28004@debbugs.gnu.org; Thu, 11 Jan 2018 19:09:09 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 4160F20C01; Thu, 11 Jan 2018 19:09:06 -0500 (EST) Received: from frontend1 ([10.202.2.160]) by compute5.internal (MEProxy); Thu, 11 Jan 2018 19:09:06 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=EJf8IQV25ppCBxZMuw10TlxSsQPZVk0DqSo/OW2NtDA=; b=TK6LyXyc W7tWBeNukHWngyVO44nUfbefnysBuKVwHW8h2zFq5WTkkWZVhryQcPGcpDHZYZ1Q s2KuJaTfa/H/EsIrnYb3GLrI06P4utd5/CWmQRHz6g8NYKoiCIEt5skANtpX0aqM nKW1jqKikNehkqv0iSAUquCc/stZIFonbrP/BpDN1nQ/7LbbzRq4SEEZH5bwgOJl 1NyWZddc2h7BTW+dRK8qkF7lGFY3hk9kbpd3LK1m/8otHUPUiFyF0zmYhnBOFztn Apc2EHATxvD+cBsIrBrPRNRmqpkNEOWQiPJAH0aDddTfAlksjuEgjkVqqWfelEYk //PTxACnk9BWfA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm1; bh=EJf8IQV25ppCBxZMuw10TlxSsQPZV k0DqSo/OW2NtDA=; b=NmqrxEmbG3Qt1Z3nBBd+kYMAsJBnsUJbGzVR59yX+tsra mq/q2BrPBQoavB7Ng1m8qLkelvMf4WGHAM4Gtcou538zwv3gVd5WqlPJiLrgpazg ycCcj1xQ4rG6FGhBy5orUGKkf/ZgRRhicblUiG8fpLEUFQKmzNFAL7yM5N4aFDZM rraYFG5iwe3I2TJRIEVcu5/AHfE+Y8G5IqzXee5j5Ar/vY3HmJffLjYKYU0sBP0Z 8UcrN5g1XF1nF7oO+RnQ2xbvZe9JH/URca9jSTY9Iy+NyoQNdY/AcOuUeDj8rKKD ogaif9nJEBfpVXtFIjpdFqAkUp9vaT8xMtcevKjVA== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id BA0DC7E30E; Thu, 11 Jan 2018 19:09:05 -0500 (EST) From: Marius Bakke To: ng0 Subject: Re: [bug#28004] Chromium In-Reply-To: <20180108232042.nqjurjr2bcfl2yyc@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> User-Agent: Notmuch/0.26 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Fri, 12 Jan 2018 01:09:04 +0100 Message-ID: <87373cey5b.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Ludovic =?utf-8?Q?Court=C3=A8s?= , ng0 , Leo Famulari X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.0 (/) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain ng0 writes: > Many thanks for your ongoing work with this (and the patience :)) > As this is 63, you you are keeping track of Debian, right? I tried > to package 64 a couple of days ago because I wanted the workaround > for some of the recent security clusterfucks, but Debian is still > on 63 :/ > I hope they'll update their patchset soon. Indeed Google did not add the Spectre mitigation to Chromium 63, even though the latest version was released after the fact. https://xlab.tencent.com/special/spectre/spectre_check.html For reasons that beat me, they only added it to the proprietary Chrome browser, which follows the same version number as Chromium. The attached patch adds Spectre mitigation to the current Chromium release. The patch was pulled from the Chrome 64 branch: --=-=-= Content-Type: text/x-patch Content-Disposition: attachment; filename=0001-gnu-chromium-Add-spectre-mitigation.patch Content-Transfer-Encoding: quoted-printable From=20b011b57f357af97f3a003a3b1c481fc8bd2b869c Mon Sep 17 00:00:00 2001 From: Marius Bakke Date: Thu, 11 Jan 2018 14:36:47 +0100 Subject: [PATCH] gnu: chromium: Add spectre mitigation. * gnu/packages/patches/chromium-spectre-mitigation.patch: New file. * gnu/local.mk (dist_patch_DATA): Register it. * gnu/packages/chromium.scm (chromium)[source]: Use it. =2D-- gnu/local.mk | 1 + gnu/packages/chromium.scm | 3 ++- gnu/packages/patches/chromium-spectre-mitigation.patch | 13 +++++++++++++ 3 files changed, 16 insertions(+), 1 deletion(-) create mode 100644 gnu/packages/patches/chromium-spectre-mitigation.patch diff --git a/gnu/local.mk b/gnu/local.mk index 513f64043..89dab227c 100644 =2D-- a/gnu/local.mk +++ b/gnu/local.mk @@ -575,6 +575,7 @@ dist_patch_DATA =3D \ %D%/packages/patches/ceph-skip-collect-sys-info-test.patch \ %D%/packages/patches/ceph-skip-unittest_blockdev.patch \ %D%/packages/patches/chmlib-inttypes.patch \ + %D%/packages/patches/chromium-spectre-mitigation.patch \ %D%/packages/patches/clang-libc-search-path.patch \ %D%/packages/patches/clang-3.8-libc-search-path.patch \ %D%/packages/patches/clementine-use-openssl.patch \ diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm index dd040527b..1e9dba42e 100644 =2D-- a/gnu/packages/chromium.scm +++ b/gnu/packages/chromium.scm @@ -240,7 +240,8 @@ %chromium-system-icu.patch %chromium-system-nspr.patch %chromium-system-libevent.patch =2D %chromium-disable-api-keys-warning.patch)) + %chromium-disable-api-keys-warning.patch + (search-patch "chromium-spectre-mitigation.pa= tch"))) (modules '((srfi srfi-1) (guix build utils))) (snippet diff --git a/gnu/packages/patches/chromium-spectre-mitigation.patch b/gnu/p= ackages/patches/chromium-spectre-mitigation.patch new file mode 100644 index 000000000..a44a3bce4 =2D-- /dev/null +++ b/gnu/packages/patches/chromium-spectre-mitigation.patch @@ -0,0 +1,13 @@ +diff --git a/content/public/common/content_features.cc b/content/public/co= mmon/content_features.cc +index 43feb76..33a49b8 100644 +--- a/content/public/common/content_features.cc ++++ b/content/public/common/content_features.cc +@@ -308,7 +308,7 @@ +=20 + // http://tc39.github.io/ecmascript_sharedmem/shmem.html + const base::Feature kSharedArrayBuffer{"SharedArrayBuffer", +- base::FEATURE_ENABLED_BY_DEFAULT}; ++ base::FEATURE_DISABLED_BY_DEFAULT}; +=20 + // An experiment to require process isolation for the sign-in origin, + // https://accounts.google.com. Launch bug: https://crbug.com/739418. =2D-=20 2.15.1 --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlpX/KAACgkQoqBt8qM6 VPp9Ugf9EcLGWsYQsyktXTYY7fo37j1CKGiXuzbBtyXpJGWCAz8MBHVC0qA1H7Lf EhK7HBpf1dybG7yyIC2M5wV9wMi8y1fB0m05HNH5JmYoVe1oZFtdaeV8XFNmLxqa Gjh9SOwo41YTX+tPciv1Z0Y6i+4XBYSaSw8FUh9Xm1E3ceJHBVx3GNsde9KZ4Vng twCWeii97hhnnmKjhZ67B/AzuvJz2ar5AmHaj8nL8wAlK1xd14l7O2LGAKeLQe0x +R/0ihjae/y2SUnnffOt0k9X9oqYF/E59QKArY//8j/aoMJtbKYZfu+pEoYIjrdF z5TOdQR6W0ePo1gOPE37bIgMAhj3Yw== =8mQZ -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Fri Jan 12 03:38:30 2018 Received: (at 28004) by debbugs.gnu.org; 12 Jan 2018 08:38:30 +0000 Received: from localhost ([127.0.0.1]:52839 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eZur8-0004w2-0Q for submit@debbugs.gnu.org; Fri, 12 Jan 2018 03:38:30 -0500 Received: from aibo.runbox.com ([91.220.196.211]:35506) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eZur5-0004vs-1S for 28004@debbugs.gnu.org; Fri, 12 Jan 2018 03:38:28 -0500 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1eZur3-0004fr-D8; Fri, 12 Jan 2018 09:38:25 +0100 Received: from dslb-188-101-171-176.188.101.pools.vodafone-ip.de ([188.101.171.176] helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1eZuqs-0000up-Q4; Fri, 12 Jan 2018 09:38:14 +0100 Date: Fri, 12 Jan 2018 09:38:19 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180112093819.763dsyiuxcyreh5z@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180109065800.j2gfid7o6a6db2fv@abyayala> <876088eyff.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="auyxbv6jymdxwpku" Content-Disposition: inline In-Reply-To: <876088eyff.fsf@fastmail.com> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --auyxbv6jymdxwpku Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 2.3K bytes: > ng0 writes: >=20 > > Marius Bakke transcribed 39K bytes: > > > >> Testing and feedback welcome! > >>=20 > >> Currently there are two "important" (blocking?) TODOs left: > >>=20 > >> * Move the 'delete-bundled-software' phase to a source snippet. > >> Repacking the ~500MiB compressed tarball is *really* expensive. It > >> should also aid the licensing situation. > >> * Delete the two default entries from the "most used" list on the New > >> Tab page. The first run will download thumbnails for these sites, > >> leaking data. One of them also leads to the disabled-by-default > >> store, promoting non-free software. > >>=20 > >> I'm optimistic that fixing the second item will make the browser not > >> leak *any* data at launch with the default configuration. Which leads > >> to a third item: writing a system test that verifies that launching > >> Chromium does indeed not initiate any network traffic. > >>=20 > >> Anyway, here is the latest patch: > >>=20 > > > >> From f813b2d7ec0728a906720fa74bf9f442af6ab10d Mon Sep 17 00:00:00 2001 > >> From: Marius Bakke > >> Date: Wed, 12 Oct 2016 17:25:05 +0100 > >> Subject: [PATCH] gnu: Add chromium. > >>=20 > >> * gnu/packages/chromium.scm: New file. > >> * gnu/local.mk: Record it. > > > > I think you forgot a package: > > > > gnu/packages/chromium.scm:664:5: icu4c-59.1: unbound variable >=20 > Indeed. This can now be changed to use the regular "icu4c" package. Okay, will change. Thanks! > Tangentially, these kinds of problems are typical with new Chromium > releases. In 63 or later, system harfbuzz had to be disabled. If we > are going to carry this package, changes like these *will* be normal. > > Upstream only tests their releases with Clang, and with the bundled > versions of packages, regardless of the unbundling script. Not great. Yeah. I've been there, and read the frustration of other packagers when I worked on getting a basic skeleton of chromium + dependencies ready one(?) year ago. --=20 GnuPG: A88C8ADD129828D7EAC02E52E22F9BBFEE348588 GnuPG: https://c.n0.is/ng0_pubkeys/tree/keys WWW: https://n0.is/a/ :: https://ea.n0.is --auyxbv6jymdxwpku Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlpYggoACgkQ4i+bv+40 hYjN4Q/+KGObsSC509gmQg5SnAMBjF+MGqXs56d8+j7xHyBoVVlFyy8P81Z1csGO Lfd+q36s2EoOXgIRlCQLw/g2nnlCTeITKmme0/fvXoqGxxkc5pc6YcvbRDH5S7rw eW5N7XW6F1d6OiQBkXfGNnlZd78agHN798BDbcoP877OjIa0OPZ1aDtdYk1ZOqyp Jmehha9SY5Jdxl5xQRJbLv6Aq7fzNdqS1o0UzN/I4hDTNNI3ucZ5F1LLX36YQGky QA8BLnqTu3+uAzIETK5QaSvHyycE2fUW6x3f3Pr4EDNDQZgmbOhPKzdH3Ayt5mo+ y0nJzyiORfwNRzUvC7kyrlgG0oCLMEAbSMSNTKOY9dEo2gzAmS2imMfqvJvjNI8f XpCwyOC3LBMLNd7xICkwGHyAIVtBoLFlqA94Sc0fXLrzzh0qqNg3p9QO68wt5IdE 56eUYZFHdQLabfzZd+kVejbRcp/5P1SB4kulYNvKosP7dg1btJ63RmPILm+vI8Yn r7jZW2Fm+fPbyBOX1MRn2eLaGCMVvlvOgU9H99iK5lnDXBbU/0xfHzSOPcrL5aEg swcSM740OBvMaGc62bqfj20LuovCZXLK3bRPZ1CaLfDjFIzaFtMv1pgOordOMjE6 OEueYJ0/V7yykc0IlBb4sxrep2xKjQfr9o8K4L8QIJp+wjl2pic= =pPQ9 -----END PGP SIGNATURE----- --auyxbv6jymdxwpku-- From debbugs-submit-bounces@debbugs.gnu.org Sat Jan 13 13:02:53 2018 Received: (at 28004) by debbugs.gnu.org; 13 Jan 2018 18:02:53 +0000 Received: from localhost ([127.0.0.1]:55083 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eaQ8j-000308-6Y for submit@debbugs.gnu.org; Sat, 13 Jan 2018 13:02:53 -0500 Received: from aibo.runbox.com ([91.220.196.211]:39712) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eaQ8d-0002zt-Cb for 28004@debbugs.gnu.org; Sat, 13 Jan 2018 13:02:43 -0500 Received: from [10.9.9.212] (helo=mailfront12.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1eaQ8c-00050U-4I; Sat, 13 Jan 2018 19:02:38 +0100 Received: from dslb-092-073-146-083.092.073.pools.vodafone-ip.de ([92.73.146.83] helo=localhost) by mailfront12.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1eaQ8X-0004OY-Gq; Sat, 13 Jan 2018 19:02:33 +0100 Date: Sat, 13 Jan 2018 19:02:35 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180113190235.4yhko2v5cxiu7p6f@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="kqis44vvjivz3hfq" Content-Disposition: inline In-Reply-To: <87373cey5b.fsf@fastmail.com> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.0 (/) --kqis44vvjivz3hfq Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable I just got a bug report for the build via: guix pull --url=3D"https://c.n0.is/git/ng0/guix/guix.git" --branch=3D"prete= st/chromium" guix package --install chromium Failing with the attached build log excerpt. We are not FreeBSD, but I found this in the first 5 minutes: https://bugs.freebsd.org/bugzilla/show_bug.cgi= ?id=3D160935 Maybe it helps to debug this, or maybe you've encountered this before. I myself have been able to build this without issues on two systems. All mentioned systems are GuixSD. This should be a blocker, but maybe a head-up in potential build issues. Marius Bakke transcribed 4.5K bytes: > ng0 writes: >=20 > > Many thanks for your ongoing work with this (and the patience :)) > > As this is 63, you you are keeping track of Debian, right? I tried > > to package 64 a couple of days ago because I wanted the workaround > > for some of the recent security clusterfucks, but Debian is still > > on 63 :/ > > I hope they'll update their patchset soon. >=20 > Indeed Google did not add the Spectre mitigation to Chromium 63, even > though the latest version was released after the fact. >=20 > https://xlab.tencent.com/special/spectre/spectre_check.html >=20 > For reasons that beat me, they only added it to the proprietary Chrome > browser, which follows the same version number as Chromium. >=20 > The attached patch adds Spectre mitigation to the current Chromium > release. The patch was pulled from the Chrome 64 branch: >=20 > From b011b57f357af97f3a003a3b1c481fc8bd2b869c Mon Sep 17 00:00:00 2001 > From: Marius Bakke > Date: Thu, 11 Jan 2018 14:36:47 +0100 > Subject: [PATCH] gnu: chromium: Add spectre mitigation. >=20 > * gnu/packages/patches/chromium-spectre-mitigation.patch: New file. > * gnu/local.mk (dist_patch_DATA): Register it. > * gnu/packages/chromium.scm (chromium)[source]: Use it. > --- > gnu/local.mk | 1 + > gnu/packages/chromium.scm | 3 ++- > gnu/packages/patches/chromium-spectre-mitigation.patch | 13 +++++++++++++ > 3 files changed, 16 insertions(+), 1 deletion(-) > create mode 100644 gnu/packages/patches/chromium-spectre-mitigation.patch >=20 > diff --git a/gnu/local.mk b/gnu/local.mk > index 513f64043..89dab227c 100644 > --- a/gnu/local.mk > +++ b/gnu/local.mk > @@ -575,6 +575,7 @@ dist_patch_DATA =3D \ > %D%/packages/patches/ceph-skip-collect-sys-info-test.patch \ > %D%/packages/patches/ceph-skip-unittest_blockdev.patch \ > %D%/packages/patches/chmlib-inttypes.patch \ > + %D%/packages/patches/chromium-spectre-mitigation.patch \ > %D%/packages/patches/clang-libc-search-path.patch \ > %D%/packages/patches/clang-3.8-libc-search-path.patch \ > %D%/packages/patches/clementine-use-openssl.patch \ > diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm > index dd040527b..1e9dba42e 100644 > --- a/gnu/packages/chromium.scm > +++ b/gnu/packages/chromium.scm > @@ -240,7 +240,8 @@ > %chromium-system-icu.patch > %chromium-system-nspr.patch > %chromium-system-libevent.patch > - %chromium-disable-api-keys-warning.patch)) > + %chromium-disable-api-keys-warning.patch > + (search-patch "chromium-spectre-mitigation.= patch"))) > (modules '((srfi srfi-1) > (guix build utils))) > (snippet > diff --git a/gnu/packages/patches/chromium-spectre-mitigation.patch b/gnu= /packages/patches/chromium-spectre-mitigation.patch > new file mode 100644 > index 000000000..a44a3bce4 > --- /dev/null > +++ b/gnu/packages/patches/chromium-spectre-mitigation.patch > @@ -0,0 +1,13 @@ > +diff --git a/content/public/common/content_features.cc b/content/public/= common/content_features.cc > +index 43feb76..33a49b8 100644 > +--- a/content/public/common/content_features.cc > ++++ b/content/public/common/content_features.cc > +@@ -308,7 +308,7 @@ > +=20 > + // http://tc39.github.io/ecmascript_sharedmem/shmem.html > + const base::Feature kSharedArrayBuffer{"SharedArrayBuffer", > +- base::FEATURE_ENABLED_BY_DEFAULT= }; > ++ base::FEATURE_DISABLED_BY_DEFAUL= T}; > +=20 > + // An experiment to require process isolation for the sign-in origin, > + // https://accounts.google.com. Launch bug: https://crbug.com/739418. > --=20 > 2.15.1 >=20 --=20 ng0 :: https://ea.n0.is A88C8ADD129828D7EAC02E52E22F9BBFEE348588 :: https://ea.n0.is/keys/ --kqis44vvjivz3hfq Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlpaV8sACgkQ4i+bv+40 hYh3Sw//b6MPJEuZrE7/amksG3/kWlJlxjqmWqrSGmVHcfJuJqfEtulyJq6zT+va YWQNcsXelCbKUX/hD3BWLE2J0N8lWHn8oa8FNFrv6Yd3PJrgZT2VS+qJ4Fhv788t dMK2VTWJZ/cOgJjt+qohIipjuxQEnZpUDk3WZpWzljA8AcukSrzGc15Tw04ALucK polnXLRvcUUk2zmFf5D1h3Ebahy4VdBEHl6Uv9ar7PvjbgHzYFiABa0ed3s9xuii MyLYWEXM8LW7xOHr/uTEBMYfMpL40tHVNxQFVHGjDM1sL9oMT1iXEr1QKzXIsDz0 c+54Tk1dIgOOnNvov2sDWqyvlq1xO+1a0ZK0iqm1x3Yk4pRXHGU8YQ4hNIryyLoc erfwyfsGjOVyhfFLNkcph+0Jov1NH+k/8mjyfaNRlIZdg0xTG5UwOO9NaZKLFfWX Op3qlLZBDbQbqM760hMLC6zvI+84TyCYohTQwLJ6+Usr0M2t/UhzBCj4UMBM799z CR7P2M9fQ3EsMO0BkD+WQHpzWQtPOKhG7nSfZDslTcCi7eO0fomY16m7Nxa6mgZk QNtxpQMdKDHS/cd2OEyMsphq/5tKL4VhWnn09JciEUN6a5gDv/4VbDM/KFoqlcFY uttIG2CfIfWHcTOHxNDFWinonot8713BTWCMK7g07YMBfwYS4kg= =Resk -----END PGP SIGNATURE----- --kqis44vvjivz3hfq-- From debbugs-submit-bounces@debbugs.gnu.org Sat Jan 13 13:14:13 2018 Received: (at 28004) by debbugs.gnu.org; 13 Jan 2018 18:14:13 +0000 Received: from localhost ([127.0.0.1]:55109 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eaQJi-0003HH-5r for submit@debbugs.gnu.org; Sat, 13 Jan 2018 13:14:13 -0500 Received: from aibo.runbox.com ([91.220.196.211]:40276) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eaQJa-0003Gg-QS for 28004@debbugs.gnu.org; Sat, 13 Jan 2018 13:14:03 -0500 Received: from [10.9.9.212] (helo=mailfront12.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1eaQJZ-0005lU-Pq; Sat, 13 Jan 2018 19:13:57 +0100 Received: from dslb-092-073-146-083.092.073.pools.vodafone-ip.de ([92.73.146.83] helo=localhost) by mailfront12.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1eaQJX-0002mp-UT; Sat, 13 Jan 2018 19:13:56 +0100 Date: Sat, 13 Jan 2018 19:13:57 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180113191357.lqiwwyw3jxcimaqa@abyayala> References: <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <20180113190235.4yhko2v5cxiu7p6f@abyayala> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="6f4gatmyeuo3klfj" Content-Disposition: inline In-Reply-To: <20180113190235.4yhko2v5cxiu7p6f@abyayala> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.0 (/) --6f4gatmyeuo3klfj Content-Type: multipart/mixed; boundary="yoqriwqvuf3qqpax" Content-Disposition: inline --yoqriwqvuf3qqpax Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable ng0 transcribed 5.6K bytes: > I just got a bug report for the build via: >=20 > guix pull --url=3D"https://c.n0.is/git/ng0/guix/guix.git" --branch=3D"pre= test/chromium" > guix package --install chromium >=20 > Failing with the attached build log excerpt. We are not FreeBSD, but I fo= und > this in the first 5 minutes: https://bugs.freebsd.org/bugzilla/show_bug.c= gi?id=3D160935 > Maybe it helps to debug this, or maybe you've encountered this before. >=20 > I myself have been able to build this without issues on two systems. >=20 > All mentioned systems are GuixSD. >=20 this time with attached file. > This should be a blocker, but maybe a head-up in potential build issues. > Marius Bakke transcribed 4.5K bytes: > > ng0 writes: > >=20 > > > Many thanks for your ongoing work with this (and the patience :)) > > > As this is 63, you you are keeping track of Debian, right? I tried > > > to package 64 a couple of days ago because I wanted the workaround > > > for some of the recent security clusterfucks, but Debian is still > > > on 63 :/ > > > I hope they'll update their patchset soon. > >=20 > > Indeed Google did not add the Spectre mitigation to Chromium 63, even > > though the latest version was released after the fact. > >=20 > > https://xlab.tencent.com/special/spectre/spectre_check.html > >=20 > > For reasons that beat me, they only added it to the proprietary Chrome > > browser, which follows the same version number as Chromium. > >=20 > > The attached patch adds Spectre mitigation to the current Chromium > > release. The patch was pulled from the Chrome 64 branch: > >=20 >=20 > > From b011b57f357af97f3a003a3b1c481fc8bd2b869c Mon Sep 17 00:00:00 2001 > > From: Marius Bakke > > Date: Thu, 11 Jan 2018 14:36:47 +0100 > > Subject: [PATCH] gnu: chromium: Add spectre mitigation. > >=20 > > * gnu/packages/patches/chromium-spectre-mitigation.patch: New file. > > * gnu/local.mk (dist_patch_DATA): Register it. > > * gnu/packages/chromium.scm (chromium)[source]: Use it. > > --- > > gnu/local.mk | 1 + > > gnu/packages/chromium.scm | 3 ++- > > gnu/packages/patches/chromium-spectre-mitigation.patch | 13 ++++++++++= +++ > > 3 files changed, 16 insertions(+), 1 deletion(-) > > create mode 100644 gnu/packages/patches/chromium-spectre-mitigation.pa= tch > >=20 > > diff --git a/gnu/local.mk b/gnu/local.mk > > index 513f64043..89dab227c 100644 > > --- a/gnu/local.mk > > +++ b/gnu/local.mk > > @@ -575,6 +575,7 @@ dist_patch_DATA =3D \ > > %D%/packages/patches/ceph-skip-collect-sys-info-test.patch \ > > %D%/packages/patches/ceph-skip-unittest_blockdev.patch \ > > %D%/packages/patches/chmlib-inttypes.patch \ > > + %D%/packages/patches/chromium-spectre-mitigation.patch \ > > %D%/packages/patches/clang-libc-search-path.patch \ > > %D%/packages/patches/clang-3.8-libc-search-path.patch \ > > %D%/packages/patches/clementine-use-openssl.patch \ > > diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm > > index dd040527b..1e9dba42e 100644 > > --- a/gnu/packages/chromium.scm > > +++ b/gnu/packages/chromium.scm > > @@ -240,7 +240,8 @@ > > %chromium-system-icu.patch > > %chromium-system-nspr.patch > > %chromium-system-libevent.patch > > - %chromium-disable-api-keys-warning.patch)) > > + %chromium-disable-api-keys-warning.patch > > + (search-patch "chromium-spectre-mitigatio= n.patch"))) > > (modules '((srfi srfi-1) > > (guix build utils))) > > (snippet > > diff --git a/gnu/packages/patches/chromium-spectre-mitigation.patch b/g= nu/packages/patches/chromium-spectre-mitigation.patch > > new file mode 100644 > > index 000000000..a44a3bce4 > > --- /dev/null > > +++ b/gnu/packages/patches/chromium-spectre-mitigation.patch > > @@ -0,0 +1,13 @@ > > +diff --git a/content/public/common/content_features.cc b/content/publi= c/common/content_features.cc > > +index 43feb76..33a49b8 100644 > > +--- a/content/public/common/content_features.cc > > ++++ b/content/public/common/content_features.cc > > +@@ -308,7 +308,7 @@ > > +=20 > > + // http://tc39.github.io/ecmascript_sharedmem/shmem.html > > + const base::Feature kSharedArrayBuffer{"SharedArrayBuffer", > > +- base::FEATURE_ENABLED_BY_DEFAU= LT}; > > ++ base::FEATURE_DISABLED_BY_DEFA= ULT}; > > +=20 > > + // An experiment to require process isolation for the sign-in origin, > > + // https://accounts.google.com. Launch bug: https://crbug.com/739418. > > --=20 > > 2.15.1 > >=20 >=20 >=20 >=20 >=20 > --=20 > ng0 :: https://ea.n0.is > A88C8ADD129828D7EAC02E52E22F9BBFEE348588 :: https://ea.n0.is/keys/ --=20 ng0 :: https://ea.n0.is A88C8ADD129828D7EAC02E52E22F9BBFEE348588 :: https://ea.n0.is/keys/ --yoqriwqvuf3qqpax Content-Type: text/plain; charset=utf-8 Content-Disposition: attachment; filename="chromium.fail" Content-Transfer-Encoding: quoted-printable [19248/23429] CXX obj/content/browser/browser/web_bluetooth_service_impl.o FAILED: obj/content/browser/browser/web_bluetooth_service_impl.o=20 g++ -MMD -MF obj/content/browser/browser/web_bluetooth_service_impl.o.d -DE= NABLE_SCREEN_CAPTURE=3D1 -DV8_DEPRECATION_WARNINGS=20 -DUSE_UDEV -DUSE_AURA=3D1 -DUSE_GLIB=3D1 -DUSE_NSS_CERTS=3D1 -DUSE_X11=3D1 = -DNO_TCMALLOC -DFULL_SAFE_BROWSING -DSAFE_BROWSING_CSD=20 -DSAFE_BROWSING_DB_LOCAL -DCHROMIUM_BUILD -D_FILE_OFFSET_BITS=3D64 -D_LARGE= FILE_SOURCE -D_LARGEFILE64_SOURCE=20 -D__STDC_CONSTANT_MACROS -D__STDC_FORMAT_MACROS -D_FORTIFY_SOURCE=3D2 -DNDE= BUG -DNVALGRIND -DDYNAMIC_ANNOTATIONS_ENABLED=3D0=20 -DCONTENT_IMPLEMENTATION -DV8_USE_EXTERNAL_STARTUP_DATA=20 -DATK_LIB_DIR=3D\"/gnu/store/nniszqyslmgllha2cyi9g3pfsmm6sg16-atk-2.24.0/li= b\" -DGLIB_VERSION_MAX_ALLOWED=3DGLIB_VERSION_2_32=20 -DGLIB_VERSION_MIN_REQUIRED=3DGLIB_VERSION_2_26 -DGL_GLEXT_PROTOTYPES -DUSE= _GLX -DUSE_EGL -DGOOGLE_PROTOBUF_NO_RTTI=20 -DGOOGLE_PROTOBUF_NO_STATIC_INITIALIZER -DHAVE_PTHREAD -DUSING_SYSTEM_ICU= =3D1 -DICU_UTIL_DATA_IMPL=3DICU_UTIL_DATA_STATIC=20 -DUCHAR_TYPE=3Duint16_t -DSK_IGNORE_LINEONLY_AA_CONVEX_PATH_OPTS -DSK_HAS_P= NG_LIBRARY -DSK_HAS_WEBP_LIBRARY -DSK_HAS_JPEG_LIBRARY=20 -DSK_SUPPORT_GPU=3D1 -DLEVELDB_PLATFORM_CHROMIUM=3D1 -DWEBRTC_NON_STATIC_TR= ACE_EVENT_HANDLERS=3D0 -DFEATURE_ENABLE_VOICEMAIL=20 -DGTEST_RELATIVE_PATH -DWEBRTC_CHROMIUM_BUILD -DWEBRTC_POSIX -DWEBRTC_LINUX= -DWTF_USE_WEBAUDIO_FFMPEG=3D1=20 -DWTF_USE_DEFAULT_RENDER_THEME=3D1 -DUSE_SYSTEM_ZLIB=3D1 -DNO_MAIN_THREAD_W= RAPPING -I../.. -Igen=20 -I/gnu/store/nniszqyslmgllha2cyi9g3pfsmm6sg16-atk-2.24.0/include/atk-1.0=20 -I/gnu/store/azbfh3i72lbaqvhgg5m7p6ymmqq0ii6q-glib-2.52.3/include/glib-2.0= =20 -I/gnu/store/azbfh3i72lbaqvhgg5m7p6ymmqq0ii6q-glib-2.52.3/lib/glib-2.0/incl= ude=20 -I/gnu/store/azbfh3i72lbaqvhgg5m7p6ymmqq0ii6q-glib-2.52.3/include/glib-2.0= =20 -I/gnu/store/azbfh3i72lbaqvhgg5m7p6ymmqq0ii6q-glib-2.52.3/lib/glib-2.0/incl= ude=20 -I/gnu/store/b9ww6qv1ii9v6n45kin7543vkf6jfnd3-libpng-1.6.29/include/libpng1= 6=20 -I/gnu/store/azbfh3i72lbaqvhgg5m7p6ymmqq0ii6q-glib-2.52.3/include/glib-2.0= =20 -I/gnu/store/azbfh3i72lbaqvhgg5m7p6ymmqq0ii6q-glib-2.52.3/lib/glib-2.0/incl= ude=20 -I/gnu/store/3k1y78v6nxjvmivnri5j46wai6ppvyz0-harfbuzz-1.5.1/include/harfbu= zz=20 -I/gnu/store/b9ww6qv1ii9v6n45kin7543vkf6jfnd3-libpng-1.6.29/include/libpng1= 6=20 -I/gnu/store/4b9y9f5fvghk2vmwpbgzncal7z3r4n5y-pango-1.40.12/include/pango-1= =2E0=20 -I/gnu/store/c4vl4hw5jccg0b23sfvs0kdnfdbxdlgm-cairo-1.14.10/include/cairo= =20 -I/gnu/store/w8kii3hjvmh50yxs52gkdywkq9jc7s19-pixman-0.34.0/include/pixman-= 1 -Igen/shim_headers/libevent_shim=20 -Igen/shim_headers/icui18n_shim -Igen/shim_headers/icuuc_shim -Igen/shim_he= aders/re2_shim -Igen/shim_headers/libpng_shim=20 -Igen/shim_headers/zlib_shim -Igen/shim_headers/libdrm_shim -I../../third_p= arty/khronos -I../../gpu=20 -Igen/shim_headers/ffmpeg_shim -Igen/shim_headers/libvpx_shim -Igen/shim_he= aders/opus_shim -Igen/shim_headers/snappy_shim=20 -Igen/shim_headers/openh264_shim -Igen/shim_headers/minizip_shim -Igen/shim= _headers/flac_shim -I../../third_party/protobuf/src=20 -I../../third_party/ced/src -I../../skia/config -I../../skia/ext -I../../th= ird_party/skia/include/c=20 -I../../third_party/skia/include/config -I../../third_party/skia/include/co= re -I../../third_party/skia/include/effects=20 -I../../third_party/skia/include/encode -I../../third_party/skia/include/gp= u -I../../third_party/skia/include/images=20 -I../../third_party/skia/include/lazy -I../../third_party/skia/include/path= ops -I../../third_party/skia/include/pdf=20 -I../../third_party/skia/include/pipe -I../../third_party/skia/include/port= s -I../../third_party/skia/include/utils=20 -I../../third_party/skia/third_party/vulkan -I../../third_party/skia/src/gp= u -I../../third_party/skia/src/sksl=20 -I../../third_party/leveldatabase -I../../third_party/leveldatabase/src -I.= =2E/../third_party/leveldatabase/src/include=20 -I../../third_party/webrtc_overrides -I../../testing/gtest/include -I../../= third_party/webrtc=20 -I../../third_party/webrtc_overrides -I../../third_party/webrtc -I../../thi= rd_party/protobuf/src -Igen/protoc_out=20 -Igen/components/metrics/proto -I../../third_party/boringssl/src/include=20 -I/gnu/store/yk0bk0y3dvz2pa3f56knjhdby16fb62s-nss-3.34/include/nss=20 -I/gnu/store/544jcd4141xgg72dk5xxbs4zjzvxvvxi-nspr-4.17/include/nspr -I../.= =2E/third_party/libwebm/source -Igen=20 -I../../third_party/WebKit -Igen/third_party/WebKit -I../../v8/include -Ige= n/v8/include -I../../third_party/mesa/src/include=20 -I../../third_party/WebKit/Source -I../../third_party/WebKit -Igen/blink -I= gen/third_party/WebKit=20 -I../../third_party/angle/src/common/third_party/base -Igen/angle -I../../t= hird_party/brotli/include=20 -I../../third_party/libyuv/include -I/gnu/store/xr0zjan791j0pgvcs770m59za9b= sjsr6-dbus-1.10.22/include/dbus-1.0=20 -I/gnu/store/xr0zjan791j0pgvcs770m59za9bsjsr6-dbus-1.10.22/lib/dbus-1.0/inc= lude -fno-strict-aliasing --param=3Dssp-buffer-size=3D4=20 -fstack-protector -Wno-builtin-macro-redefined -D__DATE__=3D -D__TIME__=3D = -D__TIMESTAMP__=3D -funwind-tables -fPIC -pipe -pthread=20 -m64 -march=3Dx86-64 -Wall -Wno-unused-local-typedefs -Wno-maybe-uninitiali= zed -Wno-missing-field-initializers=20 -Wno-unused-parameter -O2 -fno-ident -fdata-sections -ffunction-sections -f= omit-frame-pointer -g0 -fvisibility=3Dhidden=20 -Wno-unused-local-typedef -Wno-unused-function -std=3Dgnu++14 -Wno-narrowin= g -fno-rtti -fno-exceptions -fvisibility-inlines-hidden=20 -c ../../content/browser/bluetooth/web_bluetooth_service_impl.cc -o obj/con= tent/browser/browser/web_bluetooth_service_impl.o g++: internal compiler error: Killed (program cc1plus) Please submit a full bug report, with preprocessed source if appropriate. See for instructions. [19249/23429] CXX obj/content/browser/browser/render_frame_host_factory.o In file included from ../../content/browser/frame_host/frame_tree_node.h:18= :0, from ../../content/browser/frame_host/render_frame_host_fa= ctory.cc:9: =2E./../content/browser/frame_host/render_frame_host_impl.h:1001:3: warning= : multi-line comment [-Wcomment] // / | \ ^ =2E./../content/browser/frame_host/render_frame_host_impl.h:1003:3: warning= : multi-line comment [-Wcomment] // / / \ \ ^ cc1plus: warning: unrecognized command line option =E2=80=98-Wno-unused-loc= al-typedef=E2=80=99 [19250/23429] CXX obj/content/browser/browser/render_frame_host_manager.o In file included from ../../content/browser/frame_host/render_frame_host_ma= nager.h:19:0, from ../../content/browser/frame_host/render_frame_host_ma= nager.cc:5: =2E./../content/browser/frame_host/render_frame_host_impl.h:1001:3: warning= : multi-line comment [-Wcomment] // / | \ ^ =2E./../content/browser/frame_host/render_frame_host_impl.h:1003:3: warning= : multi-line comment [-Wcomment] // / / \ \ ^ cc1plus: warning: unrecognized command line option =E2=80=98-Wno-unused-loc= al-typedef=E2=80=99 [19251/23429] CXX obj/content/browser/browser/render_frame_host_impl.o In file included from ../../content/browser/frame_host/render_frame_host_im= pl.cc:5:0: =2E./../content/browser/frame_host/render_frame_host_impl.h:1001:3: warning= : multi-line comment [-Wcomment] // / | \ ^ =2E./../content/browser/frame_host/render_frame_host_impl.h:1003:3: warning= : multi-line comment [-Wcomment] // / / \ \ ^ cc1plus: warning: unrecognized command line option =E2=80=98-Wno-unused-loc= al-typedef=E2=80=99 ninja: build stopped: subcommand failed. phase `build' failed after 16570.6 seconds builder for `/gnu/store/9ws2gavs5bjlrfimhdi10pssvy7hwnwl-chromium-63.0.3239= =2E132.drv' failed with exit code 1 guix package: error: build failed: build of `/gnu/store/9ws2gavs5bjlrfimhdi= 10pssvy7hwnwl-chromium-63.0.3239.132.drv' failed --yoqriwqvuf3qqpax-- --6f4gatmyeuo3klfj Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlpaWnUACgkQ4i+bv+40 hYhE0RAAhjXzAIYYYwPEC38gItQP6jeHA8O8pxQfI6xLXdpy0KZNllzcis87RzWK XYQkiw3nnUQB3pkFGsAhrAJ5c0R4IOTjFHPtwbppoy5uQ/YL6jIZKwGmhL4NoLKN EdRNHH5/nl07pWIGPYmJiQH8YqHmKgykq3GUamVcU4T6xkdwMpZzDlGb5UnjVuda MUj1oX5Ex29CONACDaoo1pDZnHn/UVp2QuV8WwedZr3LTESvaMvj/m3CPY4qov8l z6gAUe5tFcm66q+gBU5t0VYXGWRliiM5JFnfLiOhXmgd6/A0SaMGZIpBGOp0JLJD 33/w3Dud8P/0Omw8ZsFXBgXA4O5/NCE/YtBi5tmjU181T5SUk05Q3Tdu8qwi0h38 u3sAvRK0eQvcsHlLfNaYX0w2f+H2OeV0+NGjKoY1JCvf+HVQiriM14lJ2SQwsfPl 51U2hZeQnOsF56CfX7z1vfnaJ2EF6ws47OGU6xvSa2LcumwtkkHBUVRYO6R+DlUU W+3qMSoG0nPtXLhiOqy/oFu1gfza2ZJZ6CzHFIaYmRhJxAmRX9jv0cQehBZ4lkwB jdpeLrbabxVc/ESADRfgEq2/24y8tZDFyOEMpeCuNstZZa4jT4mfc7HOzTqOjWbN Ni5AoigSRLehRrwe+w+GhJ+/ZXiatE81EqUvCmm9LC25cK5XyaE= =lG00 -----END PGP SIGNATURE----- --6f4gatmyeuo3klfj-- From debbugs-submit-bounces@debbugs.gnu.org Sun Jan 14 06:10:48 2018 Received: (at 28004) by debbugs.gnu.org; 14 Jan 2018 11:10:48 +0000 Received: from localhost ([127.0.0.1]:55413 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eagBU-0004TC-Ai for submit@debbugs.gnu.org; Sun, 14 Jan 2018 06:10:47 -0500 Received: from aibo.runbox.com ([91.220.196.211]:47640) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eagBP-0004Sy-Hn for 28004@debbugs.gnu.org; Sun, 14 Jan 2018 06:10:38 -0500 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1eagBN-0003kc-Qx; Sun, 14 Jan 2018 12:10:33 +0100 Received: from dslb-092-073-146-083.092.073.pools.vodafone-ip.de ([92.73.146.83] helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1eagB9-000251-KO; Sun, 14 Jan 2018 12:10:20 +0100 Date: Sun, 14 Jan 2018 12:10:21 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180114121021.kjkkfzpvwkepaxsh@abyayala> References: <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <20180113190235.4yhko2v5cxiu7p6f@abyayala> <20180113191357.lqiwwyw3jxcimaqa@abyayala> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="rhpp4fbt4wy637lc" Content-Disposition: inline In-Reply-To: <20180113191357.lqiwwyw3jxcimaqa@abyayala> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.0 (/) --rhpp4fbt4wy637lc Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable ng0 transcribed 14K bytes: > ng0 transcribed 5.6K bytes: > > I just got a bug report for the build via: > >=20 > > guix pull --url=3D"https://c.n0.is/git/ng0/guix/guix.git" --branch=3D"p= retest/chromium" > > guix package --install chromium > >=20 > > Failing with the attached build log excerpt. We are not FreeBSD, but I = found > > this in the first 5 minutes: https://bugs.freebsd.org/bugzilla/show_bug= =2Ecgi?id=3D160935 > > Maybe it helps to debug this, or maybe you've encountered this before. > >=20 > > I myself have been able to build this without issues on two systems. > >=20 > > All mentioned systems are GuixSD. > >=20 >=20 > this time with attached file. My guess was "low on RAM or swap", as it turns out this was right. With more RAM and/or swap space it builds. > > This should be a blocker, but maybe a head-up in potential build issues. > > Marius Bakke transcribed 4.5K bytes: > > > ng0 writes: > > >=20 > > > > Many thanks for your ongoing work with this (and the patience :)) > > > > As this is 63, you you are keeping track of Debian, right? I tried > > > > to package 64 a couple of days ago because I wanted the workaround > > > > for some of the recent security clusterfucks, but Debian is still > > > > on 63 :/ > > > > I hope they'll update their patchset soon. > > >=20 > > > Indeed Google did not add the Spectre mitigation to Chromium 63, even > > > though the latest version was released after the fact. > > >=20 > > > https://xlab.tencent.com/special/spectre/spectre_check.html > > >=20 > > > For reasons that beat me, they only added it to the proprietary Chrome > > > browser, which follows the same version number as Chromium. > > >=20 > > > The attached patch adds Spectre mitigation to the current Chromium > > > release. The patch was pulled from the Chrome 64 branch: > > >=20 > >=20 > > > From b011b57f357af97f3a003a3b1c481fc8bd2b869c Mon Sep 17 00:00:00 2001 > > > From: Marius Bakke > > > Date: Thu, 11 Jan 2018 14:36:47 +0100 > > > Subject: [PATCH] gnu: chromium: Add spectre mitigation. > > >=20 > > > * gnu/packages/patches/chromium-spectre-mitigation.patch: New file. > > > * gnu/local.mk (dist_patch_DATA): Register it. > > > * gnu/packages/chromium.scm (chromium)[source]: Use it. > > > --- > > > gnu/local.mk | 1 + > > > gnu/packages/chromium.scm | 3 ++- > > > gnu/packages/patches/chromium-spectre-mitigation.patch | 13 ++++++++= +++++ > > > 3 files changed, 16 insertions(+), 1 deletion(-) > > > create mode 100644 gnu/packages/patches/chromium-spectre-mitigation.= patch > > >=20 > > > diff --git a/gnu/local.mk b/gnu/local.mk > > > index 513f64043..89dab227c 100644 > > > --- a/gnu/local.mk > > > +++ b/gnu/local.mk > > > @@ -575,6 +575,7 @@ dist_patch_DATA =3D \ > > > %D%/packages/patches/ceph-skip-collect-sys-info-test.patch \ > > > %D%/packages/patches/ceph-skip-unittest_blockdev.patch \ > > > %D%/packages/patches/chmlib-inttypes.patch \ > > > + %D%/packages/patches/chromium-spectre-mitigation.patch \ > > > %D%/packages/patches/clang-libc-search-path.patch \ > > > %D%/packages/patches/clang-3.8-libc-search-path.patch \ > > > %D%/packages/patches/clementine-use-openssl.patch \ > > > diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm > > > index dd040527b..1e9dba42e 100644 > > > --- a/gnu/packages/chromium.scm > > > +++ b/gnu/packages/chromium.scm > > > @@ -240,7 +240,8 @@ > > > %chromium-system-icu.patch > > > %chromium-system-nspr.patch > > > %chromium-system-libevent.patch > > > - %chromium-disable-api-keys-warning.patc= h)) > > > + %chromium-disable-api-keys-warning.patch > > > + (search-patch "chromium-spectre-mitigat= ion.patch"))) > > > (modules '((srfi srfi-1) > > > (guix build utils))) > > > (snippet > > > diff --git a/gnu/packages/patches/chromium-spectre-mitigation.patch b= /gnu/packages/patches/chromium-spectre-mitigation.patch > > > new file mode 100644 > > > index 000000000..a44a3bce4 > > > --- /dev/null > > > +++ b/gnu/packages/patches/chromium-spectre-mitigation.patch > > > @@ -0,0 +1,13 @@ > > > +diff --git a/content/public/common/content_features.cc b/content/pub= lic/common/content_features.cc > > > +index 43feb76..33a49b8 100644 > > > +--- a/content/public/common/content_features.cc > > > ++++ b/content/public/common/content_features.cc > > > +@@ -308,7 +308,7 @@ > > > +=20 > > > + // http://tc39.github.io/ecmascript_sharedmem/shmem.html > > > + const base::Feature kSharedArrayBuffer{"SharedArrayBuffer", > > > +- base::FEATURE_ENABLED_BY_DEF= AULT}; > > > ++ base::FEATURE_DISABLED_BY_DE= FAULT}; > > > +=20 > > > + // An experiment to require process isolation for the sign-in origi= n, > > > + // https://accounts.google.com. Launch bug: https://crbug.com/7394= 18. > > > --=20 > > > 2.15.1 > > >=20 > >=20 > >=20 > >=20 > >=20 > > --=20 > > ng0 :: https://ea.n0.is > > A88C8ADD129828D7EAC02E52E22F9BBFEE348588 :: https://ea.n0.is/keys/ >=20 >=20 >=20 > --=20 > ng0 :: https://ea.n0.is > A88C8ADD129828D7EAC02E52E22F9BBFEE348588 :: https://ea.n0.is/keys/ > [19248/23429] CXX obj/content/browser/browser/web_bluetooth_service_impl.o > FAILED: obj/content/browser/browser/web_bluetooth_service_impl.o=20 > g++ -MMD -MF obj/content/browser/browser/web_bluetooth_service_impl.o.d -= DENABLE_SCREEN_CAPTURE=3D1 -DV8_DEPRECATION_WARNINGS=20 > -DUSE_UDEV -DUSE_AURA=3D1 -DUSE_GLIB=3D1 -DUSE_NSS_CERTS=3D1 -DUSE_X11=3D= 1 -DNO_TCMALLOC -DFULL_SAFE_BROWSING -DSAFE_BROWSING_CSD=20 > -DSAFE_BROWSING_DB_LOCAL -DCHROMIUM_BUILD -D_FILE_OFFSET_BITS=3D64 -D_LAR= GEFILE_SOURCE -D_LARGEFILE64_SOURCE=20 > -D__STDC_CONSTANT_MACROS -D__STDC_FORMAT_MACROS -D_FORTIFY_SOURCE=3D2 -DN= DEBUG -DNVALGRIND -DDYNAMIC_ANNOTATIONS_ENABLED=3D0=20 > -DCONTENT_IMPLEMENTATION -DV8_USE_EXTERNAL_STARTUP_DATA=20 > -DATK_LIB_DIR=3D\"/gnu/store/nniszqyslmgllha2cyi9g3pfsmm6sg16-atk-2.24.0/= lib\" -DGLIB_VERSION_MAX_ALLOWED=3DGLIB_VERSION_2_32=20 > -DGLIB_VERSION_MIN_REQUIRED=3DGLIB_VERSION_2_26 -DGL_GLEXT_PROTOTYPES -DU= SE_GLX -DUSE_EGL -DGOOGLE_PROTOBUF_NO_RTTI=20 > -DGOOGLE_PROTOBUF_NO_STATIC_INITIALIZER -DHAVE_PTHREAD -DUSING_SYSTEM_ICU= =3D1 -DICU_UTIL_DATA_IMPL=3DICU_UTIL_DATA_STATIC=20 > -DUCHAR_TYPE=3Duint16_t -DSK_IGNORE_LINEONLY_AA_CONVEX_PATH_OPTS -DSK_HAS= _PNG_LIBRARY -DSK_HAS_WEBP_LIBRARY -DSK_HAS_JPEG_LIBRARY=20 > -DSK_SUPPORT_GPU=3D1 -DLEVELDB_PLATFORM_CHROMIUM=3D1 -DWEBRTC_NON_STATIC_= TRACE_EVENT_HANDLERS=3D0 -DFEATURE_ENABLE_VOICEMAIL=20 > -DGTEST_RELATIVE_PATH -DWEBRTC_CHROMIUM_BUILD -DWEBRTC_POSIX -DWEBRTC_LIN= UX -DWTF_USE_WEBAUDIO_FFMPEG=3D1=20 > -DWTF_USE_DEFAULT_RENDER_THEME=3D1 -DUSE_SYSTEM_ZLIB=3D1 -DNO_MAIN_THREAD= _WRAPPING -I../.. -Igen=20 > -I/gnu/store/nniszqyslmgllha2cyi9g3pfsmm6sg16-atk-2.24.0/include/atk-1.0= =20 > -I/gnu/store/azbfh3i72lbaqvhgg5m7p6ymmqq0ii6q-glib-2.52.3/include/glib-2.= 0=20 > -I/gnu/store/azbfh3i72lbaqvhgg5m7p6ymmqq0ii6q-glib-2.52.3/lib/glib-2.0/in= clude=20 > -I/gnu/store/azbfh3i72lbaqvhgg5m7p6ymmqq0ii6q-glib-2.52.3/include/glib-2.= 0=20 > -I/gnu/store/azbfh3i72lbaqvhgg5m7p6ymmqq0ii6q-glib-2.52.3/lib/glib-2.0/in= clude=20 > -I/gnu/store/b9ww6qv1ii9v6n45kin7543vkf6jfnd3-libpng-1.6.29/include/libpn= g16=20 > -I/gnu/store/azbfh3i72lbaqvhgg5m7p6ymmqq0ii6q-glib-2.52.3/include/glib-2.= 0=20 > -I/gnu/store/azbfh3i72lbaqvhgg5m7p6ymmqq0ii6q-glib-2.52.3/lib/glib-2.0/in= clude=20 > -I/gnu/store/3k1y78v6nxjvmivnri5j46wai6ppvyz0-harfbuzz-1.5.1/include/harf= buzz=20 > -I/gnu/store/b9ww6qv1ii9v6n45kin7543vkf6jfnd3-libpng-1.6.29/include/libpn= g16=20 > -I/gnu/store/4b9y9f5fvghk2vmwpbgzncal7z3r4n5y-pango-1.40.12/include/pango= -1.0=20 > -I/gnu/store/c4vl4hw5jccg0b23sfvs0kdnfdbxdlgm-cairo-1.14.10/include/cairo= =20 > -I/gnu/store/w8kii3hjvmh50yxs52gkdywkq9jc7s19-pixman-0.34.0/include/pixma= n-1 -Igen/shim_headers/libevent_shim=20 > -Igen/shim_headers/icui18n_shim -Igen/shim_headers/icuuc_shim -Igen/shim_= headers/re2_shim -Igen/shim_headers/libpng_shim=20 > -Igen/shim_headers/zlib_shim -Igen/shim_headers/libdrm_shim -I../../third= _party/khronos -I../../gpu=20 > -Igen/shim_headers/ffmpeg_shim -Igen/shim_headers/libvpx_shim -Igen/shim_= headers/opus_shim -Igen/shim_headers/snappy_shim=20 > -Igen/shim_headers/openh264_shim -Igen/shim_headers/minizip_shim -Igen/sh= im_headers/flac_shim -I../../third_party/protobuf/src=20 > -I../../third_party/ced/src -I../../skia/config -I../../skia/ext -I../../= third_party/skia/include/c=20 > -I../../third_party/skia/include/config -I../../third_party/skia/include/= core -I../../third_party/skia/include/effects=20 > -I../../third_party/skia/include/encode -I../../third_party/skia/include/= gpu -I../../third_party/skia/include/images=20 > -I../../third_party/skia/include/lazy -I../../third_party/skia/include/pa= thops -I../../third_party/skia/include/pdf=20 > -I../../third_party/skia/include/pipe -I../../third_party/skia/include/po= rts -I../../third_party/skia/include/utils=20 > -I../../third_party/skia/third_party/vulkan -I../../third_party/skia/src/= gpu -I../../third_party/skia/src/sksl=20 > -I../../third_party/leveldatabase -I../../third_party/leveldatabase/src -= I../../third_party/leveldatabase/src/include=20 > -I../../third_party/webrtc_overrides -I../../testing/gtest/include -I../.= =2E/third_party/webrtc=20 > -I../../third_party/webrtc_overrides -I../../third_party/webrtc -I../../t= hird_party/protobuf/src -Igen/protoc_out=20 > -Igen/components/metrics/proto -I../../third_party/boringssl/src/include= =20 > -I/gnu/store/yk0bk0y3dvz2pa3f56knjhdby16fb62s-nss-3.34/include/nss=20 > -I/gnu/store/544jcd4141xgg72dk5xxbs4zjzvxvvxi-nspr-4.17/include/nspr -I..= /../third_party/libwebm/source -Igen=20 > -I../../third_party/WebKit -Igen/third_party/WebKit -I../../v8/include -I= gen/v8/include -I../../third_party/mesa/src/include=20 > -I../../third_party/WebKit/Source -I../../third_party/WebKit -Igen/blink = -Igen/third_party/WebKit=20 > -I../../third_party/angle/src/common/third_party/base -Igen/angle -I../..= /third_party/brotli/include=20 > -I../../third_party/libyuv/include -I/gnu/store/xr0zjan791j0pgvcs770m59za= 9bsjsr6-dbus-1.10.22/include/dbus-1.0=20 > -I/gnu/store/xr0zjan791j0pgvcs770m59za9bsjsr6-dbus-1.10.22/lib/dbus-1.0/i= nclude -fno-strict-aliasing --param=3Dssp-buffer-size=3D4=20 > -fstack-protector -Wno-builtin-macro-redefined -D__DATE__=3D -D__TIME__= =3D -D__TIMESTAMP__=3D -funwind-tables -fPIC -pipe -pthread=20 > -m64 -march=3Dx86-64 -Wall -Wno-unused-local-typedefs -Wno-maybe-uninitia= lized -Wno-missing-field-initializers=20 > -Wno-unused-parameter -O2 -fno-ident -fdata-sections -ffunction-sections = -fomit-frame-pointer -g0 -fvisibility=3Dhidden=20 > -Wno-unused-local-typedef -Wno-unused-function -std=3Dgnu++14 -Wno-narrow= ing -fno-rtti -fno-exceptions -fvisibility-inlines-hidden=20 > -c ../../content/browser/bluetooth/web_bluetooth_service_impl.cc -o obj/c= ontent/browser/browser/web_bluetooth_service_impl.o > g++: internal compiler error: Killed (program cc1plus) > Please submit a full bug report, > with preprocessed source if appropriate. > See for instructions. > [19249/23429] CXX obj/content/browser/browser/render_frame_host_factory.o > In file included from ../../content/browser/frame_host/frame_tree_node.h:= 18:0, > from ../../content/browser/frame_host/render_frame_host_= factory.cc:9: > ../../content/browser/frame_host/render_frame_host_impl.h:1001:3: warning= : multi-line comment [-Wcomment] > // / | \ > ^ > ../../content/browser/frame_host/render_frame_host_impl.h:1003:3: warning= : multi-line comment [-Wcomment] > // / / \ \ > ^ > cc1plus: warning: unrecognized command line option =E2=80=98-Wno-unused-l= ocal-typedef=E2=80=99 > [19250/23429] CXX obj/content/browser/browser/render_frame_host_manager.o > In file included from ../../content/browser/frame_host/render_frame_host_= manager.h:19:0, > from ../../content/browser/frame_host/render_frame_host_= manager.cc:5: > ../../content/browser/frame_host/render_frame_host_impl.h:1001:3: warning= : multi-line comment [-Wcomment] > // / | \ > ^ > ../../content/browser/frame_host/render_frame_host_impl.h:1003:3: warning= : multi-line comment [-Wcomment] > // / / \ \ > ^ > cc1plus: warning: unrecognized command line option =E2=80=98-Wno-unused-l= ocal-typedef=E2=80=99 > [19251/23429] CXX obj/content/browser/browser/render_frame_host_impl.o > In file included from ../../content/browser/frame_host/render_frame_host_= impl.cc:5:0: > ../../content/browser/frame_host/render_frame_host_impl.h:1001:3: warning= : multi-line comment [-Wcomment] > // / | \ > ^ > ../../content/browser/frame_host/render_frame_host_impl.h:1003:3: warning= : multi-line comment [-Wcomment] > // / / \ \ > ^ > cc1plus: warning: unrecognized command line option =E2=80=98-Wno-unused-l= ocal-typedef=E2=80=99 > ninja: build stopped: subcommand failed. > phase `build' failed after 16570.6 seconds > builder for `/gnu/store/9ws2gavs5bjlrfimhdi10pssvy7hwnwl-chromium-63.0.32= 39.132.drv' failed with exit code 1 > guix package: error: build failed: build of `/gnu/store/9ws2gavs5bjlrfimh= di10pssvy7hwnwl-chromium-63.0.3239.132.drv' failed --=20 ng0 :: https://ea.n0.is A88C8ADD129828D7EAC02E52E22F9BBFEE348588 :: https://ea.n0.is/keys/ --rhpp4fbt4wy637lc Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlpbSK0ACgkQ4i+bv+40 hYhzXxAArDgVnBuXsW8jofkbBp4Iq843KaULtKxF3QcKzT1ZXO4x6S1XCAc9C9bg QY941InFbH8C2hSzmfKsK9RXSmzfsUn3cdsxmE+rL7LKd7YIAlc4B/dvLiMW0Vuq SlRNpWzYRnvXLJRSJFWg02s91pKa90klINTQfLvlQMvgCm6lAclxs8ufkgPuRMyu 24xQtO1pBOA6meOa4C13Z1XhaWLoknvci/n1IsnANszV8iYZ/iW2YQqc4x9ebCoq rBn9/WvC/piGwafWEdnWgTaoYw9CWRLGuoBoTXprpU/wiVudUfrgSbTOJsmg03hg zG82KX96FcVvwtWLkXMm/jRAt3inuxbtCogACOjYcWXSV5iz/Hrgvx4X6jCO0GdX lg/ew4No+6kytOmDPG9SM6z+wBfcvgg7SFP93CYDwj5xHqJujhRN6t+5hL3c2XUL uB6MMZW7Fs4bbbweY9Eb7o/1klit5I/6olHSP/FbB0U5rGM3wW/Y6HMmfdpqyFqI lOSPBNbQUqyAWWyI7Ffl+SlcOnSdiqcKrw1UMs5e9gQqZu7IlbRv2XiNm6deD78P vRHAtDAEb9VpTImWOwRJnYs6VD3kNnAtkRmTDWVYkD7I8iPeP0bMcSivjtQXm1dq jRNOqVyJE2IbVOnmdHU+lH5M3J3ImyR5trLadggQLaQ89lVV3oQ= =FWRC -----END PGP SIGNATURE----- --rhpp4fbt4wy637lc-- From debbugs-submit-bounces@debbugs.gnu.org Tue Jan 16 09:18:23 2018 Received: (at 28004) by debbugs.gnu.org; 16 Jan 2018 14:18:24 +0000 Received: from localhost ([127.0.0.1]:58201 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebS4F-0000Ze-MY for submit@debbugs.gnu.org; Tue, 16 Jan 2018 09:18:23 -0500 Received: from hera.aquilenet.fr ([185.233.100.1]:54066) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebS4B-0000ZR-1m for 28004@debbugs.gnu.org; Tue, 16 Jan 2018 09:18:22 -0500 Received: from localhost (localhost [127.0.0.1]) by hera.aquilenet.fr (Postfix) with ESMTP id 9B2AB10D98; Tue, 16 Jan 2018 15:18:18 +0100 (CET) X-Virus-Scanned: Debian amavisd-new at aquilenet.fr Received: from hera.aquilenet.fr ([127.0.0.1]) by localhost (hera.aquilenet.fr [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id ZxJyusxxCJ6y; Tue, 16 Jan 2018 15:18:18 +0100 (CET) Received: from ribbon (unknown [193.50.110.60]) by hera.aquilenet.fr (Postfix) with ESMTPSA id D198510CF0; Tue, 16 Jan 2018 15:18:17 +0100 (CET) From: ludo@gnu.org (Ludovic =?utf-8?Q?Court=C3=A8s?=) To: Marius Bakke Subject: Re: [bug#28004] Chromium References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 27 =?utf-8?Q?Niv=C3=B4se?= an 226 de la =?utf-8?Q?R?= =?utf-8?Q?=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Tue, 16 Jan 2018 15:18:16 +0100 In-Reply-To: <87373cey5b.fsf@fastmail.com> (Marius Bakke's message of "Fri, 12 Jan 2018 01:09:04 +0100") Message-ID: <87vag16g5z.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/25.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: 1.0 (+) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 , Leo Famulari X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 1.0 (+) Hi Marius, Marius Bakke skribis: > The attached patch adds Spectre mitigation to the current Chromium > release. The patch was pulled from the Chrome 64 branch: > > From b011b57f357af97f3a003a3b1c481fc8bd2b869c Mon Sep 17 00:00:00 2001 > From: Marius Bakke > Date: Thu, 11 Jan 2018 14:36:47 +0100 > Subject: [PATCH] gnu: chromium: Add spectre mitigation. > > * gnu/packages/patches/chromium-spectre-mitigation.patch: New file. > * gnu/local.mk (dist_patch_DATA): Register it. > * gnu/packages/chromium.scm (chromium)[source]: Use it. I didn=E2=80=99t really follow the whole discussion :-), but if what you ha= ve is now OK from the freedom and security viewpoints (including bundling), perhaps you can go ahead? Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Tue Jan 16 14:01:43 2018 Received: (at 28004) by debbugs.gnu.org; 16 Jan 2018 19:01:43 +0000 Received: from localhost ([127.0.0.1]:59067 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebWUQ-00050n-V0 for submit@debbugs.gnu.org; Tue, 16 Jan 2018 14:01:43 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:45871) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebWUL-00050a-3N for 28004@debbugs.gnu.org; Tue, 16 Jan 2018 14:01:39 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 6C6BA20BFE; Tue, 16 Jan 2018 14:01:36 -0500 (EST) Received: from frontend1 ([10.202.2.160]) by compute5.internal (MEProxy); Tue, 16 Jan 2018 14:01:36 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=3Pfe7GLKCwFVZhIUwMDOARSQK4T+ny7GwACtIBF0UBI=; b=SPnOpVwE 43bgDf1dchbU1dpbuqyRdm89JeyMG9KR4hDr0eV21m+i0ywzFwDMRZXXExTB3zhR 4/SF+wHuQ8kAWqNsbgqGKef9LsIm0kxohEBL3rAKc9J9ikJmQX5pAwz1VQIGo1eY 1AAZXxQF89cY22JHBOmqq9I8HnDLeqBy5XVgxxNW0kzOvvsN/2VcpmOoaiGbn1z3 CYPMjKHR1JRLmJ88vcQKZHbjoaVevIU6h9+qYT29kET4qn0mbM1OwcXjXpYozIIX op+47NbwF1IXajPQDx57KrIEOKc4E+FXpY4k9orerhx7exDjIYSQTf1GWMVMH+Kz MG2aRdc4C86OVg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm1; bh=3Pfe7GLKCwFVZhIUwMDOARSQK4T+n y7GwACtIBF0UBI=; b=eQL/ifVfX1DuMv0NurEaTET4nA3kuLM6r3DHRiyHU7/sg m5e2G4AOus35kZbx94ZWi8KU/DcKhyeJz4nbtnXXBXxxWCeb+VjBhieEtCaV+z4y I9QgzNDtrC+pdY7IiCGLO/2v1W9z+RTJzkbxipYzxv51HyzKVnnBH1cVJl+nJrVJ f2ypGSP8cStQaNull66ImQZgCWY4MDpaGmvY/oesX8BYR9Tw9dCp9KfDCfnlJVMN kcP2l7AsPAmIQuL9mdp3eYbpe3WLYRLBpKXWZohTUQd5EqMpV0llu7DlWsZv31pz zrEweY4x8S/QxtGKAHKnTwnYNOFfP1o1jmbFXySgw== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id DA0E97E3D4; Tue, 16 Jan 2018 14:01:35 -0500 (EST) From: Marius Bakke To: Ludovic =?utf-8?Q?Court=C3=A8s?= Subject: Re: [bug#28004] Chromium In-Reply-To: <87vag16g5z.fsf@gnu.org> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> User-Agent: Notmuch/0.26 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Tue, 16 Jan 2018 20:01:34 +0100 Message-ID: <87fu75aar5.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 , Leo Famulari X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Ludovic Court=C3=A8s writes: > Hi Marius, > > Marius Bakke skribis: > >> The attached patch adds Spectre mitigation to the current Chromium >> release. The patch was pulled from the Chrome 64 branch: >> >> From b011b57f357af97f3a003a3b1c481fc8bd2b869c Mon Sep 17 00:00:00 2001 >> From: Marius Bakke >> Date: Thu, 11 Jan 2018 14:36:47 +0100 >> Subject: [PATCH] gnu: chromium: Add spectre mitigation. >> >> * gnu/packages/patches/chromium-spectre-mitigation.patch: New file. >> * gnu/local.mk (dist_patch_DATA): Register it. >> * gnu/packages/chromium.scm (chromium)[source]: Use it. > > I didn=E2=80=99t really follow the whole discussion :-), but if what you = have is > now OK from the freedom and security viewpoints (including bundling), > perhaps you can go ahead? I believe this is pretty much ready. However Chromium 64 is due in one week, so I'll wait for that. Meanwhile I'll try to get rid of the default "most used" sites which links to the nonfree Web Store. Not sure what to put in the description. Can I hire Tobias for this? :P If there are no objections, expect to see this in 'master' in 1-2 weeks. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlpeTA4ACgkQoqBt8qM6 VPqvkAf8DWaQTEwZG4k8tUyN0YpBoeWn61SGaMl4YFsID0u8ZTgZJl84Zl4qBsbh YZOE+DtciImNSUp4BPEJYtGcEIS75YKM8tvPgXUWUJFbUZLrHgHU7S/Dfd2LVIuh cmqLhaxTVj0qEzK9xRtpqlEmNarHtryMniHvZS5vgqVw+cqBYCzYO/IrO/mD1MW5 g5tGu3zwPvms0uS/ku4s3w0vqKjtRIRomnRr0eOToq9sUBG6ANFwVMfNB6Ua71jW QTSRyKdjVZYe7bK60kawtvW24I5PtziV++6jzVunQWlqIlQviDx3nxLjq4yAYSd9 +6Q91PkIa/fBJxkiXd65UuB8424biQ== =TzwX -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Tue Jan 16 14:04:58 2018 Received: (at 28004) by debbugs.gnu.org; 16 Jan 2018 19:04:58 +0000 Received: from localhost ([127.0.0.1]:59071 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebWXa-00055O-HC for submit@debbugs.gnu.org; Tue, 16 Jan 2018 14:04:58 -0500 Received: from aibo.runbox.com ([91.220.196.211]:50856) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebWXU-000558-Tg for 28004@debbugs.gnu.org; Tue, 16 Jan 2018 14:04:55 -0500 Received: from [10.9.9.211] (helo=mailfront11.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1ebWXO-0004bI-Ss; Tue, 16 Jan 2018 20:04:47 +0100 Received: from dslb-088-078-094-182.088.078.pools.vodafone-ip.de ([88.78.94.182] helo=localhost) by mailfront11.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1ebWX3-0002T0-Qb; Tue, 16 Jan 2018 20:04:25 +0100 Date: Tue, 16 Jan 2018 20:04:21 +0000 From: ng0 To: Ludovic =?utf-8?Q?Court=C3=A8s?= Subject: Re: [bug#28004] Chromium Message-ID: <20180116200421.irjxlsumisngpob5@abyayala> References: <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="paobxpciynohnxfa" Content-Disposition: inline In-Reply-To: <87vag16g5z.fsf@gnu.org> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Marius Bakke , ng0 , Leo Famulari X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --paobxpciynohnxfa Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Ludovic Court=C3=A8s transcribed 0.8K bytes: > Hi Marius, >=20 > Marius Bakke skribis: >=20 > > The attached patch adds Spectre mitigation to the current Chromium > > release. The patch was pulled from the Chrome 64 branch: > > > > From b011b57f357af97f3a003a3b1c481fc8bd2b869c Mon Sep 17 00:00:00 2001 > > From: Marius Bakke > > Date: Thu, 11 Jan 2018 14:36:47 +0100 > > Subject: [PATCH] gnu: chromium: Add spectre mitigation. > > > > * gnu/packages/patches/chromium-spectre-mitigation.patch: New file. > > * gnu/local.mk (dist_patch_DATA): Register it. > > * gnu/packages/chromium.scm (chromium)[source]: Use it. >=20 > I didn=E2=80=99t really follow the whole discussion :-), but if what you = have is > now OK from the freedom and security viewpoints (including bundling), > perhaps you can go ahead? >=20 > Ludo=E2=80=99. >=20 =46rom a usability point of view it's definitely okay, I've been using this for a while now, no crashes so far. Coming up with a way to define extensions is just a matter of placing the Lego blocks in the right position. Gentoo and other systems (maybe Nix) off= er insights. I'd say to get to a PoC package for an easy extension, under the assumption that the general integration works, it could be done in a couple of working weekends. --=20 ng0 :: https://ea.n0.is A88C8ADD129828D7EAC02E52E22F9BBFEE348588 :: https://ea.n0.is/keys/ --paobxpciynohnxfa Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlpeWsUACgkQ4i+bv+40 hYi9Lg/9HrswBaKnqUaxo3k7yWD0ZGE4vrPqtlIZX04puBYBBrziUhcrU/1EZnw6 K/JU2+UvD9jnaa8hiK6qmppjXiAASDvCny5qo/f7hl5zqETL0VD5RMxlK9cbrykQ tiDc+R5Y7BhDJOBZD66/UvBzwaXoQlgAaAMCNL4B0dXQxaMBj2MCO6dbA5ZBT30s PrauHrS0mEMb36c2tFdALk0N0vVUrX/TGeOctDCGYbTGyjppwpsoiJ1ckpN8V3FJ c6FVlWg8szKsbsuP3aj/ZhDD2vu3vXxWv5fr89NH8jipKohZrlqC9HoNBFKwPrYa Qjpp0utDALz7DAB9z8ZMVou0RPFpCQnvXwNvC5/o/+Fj7nxwfm8tApMz4DJxyGn0 jQksCdarGVYjqXv7I1c0Wa/4tN4O0T/uQ6oOYkMWvbeMYkG1NimvdZ6bQdfng6pG Q8E+ZJuL5DKak9/5HIjwgdXyA+WlhZbBeNha/QH8Vbf+dl/agABcBb00StjtDC7G QLSwe3ojIR3V2QFV6llmG8TDOYXsKGA5kHuD5ZRW+wDw1Y8YCP6C4b7gkfjWn3z4 4xmev8N40xOUkQCalXBSGu1lRb3XcvBSp0aEECdm3Y6cQLsjZoicz9RF556O5Lae vk9cAoSCNgChvKZAa1f1Ne/wnTfrixKyXYzAzG6BkQ2NZiGyUzg= =wsUS -----END PGP SIGNATURE----- --paobxpciynohnxfa-- From debbugs-submit-bounces@debbugs.gnu.org Tue Jan 16 14:06:56 2018 Received: (at 28004) by debbugs.gnu.org; 16 Jan 2018 19:06:56 +0000 Received: from localhost ([127.0.0.1]:59076 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebWZT-00058V-Vg for submit@debbugs.gnu.org; Tue, 16 Jan 2018 14:06:56 -0500 Received: from tobias.gr ([51.15.135.5]:38812) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebWZS-00058N-MF for 28004@debbugs.gnu.org; Tue, 16 Jan 2018 14:06:55 -0500 Received: by tobias.gr (OpenSMTPD) with ESMTP id dbc3edd6; Tue, 16 Jan 2018 19:06:52 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=tobias.gr; h=subject:to :cc:references:from:message-id:date:mime-version:in-reply-to :content-type; s=2018; bh=LSO/JFDn/behxcjVE+gLDRFXOI8WnJ1ZIo3aIF 6ysX4=; b=cNfpE3M81TGVerJpWl13zm2aNXzjvQC+ynBh02aL7xaHqrSWyjgEw/ jBS2KzjAIdfEsglWqVuiBR/L4UKJmpzWTeuYTbCtXoGK29ea3TTxshy0OONnSkZv voCVvDx5hPi/jINvc51TYzUGfhPZe2vHy2EwGTyEbHmWIki+5s/9eFOH9dKjjF// l0LrS+LSdCyBtdJsOniEhkOyoBLNKrIulfTorTwVx2zkTNXsUWwuRbrPTOltaSWB eDi0W+vSQz1g/IgWIaTYTxljZbZmkgSNVs76zEW4kEC4wjd6iJQuXvfsy/oZGOpR uzlP/dsTKCmoLZx24m0noqTmzStvMQaQ== Received: by submission.tobias.gr (OpenSMTPD) with ESMTPSA id 3bf9d435 (TLSv1.2:ECDHE-RSA-CHACHA20-POLY1305:256:NO); Tue, 16 Jan 2018 19:06:50 +0000 (UTC) Subject: Re: [bug#28004] Chromium To: mbakke@fastmail.com, ludo@gnu.org References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> From: Tobias Geerinckx-Rice Message-ID: Date: Tue, 16 Jan 2018 20:09:41 +0100 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:52.0) Gecko/20100101 Thunderbird/52.5.0 MIME-Version: 1.0 In-Reply-To: <87fu75aar5.fsf@fastmail.com> Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="PAnmkOQmPgvM0hm475nQZnAG89chxRqzn" X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.3 (--) This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --PAnmkOQmPgvM0hm475nQZnAG89chxRqzn Content-Type: multipart/mixed; boundary="dS7ONX2m1GhkmOBGLHH25gdFGmy02qDzr"; protected-headers="v1" From: Tobias Geerinckx-Rice To: mbakke@fastmail.com, ludo@gnu.org Cc: 28004@debbugs.gnu.org Message-ID: Subject: Re: [bug#28004] Chromium References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> In-Reply-To: <87fu75aar5.fsf@fastmail.com> --dS7ONX2m1GhkmOBGLHH25gdFGmy02qDzr Content-Type: text/plain; charset=utf-8 Content-Language: en-GB Content-Transfer-Encoding: quoted-printable Marius! Marius Bakke wrote on 16/01/18 at 20:01: > Not sure what to put in the description. Can I hire Tobias for this? := P You probably don't want me writing what I think of Chromium. Kind regards, T G-R --dS7ONX2m1GhkmOBGLHH25gdFGmy02qDzr-- --PAnmkOQmPgvM0hm475nQZnAG89chxRqzn Content-Type: application/pgp-signature; name="signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="signature.asc" -----BEGIN PGP SIGNATURE----- iIMEARYKACsWIQT12iAyS4c9C3o4dnINsP+IT1VteQUCWl5N/Q0cbWVAdG9iaWFz LmdyAAoJEA2w/4hPVW15AvMBANjXbISSYkjlnSRdV6FsczegfMkaJPKlCNrA1ZlX I0LbAQDke0gLdy9vdqYKqYPeL9bnbw9ogRdebFrFWF4bh+neDA== =1/Rp -----END PGP SIGNATURE----- --PAnmkOQmPgvM0hm475nQZnAG89chxRqzn-- From debbugs-submit-bounces@debbugs.gnu.org Tue Jan 16 14:22:36 2018 Received: (at 28004) by debbugs.gnu.org; 16 Jan 2018 19:22:36 +0000 Received: from localhost ([127.0.0.1]:59086 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebWoe-0005VQ-B6 for submit@debbugs.gnu.org; Tue, 16 Jan 2018 14:22:36 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:48879) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebWoc-0005VG-KY for 28004@debbugs.gnu.org; Tue, 16 Jan 2018 14:22:35 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 3FC6421025; Tue, 16 Jan 2018 14:22:34 -0500 (EST) Received: from frontend1 ([10.202.2.160]) by compute5.internal (MEProxy); Tue, 16 Jan 2018 14:22:34 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; bh=lex+GO6MOGLvNcbOjjMh5dGWA/H/3JLVh8ZZZewyIgo=; b=F854+qtx j9uFJlcTkPN2ps7UTU3izn9zEMTUGBsB9SWYjXLQBUIjeH3VomOw/MufYurUIuEO DDmUb1qiHdvuLRthkSCfgzft07EAoMXbi++J/WpIxbGL4fJSRlvlrPCPh+n2/Mih xDLfQTMx6WC1/qmk5rk00/d0yNtVU354TsQmTODikmLy2aJ5aeTR6YTufv0j25NI OWKtqhqq4jpk68uk4Ku6HLwTZv5XDdzXDCRHSK7ICoO6/yeSgfM2b92WTTYfoo1K X6Y8X9IEpxC6WK1g8Q/IcrCW5cyXFUiCJLRUaPYRjCvyQHYxSBV7lUrQA/kDXitU MFkRFftWspiWlg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm1; bh=lex+GO6MOGLvNcbOjjMh5dGWA/H/3 JLVh8ZZZewyIgo=; b=rh5am24bZPA1lvN0KZ26A5euPtcfYXAgg2qEzYyCuJjn1 g4mKKYqzJxcweqfrTXAmnZXNlSDx12kUofv/phH6o3NeaAFa9B1ZAdge8UkEJo87 T/S4ZaBpIjItTWdFzS056wfrnUxgS6QOpaEulhAkjW95bHJ/Ets0qvbioAuOnhX4 oi4eNWEb6kFrBXWmlDy6NbjocUY50cC2fHbm0dD+QSH9dCdm07W0Z2n+YXi5s3sT T0xNxx64RshpJDuQZdjUv8jy5wKDhGQ29w8DZ7ibGjCmSXz7ltUBkcTv6O5ZYpsc cgfpIZYeLsUP9iDktgQQgJqhAuXHIZLeMRrf7YM5Q== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id BEF9D7E34D; Tue, 16 Jan 2018 14:22:33 -0500 (EST) From: Marius Bakke To: Tobias Geerinckx-Rice , ludo@gnu.org Subject: Re: [bug#28004] Chromium In-Reply-To: References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> User-Agent: Notmuch/0.26 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Tue, 16 Jan 2018 20:22:32 +0100 Message-ID: <87d129a9s7.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --=-=-= Content-Type: text/plain Tobias Geerinckx-Rice writes: > Marius! > > Marius Bakke wrote on 16/01/18 at 20:01: >> Not sure what to put in the description. Can I hire Tobias for this? :P > > You probably don't want me writing what I think of Chromium. LOL, fair enough. I tend to assume zero-knowledge when writing descriptions and have been playing on spins of "Chromium is a browser designed to spy on the user", but carrying software with that description does not reflect very well on us...besides, I've gone great lengths to remove those antifeatures. I'd like to make it very clear that users concerned about privacy should prefer GNU IceCat though... Suggestions welcome. :-) --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlpeUPgACgkQoqBt8qM6 VPpgPwgAmY4+KJFwJRgYrPnnV6gZDjpC1GGx2IhsFIGGwMTqGzh62VKvW1Dp2bzA 1Sc+/WuWZ7grQ+XD9BGVVeb6sxFLNMOwVzPZCaoXTKElebWOZ4t1ZCPBmprA/7gh i4aErnj/T3agIMrFJLHo0kz8KqBI4UEzYkW+DTca1doWTVOebye3KGWfA5RgVaNV l2XO9Svf6K3MFNifnZnZROgzSnbc9nRdVF3VjLehd24U+riypl4W9KbNZAt4xnfP pPmwv12XUkEsv4VSoKTApLNgKN39O+PD8pLBlPK/APPjy6bjpTvtphPMnMTPpBpE BWp1m47Talkuni95eKw+FicfnLztIA== =fOnt -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Tue Jan 16 15:41:21 2018 Received: (at 28004) by debbugs.gnu.org; 16 Jan 2018 20:41:21 +0000 Received: from localhost ([127.0.0.1]:59126 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebY2q-0007Lf-Vc for submit@debbugs.gnu.org; Tue, 16 Jan 2018 15:41:21 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:53989) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebY2o-0007LS-HI for 28004@debbugs.gnu.org; Tue, 16 Jan 2018 15:41:19 -0500 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id EA41620EB5; Tue, 16 Jan 2018 15:41:17 -0500 (EST) Received: from frontend2 ([10.202.2.161]) by compute4.internal (MEProxy); Tue, 16 Jan 2018 15:41:17 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=famulari.name; h=cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= mesmtp; bh=dzKEgLkD2wjuoy2bLVvPgUBKXXLpHMR4X8jvLekZjhQ=; b=JyLou T2GKUgrTcGPNHtssM2tSvm3c0k91EXO4C3x4yncybaVCdV1Mx81JVVG/ZUvnhS9H yedg+zOt1CDbtZDXGafdNLsJpYdsLf1Pnh64zTL6eaQUlXwsak54nk77LUhLtS6d GyxgzxA8B+wn+IP7JHZN/i64fPVYMcxpLV8e+I= DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm1; bh=dzKEgLkD2wjuoy2bLVvPgUBKXXLpH MR4X8jvLekZjhQ=; b=ot3Zv6ApChH7HApILmBBa54+MYeV8fj7cg/kAq5j6n1xp 8v3mbLoMwKktx1FeuvXVXma8GqwtOGh44j0Czmtm2HoRksNDeO3cJm2rE6CC3gdo RFiCQ5i1yUyYZ7++8bwvMG0hPW+HamplLUUeL0Fys6PYxIvrQ0Yh9d/1Zevqk1+j Yt85uZGLhhLhkDSyi0l5iM1a2M8s10YTQfXB9BML1PL/uoW8VNpZ/PSJOrwdJY7R oT3yEgHYDBlrF6weylY9vYrbSkl7qy05M601YZBBaER6BkpcaHf4TnbeijSv3mnZ pk3d4sEFG5shnMtTGgYQ8h/AGu1cY8olHesmOW2og== X-ME-Sender: Received: from localhost (71-93-196-183.dhcp.nrwl.ca.charter.com [71.93.196.183]) by mail.messagingengine.com (Postfix) with ESMTPA id 7424724736; Tue, 16 Jan 2018 15:41:17 -0500 (EST) Date: Tue, 16 Jan 2018 12:41:15 -0800 From: Leo Famulari To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180116204115.GA18014@jasmine.lan> References: <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <87d129a9s7.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="huq684BweRXVnRxX" Content-Disposition: inline In-Reply-To: <87d129a9s7.fsf@fastmail.com> User-Agent: Mutt/1.9.2 (2017-12-15) X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ludo@gnu.org, Tobias Geerinckx-Rice X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --huq684BweRXVnRxX Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Tue, Jan 16, 2018 at 08:22:32PM +0100, Marius Bakke wrote: > Tobias Geerinckx-Rice writes: > > Marius Bakke wrote on 16/01/18 at 20:01: > >> Not sure what to put in the description. Can I hire Tobias for this? = :P > > > > You probably don't want me writing what I think of Chromium. >=20 > LOL, fair enough. >=20 > I tend to assume zero-knowledge when writing descriptions and have been > playing on spins of "Chromium is a browser designed to spy on the user", > but carrying software with that description does not reflect very well > on us...besides, I've gone great lengths to remove those antifeatures. >=20 > I'd like to make it very clear that users concerned about privacy should > prefer GNU IceCat though... Suggestions welcome. :-) The Synopses and Descriptions section of the manual says "Please avoid marketing phrases" and "try to be factual, mentioning use cases and features". I think we should also avoid "anti-marketing" language. Why not keep it simple and say something like this: "Chromium is a graphical web browser. This package omits the FOO, BAR, and BAZ features in order to help protect the user's privacy." The IceCat description is similarly terse. --huq684BweRXVnRxX Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEEsFFZSPHn08G5gDigJkb6MLrKfwgFAlpeY2gACgkQJkb6MLrK fwjPSQ/+OLT/vl6OjM8Xo8wIanmBEXBE8QbJce6ohtSnNJzD9SsZsU6ZGlkYG8Xo 2cK37vqHalm5N0YPHwnEEh9Fjx5MuM/fODBeiKJtHezr8oHznCqQK3hhMVqxSxIk G3+hQ76hUsiSzZb/EKClIdEEiwYm7Q6nP2k2KSudq/PDEJriJU0jtiKKdVp1de1t +wLccj9ytsr7hQQEhxVeE67eLqO+V5qpLZ8qYmsr+kS/PDn9Qd+KJg7ExSA5zD9Z ROzKXh6OyAIoLVWB9le1oprrKio96zvFw2A1fhDMmA2eYZ+sN9RyBohnzAAHxUxl jBSOBb65EAxkSEH0eeH4HBE5A7y08upvw0WBNZhTqCBRa2yLAxASjaemO3Tcw94u GJCCW50nIsMon1/ruf8ORlSi/SMG7ogd2wj6Kv3PjEBeou2G8lzt+GAiNn3O5Xee 5k9Ji/M8nHUKMLJseOMFlp4w3lVWRObvifSPGLcL3DSrT6v+h+yUM9/hGq51/ka6 QDiMj7h1xKpHr1IYUo665I2kXllmTHe9PiPb9PwX3v1R2Kp5O0ev58JVnskVcewk L6HamgKS6l42Mwj0L0DlVPpwCLwIebwkAKRmux40qKbAog0m0ybT3sTuv3qZyGQo TkXk/sh71/uR9eyDISneOIRMZb10qObHbu2Zx8knmY9tM/d51+Q= =ps9d -----END PGP SIGNATURE----- --huq684BweRXVnRxX-- From debbugs-submit-bounces@debbugs.gnu.org Wed Jan 17 03:53:22 2018 Received: (at 28004) by debbugs.gnu.org; 17 Jan 2018 08:53:22 +0000 Received: from localhost ([127.0.0.1]:59392 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebjTG-0000wW-5R for submit@debbugs.gnu.org; Wed, 17 Jan 2018 03:53:22 -0500 Received: from hera.aquilenet.fr ([185.233.100.1]:38976) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebjTF-0000wP-1j for 28004@debbugs.gnu.org; Wed, 17 Jan 2018 03:53:21 -0500 Received: from localhost (localhost [127.0.0.1]) by hera.aquilenet.fr (Postfix) with ESMTP id 592D610F63; Wed, 17 Jan 2018 09:53:20 +0100 (CET) X-Virus-Scanned: Debian amavisd-new at aquilenet.fr Received: from hera.aquilenet.fr ([127.0.0.1]) by localhost (hera.aquilenet.fr [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id xq8B6JHAsYM0; Wed, 17 Jan 2018 09:53:18 +0100 (CET) Received: from ribbon (unknown [IPv6:2a01:e0a:1d:7270:af76:b9b:ca24:c465]) by hera.aquilenet.fr (Postfix) with ESMTPSA id 4BDE510F60; Wed, 17 Jan 2018 09:53:18 +0100 (CET) From: ludo@gnu.org (Ludovic =?utf-8?Q?Court=C3=A8s?=) To: Marius Bakke Subject: Re: [bug#28004] Chromium References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 28 =?utf-8?Q?Niv=C3=B4se?= an 226 de la =?utf-8?Q?R?= =?utf-8?Q?=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Wed, 17 Jan 2018 09:53:17 +0100 In-Reply-To: <87fu75aar5.fsf@fastmail.com> (Marius Bakke's message of "Tue, 16 Jan 2018 20:01:34 +0100") Message-ID: <87po687toi.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/25.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: 1.0 (+) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 , Leo Famulari X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 1.0 (+) Hello, Marius Bakke skribis: > I believe this is pretty much ready. However Chromium 64 is due in one > week, so I'll wait for that. Meanwhile I'll try to get rid of the > default "most used" sites which links to the nonfree Web Store. Oh yes, we should definitely do that. > Not sure what to put in the description. Can I hire Tobias for this? :P > > If there are no objections, expect to see this in 'master' in 1-2 weeks. Sounds good. Quite an achievement! Thanks, Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Wed Jan 17 09:55:45 2018 Received: (at 28004) by debbugs.gnu.org; 17 Jan 2018 14:55:46 +0000 Received: from localhost ([127.0.0.1]:60254 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebp7x-0003Dp-LV for submit@debbugs.gnu.org; Wed, 17 Jan 2018 09:55:45 -0500 Received: from eggs.gnu.org ([208.118.235.92]:40391) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ebp7u-00039w-3e for 28004@debbugs.gnu.org; Wed, 17 Jan 2018 09:55:43 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1ebp7n-0006Sb-Ql for 28004@debbugs.gnu.org; Wed, 17 Jan 2018 09:55:36 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,T_RP_MATCHES_RCVD autolearn=disabled version=3.3.2 Received: from fencepost.gnu.org ([2001:4830:134:3::e]:35284) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1ebp7n-0006SG-OA; Wed, 17 Jan 2018 09:55:35 -0500 Received: from localhost ([::1]:41428 helo=mikegerwitz-pc.gerwitz.local) by fencepost.gnu.org with esmtps (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.82) (envelope-from ) id 1ebp7n-0006rJ-Dk; Wed, 17 Jan 2018 09:55:35 -0500 From: Mike Gerwitz To: Marius Bakke Subject: Re: [bug#28004] Chromium In-Reply-To: <87fu75aar5.fsf@fastmail.com> (Marius Bakke's message of "Tue, 16 Jan 2018 20:01:34 +0100") Date: Wed, 17 Jan 2018 09:55:16 -0500 Message-ID: <874lnkr0vf.fsf@gnu.org> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/25.3 (gnu/linux) OpenPGP: id=22175B02E626BC98D7C0C2E5F22BB8158EE30EAB MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Received-From: 2001:4830:134:3::e X-Spam-Score: -5.0 (-----) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -5.0 (-----) --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable On Tue, Jan 16, 2018 at 20:01:34 +0100, Marius Bakke wrote: > If there are no objections, expect to see this in 'master' in 1-2 weeks. I want to express gratitude for your hard work on this---given that IceCat does not contain many of the FF devtool updates, Chromium is very desirable for web development. It's also needed for certain Node.js tools, like node-inspector. So, thank you! =2D-=20 Mike Gerwitz Free Software Hacker+Activist | GNU Maintainer & Volunteer GPG: D6E9 B930 028A 6C38 F43B 2388 FEF6 3574 5E6F 6D05 https://mikegerwitz.com --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- Version: GnuPG v2 iQIcBAEBCgAGBQJaX2PUAAoJEIyRe39dxRuiRZgP/iZfOgozMPR3XNHTPVpEbpNc W9WjD5lQtDsX3cAUimLEoxGX5ehxvRGats0Ffhb2+Ui4oCFq7I2FeznwZ5UM7TmC /bAFedXVFQOrmHRAwp0Uc9ZswiyvsmBNFYiZZMKW46RBwFhLdDqySkWCRfgfzoQa 87KCQ8WpBRlip4BKlg8+++FoGXzad5L65Ii0tdAKShUC0CbdPeGCGL3ugl6u47qA D9LuSEKzxWW7IlQ+d4ZMdNrASWdhl+468gmfrK2MQAStpbx/TXfYZvFgi9Gky5si nzVMkvKho9nFGmTL3e5xrf2IJvGgz4PQ5mFWOP5siTYh13xTwoLhpnWOE/T9o5kR bLcJ81xXpTkxU1CxjD+C17Xy55s6dJD5ZFHOI3EVBwSFdUnmox3aUbPXLwy4Yyvw 2bZrjCnXGaZKyHGGCdhwNrmaywBJ4rRQ/juB9qTy3fGPWqEI4GkTP613JnwxiJHe 8xVShgHvX5EztPodXnt+LeRV9lhOUsY5yZMgm7wNmyIl/0wt3Gm9N3yL1EZcUGxe oNSRSRekCSvfjEY7kMmoHdjNGat3qAe6ynqxJ3eUFWz4zR0ZqoeQRcF6bB/R6G1e pgLFJAKigXjZ84XVcycz4f1UkEdwWPwb0Wsulu7yBzCyQNY/3aE+BJPjAQ/kRnxF vg6clndP1X+MRNcK0e8q =UADH -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 26 13:18:43 2018 Received: (at 28004) by debbugs.gnu.org; 26 Feb 2018 18:18:43 +0000 Received: from localhost ([127.0.0.1]:33822 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqNMJ-0000uH-Hl for submit@debbugs.gnu.org; Mon, 26 Feb 2018 13:18:43 -0500 Received: from out2-smtp.messagingengine.com ([66.111.4.26]:45059) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqNMH-0000u9-Dh for 28004@debbugs.gnu.org; Mon, 26 Feb 2018 13:18:42 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 00B2F20CA7; Mon, 26 Feb 2018 13:18:41 -0500 (EST) Received: from frontend2 ([10.202.2.161]) by compute5.internal (MEProxy); Mon, 26 Feb 2018 13:18:41 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; bh=OXlz0t9qFCpXPphzgsBO1rJy3iAODoVg9LuUFPwRCss=; b=Y5VSuHll J2wWB9lBlMY3RGbPgrXqrvqMfImjq+q00ZTix+RAqj7k5ElpLCDkZZ2XYyT1WNtY aJ18y7OyzEDmq4v20AcwwnHQl2OMrtFL9ZALpxgPi2FFulqo9MBo0zPcA7zqH8Xg e5pCTyDf4FqhULzky2tUeLnzL9ZR3WrwSZ0Z3fAp/OfZQ2IbNDtHCy1k/TZWkvaY E7SZeEsZKC2YQX3qzwI65WIrxdiiWgnbnPpoQdg4ULLb5aSZObH89YxX8vwWbPKo DBngTnHomYeFzjPxawFeWywEX6HgK6/sW6kk0Z4eCuzSN/spLHmtkAKvCr7Sqp2+ B9rXhwhJIKzKnA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm2; bh=OXlz0t9qFCpXPphzgsBO1rJy3iAOD oVg9LuUFPwRCss=; b=DhSU/HxX6gQcG9O3p7QQ+7V6a++EniCqscyQes4nOG5l0 fCMfG4XFxdtf9ULNsAFpJcvqRV1G4cpwd0YMgL4ea93eY6er91j/OF8y1kvoNHZ8 CrxANwkrUADhsO6MfwDL6OdX23ZgLeyLxaS8/xGzf7oZqEBXHAzJy5RLvqiJypyG fS/ddljahclGnLB1Ih57FGzqM3flkGYFybKpYEun7VJOSbjgAf8HqG4UVewQlnyD 0bXLCwCqXgRPtqi6s0R9LbPEvdq4c/hN42ua+lNRr5MiM/6dgik/WXbmYv/egpbw GotIWhDXb3YwzlHMr9fCxOmQjF+62dMZkxJwi8DLw== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id 7C52C244F9; Mon, 26 Feb 2018 13:18:40 -0500 (EST) From: Marius Bakke To: Mike Gerwitz Subject: Re: [bug#28004] Chromium In-Reply-To: <874lnkr0vf.fsf@gnu.org> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> User-Agent: Notmuch/0.26 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Mon, 26 Feb 2018 19:18:39 +0100 Message-ID: <87vaejvclc.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --=-=-= Content-Type: text/plain Mike Gerwitz writes: > On Tue, Jan 16, 2018 at 20:01:34 +0100, Marius Bakke wrote: >> If there are no objections, expect to see this in 'master' in 1-2 weeks. > > I want to express gratitude for your hard work on this---given that > IceCat does not contain many of the FF devtool updates, Chromium is very > desirable for web development. It's also needed for certain Node.js > tools, like node-inspector. > > So, thank you! Thank *you* for the kind words! :-) Here is the latest iteration of this patch. New in this version: * Chromium 64 (duh). * The 'delete-bundled-software' phase has been moved to a snippet, shaving ~100MiB (~22%) off the compressed tarball size (and drastically reduces (de)compression time). * The New Tab page does not show any thumbnails for new profiles. I've also added more comments about the patches and other flags. Now, when launching the browser for the first time, it *still* connects to Google services. After a while it also does a lookup for AdWords... However subsequent launches are "silent" as long as the Web Store is disabled and "--disable-background-networking" is passed, like the wrapper script does. Incidentally, now that IceCat supports WebRTC (and somehow plugged the IP address leak[0]!), I no longer *need* this package. However, having multiple high quality browsers at hand is a huge advantage IMO, so I'd still like to have it in Guix. What do y'all think? Feedback on the snippet and description very welcome. [0] https://en.wikipedia.org/wiki/WebRTC#Concerns --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlqUT38ACgkQoqBt8qM6 VPrloggAq1FiRB2E8ycl17PaYtQw+w44/QaCDprS69Pz1vuWg05EthVcTgcvPGZb fwLk13vLYcNlsI/ka7QHuov0XNb71O8CV/vt4AhReVZVVnIoXF5z/BmsKoSNd2u1 5LG0X/6tUi6ICdnsni/A1LzG63Gk+JZpctVS0lvrqqikWdzXrdfn4vvpZj+O9waL +OQKv7qXWINLP7utj3jypfG4N17Sy0THsJpddBoyNYXjAEcu5M9VQdHQGWd/ptup EA9N97iPqbOF9XmccEzxLbga2WfJ+SI+Wd5wefmz/6UbMmUBkhf6WXH3SdtYfF4b pESr7422UheU1oWZzPzRtryma+AU2Q== =T/a0 -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 26 13:19:34 2018 Received: (at 28004) by debbugs.gnu.org; 26 Feb 2018 18:19:34 +0000 Received: from localhost ([127.0.0.1]:33828 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqNMz-0000vX-Rk for submit@debbugs.gnu.org; Mon, 26 Feb 2018 13:19:34 -0500 Received: from out2-smtp.messagingengine.com ([66.111.4.26]:47529) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqNMu-0000vM-3C for 28004@debbugs.gnu.org; Mon, 26 Feb 2018 13:19:24 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 03A2220C74; Mon, 26 Feb 2018 13:19:20 -0500 (EST) Received: from frontend2 ([10.202.2.161]) by compute5.internal (MEProxy); Mon, 26 Feb 2018 13:19:20 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-transfer-encoding:content-type:date:from:message-id :mime-version:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; bh=eu4901N7PoAhwUgY8vJb5t5/rPH8ClQq+OgyWAoewHs=; b=okNFSdoz ADzunFbefjr3G20g3koiyqNiSdWw4E6xEetYoZpTCbrlbAxtAEhcXd759zJzhWl0 iVr1y1JhQaYlpmz/tXe06Aj5Ud4wA4dGIHITHyIAA2sds5JAZV2F9jgHxtZU/nj0 9WhciF/kAhKYDwmXvYO/jExSAMeG57BYyc4xN7zJ6l5aeU3tKhP3N2+h3uRgnx2Z VmdHXBhw7qcMzfkC6/QAKCzQ39IA9xM+9z3cjE30v4lf1JJQcl9KCX7gAUvbghn3 +W688/5wQMaIe+lPXMI8f5UR1Ba4IbHk0HVcyI8lUPamHom9U8vd3ZRwEstmypFx T04AkQndq+i+Lw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-transfer-encoding:content-type :date:from:message-id:mime-version:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm2; bh=eu4901N7PoAhwUgY8vJb5t5/rPH8C lQq+OgyWAoewHs=; b=mugTzztuAt9uWZqPmiNR12JYgQEan/6ghbnT0B6PhCCRU Z3VfLrstYERMS0MjDtg4LT+jlHkujohXvpiXNqw/5vu/lBmArbgrscFknEciCrv6 lP7VfU59UGoqmnniyiypelEOFDvVxJCpyi+2csxWnKghcVc9bkCw2cOdy2uqsuv5 dW0xvUVK6CYJQyZBfnEfhV+IzqPR7MerAlzw9wATZzxtyr7KwWCjuWhd6fHkCxlw IRBCcUoZoGOyI4Kwofn0xCLKbaRvUfN7i6I0vNweBZIjyXDvfwh579laKCLU9Svs AISMcHzwk4c3xa4k2kT1wAAW8os9pKT/fkbZ5DltQ== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id 3157C246C8; Mon, 26 Feb 2018 13:19:19 -0500 (EST) From: Marius Bakke To: 28004@debbugs.gnu.org Subject: [PATCH] gnu: Add chromium. Date: Mon, 26 Feb 2018 19:19:14 +0100 Message-Id: <20180226181914.18955-1-mbakke@fastmail.com> X-Mailer: git-send-email 2.16.2 MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: Marius Bakke X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.0 (/) * gnu/packages/chromium.scm: New file. * gnu/packages/patches/chromium-gcc.patch, gnu/packages/patches/chromium-remove-default-history.patch: New files. * gnu/local.mk: Record it. --- gnu/local.mk | 3 + gnu/packages/chromium.scm | 756 +++++++++++++++++++++ gnu/packages/patches/chromium-gcc5.patch | 39 ++ .../patches/chromium-remove-default-history.patch | 13 + 4 files changed, 811 insertions(+) create mode 100644 gnu/packages/chromium.scm create mode 100644 gnu/packages/patches/chromium-gcc5.patch create mode 100644 gnu/packages/patches/chromium-remove-default-history.patch diff --git a/gnu/local.mk b/gnu/local.mk index fa98810d6..fb1320f7b 100644 --- a/gnu/local.mk +++ b/gnu/local.mk @@ -92,6 +92,7 @@ GNU_SYSTEM_MODULES = \ %D%/packages/check.scm \ %D%/packages/chemistry.scm \ %D%/packages/chez.scm \ + %D%/packages/chromium.scm \ %D%/packages/ci.scm \ %D%/packages/cinnamon.scm \ %D%/packages/cmake.scm \ @@ -581,6 +582,8 @@ dist_patch_DATA = \ %D%/packages/patches/ceph-skip-collect-sys-info-test.patch \ %D%/packages/patches/ceph-skip-unittest_blockdev.patch \ %D%/packages/patches/chmlib-inttypes.patch \ + %D%/packages/patches/chromium-gcc5.patch \ + %D%/packages/patches/chromium-remove-default-history.patch \ %D%/packages/patches/clang-libc-search-path.patch \ %D%/packages/patches/clang-3.8-libc-search-path.patch \ %D%/packages/patches/clang-runtime-asan-build-fixes.patch \ diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm new file mode 100644 index 000000000..1dd77b089 --- /dev/null +++ b/gnu/packages/chromium.scm @@ -0,0 +1,756 @@ +;;; GNU Guix --- Functional package management for GNU +;;; Copyright © 2016, 2017, 2018 Marius Bakke +;;; +;;; This file is part of GNU Guix. +;;; +;;; GNU Guix is free software; you can redistribute it and/or modify it +;;; under the terms of the GNU General Public License as published by +;;; the Free Software Foundation; either version 3 of the License, or (at +;;; your option) any later version. +;;; +;;; GNU Guix is distributed in the hope that it will be useful, but +;;; WITHOUT ANY WARRANTY; without even the implied warranty of +;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +;;; GNU General Public License for more details. +;;; +;;; You should have received a copy of the GNU General Public License +;;; along with GNU Guix. If not, see . + +(define-module (gnu packages chromium) + #:use-module ((guix licenses) #:prefix license:) + #:use-module (guix packages) + #:use-module (guix download) + #:use-module (guix git-download) + #:use-module (guix utils) + #:use-module (guix build-system gnu) + #:use-module (gnu packages) + #:use-module (gnu packages assembly) + #:use-module (gnu packages base) + #:use-module (gnu packages bison) + #:use-module (gnu packages compression) + #:use-module (gnu packages cups) + #:use-module (gnu packages curl) + #:use-module (gnu packages databases) + #:use-module (gnu packages fontutils) + #:use-module (gnu packages ghostscript) + #:use-module (gnu packages gl) + #:use-module (gnu packages glib) + #:use-module (gnu packages gnome) + #:use-module (gnu packages gnuzilla) + #:use-module (gnu packages gperf) + #:use-module (gnu packages gtk) + #:use-module (gnu packages icu4c) + #:use-module (gnu packages image) + #:use-module (gnu packages libevent) + #:use-module (gnu packages libffi) + #:use-module (gnu packages libusb) + #:use-module (gnu packages linux) + #:use-module (gnu packages kerberos) + #:use-module (gnu packages ninja) + #:use-module (gnu packages node) + #:use-module (gnu packages pciutils) + #:use-module (gnu packages photo) + #:use-module (gnu packages pkg-config) + #:use-module (gnu packages protobuf) + #:use-module (gnu packages pulseaudio) + #:use-module (gnu packages python) + #:use-module (gnu packages python-web) + #:use-module (gnu packages regex) + #:use-module (gnu packages serialization) + #:use-module (gnu packages speech) + #:use-module (gnu packages tls) + #:use-module (gnu packages valgrind) + #:use-module (gnu packages version-control) + #:use-module (gnu packages video) + #:use-module (gnu packages xiph) + #:use-module (gnu packages xml) + #:use-module (gnu packages xdisorg) + #:use-module (gnu packages xorg)) + +(define (strip-directory-prefix pathspec) + "Return everything after the last '/' in PATHSPEC." + (let ((index (string-rindex pathspec #\/))) + (if index + (string-drop pathspec (+ 1 index)) + pathspec))) + +(define (chromium-patch-file-name pathspec) + (let ((patch-name (strip-directory-prefix pathspec))) + (if (string-prefix? "chromium-" patch-name) + patch-name + (string-append "chromium-" patch-name)))) + +;; https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/tree/debian/patches +(define (debian-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append + "https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git" + "/plain/debian/patches/" pathspec "?id=" revision)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://gitweb.gentoo.org/repo/gentoo.git/tree/www-client/chromium/files +(define (gentoo-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-client" + "/chromium/files/" pathspec "?id=" revision)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://github.com/gcarq/inox-patchset +(define (inox-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append "https://raw.githubusercontent.com/gcarq/inox-patchset/" + revision "/" pathspec)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://github.com/NixOS/nixpkgs/tree/master/pkgs/applications/networking/browsers/chromium +(define (nixos-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append "https://raw.githubusercontent.com/NixOS/nixpkgs/" + revision "/pkgs/applications/networking/browsers" + "/chromium/patches/" pathspec)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; Fix build for older versions of GCC. +(define %chromium-angle-gcc-compat.patch + (gentoo-patch "chromium-angle-r0.patch" + "08971011b4d6fa37aa906920fba7564e48b9e60b" + "0izdrqwsyr48117dhvwdsk8c6dkrnq2njida1q4mb1lagvwbz7gc")) + +;; https://webrtc-review.googlesource.com/9384 +(define %chromium-webrtc-gcc-compat.patch + (gentoo-patch "chromium-webrtc-r0.patch" + "08971011b4d6fa37aa906920fba7564e48b9e60b" + "0qj5b4w9kav51ylpdf38vm5w7p2gx4qp8p45vrfggp7miicg9cmw")) + +;; https://chromium-review.googlesource.com/813737 +(define %chromium-memcpy.patch + (gentoo-patch "chromium-memcpy-r0.patch" + "08971011b4d6fa37aa906920fba7564e48b9e60b" + "1d3vra59wjg2lva7ddv55ff6l57mk9k50llsplr0b7vxk0lh0ps5")) + +(define %chromium-system-nspr.patch + (debian-patch "system/nspr.patch" + "debian/64.0.3282.119-2" + "0pcwk3jsx8hjzd4s1v7p11jd8vpdqfnq82di31222cjx0bl6275r")) + +(define %chromium-system-libevent.patch + (debian-patch "system/event.patch" + "debian/64.0.3282.119-2" + "1dxzn1yf05mzf21c25sczj4zhkknf03x9bc3xzznqpvnsf3cjpr0")) + +(define %chromium-system-icu.patch + (debian-patch "system/icu.patch" + "debian/64.0.3282.119-2" + "0kf77d8lyma3w0xpgfv2k0c741zp6ii08gzllfja6d5s59c15ylv")) + +;; Don't show a warning about missing API keys. +(define %chromium-disable-api-keys-warning.patch + (debian-patch "disable/google-api-warning.patch" + "debian/64.0.3282.119-2" + "1932xkrskm4nnglzj6xfjpycx4chsycj9ay3ipkq5f6xk21a1xm0")) + +;; Add DuckDuckGo and set it as the default search engine. +(define %chromium-duckduckgo.patch + (inox-patch "0011-add-duckduckgo-search-engine.patch" + "d655594419af6b82a2a070e4d3eedd926a04fa79" + "0p8x98g71ngkd3wbl5q36wrl18ff185sfrr5fcwjbgrv3v7r6ra7")) + +;; Don't start a "Login Wizard" at first launch. +(define %chromium-first-run.patch + (inox-patch "0018-disable-first-run-behaviour.patch" + "d655594419af6b82a2a070e4d3eedd926a04fa79" + "1y4zsqqf2125jkb1phwy9g5hcbd9xhyv5lr4xcaly66rpdzx2ayb")) + +;; Use privacy-preserving defaults. +(define %chromium-default-preferences.patch + (inox-patch "0006-modify-default-prefs.patch" + "d655594419af6b82a2a070e4d3eedd926a04fa79" + "0qpd5l3wiw7325cicjzvdql0gay7jl4afml4nrbmy3w40i1ai2rf")) + +;; Recent versions of Chromium may load a remote search engine on the +;; New Tab Page, causing unnecessary and involuntary network traffic. +(define %chromium-restore-classic-ntp.patch + (inox-patch "0008-restore-classic-ntp.patch" + "d655594419af6b82a2a070e4d3eedd926a04fa79" + "0lj018q6vd6m43cj8rnraqgi4lp2iq76i1i0078dav4cxnzdryfs")) + +(define opus+custom + (package (inherit opus) + (name "opus+custom") + (arguments + `(;; Opus Custom is an optional extension of the Opus + ;; specification that allows for unsupported frame + ;; sizes. Chromium requires that this is enabled. + #:configure-flags '("--enable-custom-modes") + ,@(package-arguments opus))))) + +(define libvpx+experimental + (package + (inherit libvpx) + (name "libvpx+experimental") + (arguments + `(,@(substitute-keyword-arguments (package-arguments libvpx) + ((#:configure-flags flags ''()) + ;; Spatial SVC is an experimental VP9 encoder required by Chromium. + `(cons* "--enable-experimental" "--enable-spatial-svc" + ,flags))))))) + +(define-public chromium + (package + (name "chromium") + (version "64.0.3282.186") + (synopsis "Graphical web browser") + (source (origin + (method url-fetch) + (uri (string-append "https://commondatastorage.googleapis.com/" + "chromium-browser-official/chromium-" + version ".tar.xz")) + (sha256 + (base32 + "0q0q1whspmzyln04gxhgl3jd2vrgb4imh8r9qw6c06i3b63j3l2z")) + (patches (list %chromium-duckduckgo.patch + %chromium-default-preferences.patch + %chromium-first-run.patch + %chromium-restore-classic-ntp.patch + %chromium-angle-gcc-compat.patch + %chromium-webrtc-gcc-compat.patch + %chromium-memcpy.patch + %chromium-system-icu.patch + %chromium-system-nspr.patch + %chromium-system-libevent.patch + %chromium-disable-api-keys-warning.patch + (search-patch "chromium-gcc5.patch") + (search-patch "chromium-remove-default-history.patch"))) + (modules '((srfi srfi-1) + (ice-9 ftw) + (ice-9 regex) + (guix build utils))) + (snippet + '(begin + (let ((preserved-files + (map + (lambda (path) (string-append "./" path)) + (list + "base/third_party/dmg_fp" + "base/third_party/dynamic_annotations" + "base/third_party/icu" + "base/third_party/libevent" + "base/third_party/nspr" + "base/third_party/superfasthash" + "base/third_party/symbolize" ;glog + "base/third_party/xdg_mime" + "base/third_party/xdg_user_dirs" + "buildtools/third_party/libc++" + "chrome/third_party/mozilla_security_manager" + "courgette/third_party" + "net/third_party/mozilla_security_manager" + "net/third_party/nss" + "third_party/adobe/flash/flapper_version.h" + ;; FIXME: This is used in: + ;; * ui/webui/resources/js/analytics.js + ;; * ui/file_manager/ + "third_party/analytics" + "third_party/angle" + "third_party/angle/src/common/third_party/base" + "third_party/angle/src/common/third_party/smhasher" + "third_party/angle/src/third_party/compiler" + "third_party/angle/src/third_party/libXNVCtrl" + "third_party/angle/src/third_party/trace_event" + "third_party/blink" + "third_party/boringssl" + "third_party/boringssl/src/third_party/fiat" + "third_party/breakpad" + "third_party/brotli" + "third_party/cacheinvalidation" + "third_party/catapult" + "third_party/catapult/common/py_vulcanize/third_party/rcssmin" + "third_party/catapult/common/py_vulcanize/third_party/rjsmin" + "third_party/catapult/third_party/polymer" + "third_party/catapult/tracing/third_party/d3" + "third_party/catapult/tracing/third_party/gl-matrix" + "third_party/catapult/tracing/third_party/jszip" + "third_party/catapult/tracing/third_party/mannwhitneyu" + "third_party/catapult/tracing/third_party/oboe" + "third_party/catapult/tracing/third_party/pako" + "third_party/ced" + "third_party/cld_3" + "third_party/crc32c" + "third_party/cros_system_api" + "third_party/dom_distiller_js" + "third_party/fips181" + "third_party/flatbuffers" + ;; PDFium requires a private freetype API. + ;; + "third_party/freetype/src/src/psnames/pstables.h" + "third_party/glslang-angle" + "third_party/google_input_tools" + "third_party/google_input_tools/third_party/closure_library" + (string-append "third_party/google_input_tools/third_party" + "/closure_library/third_party/closure") + "third_party/googletest" + "third_party/harfbuzz-ng" + "third_party/hunspell" + "third_party/iccjpeg" + "third_party/inspector_protocol" + "third_party/jinja2" + "third_party/jstemplate" + "third_party/khronos" + "third_party/leveldatabase" + "third_party/libXNVCtrl" + "third_party/libaddressinput" + "third_party/libjingle_xmpp" + "third_party/libphonenumber" + "third_party/libsecret" ;FIXME: needs pkg-config support. + "third_party/libsrtp" ;TODO: Requires libsrtp@2. + "third_party/libudev" + "third_party/libwebm" + "third_party/libxml" + "third_party/libyuv" + "third_party/lss" + "third_party/lzma_sdk" + "third_party/markupsafe" + "third_party/mesa" + "third_party/metrics_proto" + "third_party/modp_b64" + "third_party/mt19937ar" + "third_party/node" + (string-append "third_party/node/node_modules/" + "polymer-bundler/lib/third_party/UglifyJS2") + "third_party/openmax_dl" + "third_party/ots" + "third_party/pdfium" + "third_party/pdfium/third_party" + "third_party/ply" + "third_party/polymer" + "third_party/protobuf" + "third_party/protobuf/third_party/six" + "third_party/qcms" + "third_party/sfntly" + "third_party/skia" + "third_party/skia/third_party/vulkan" + "third_party/skia/third_party/gif" + "third_party/smhasher" + "third_party/speech-dispatcher" + "third_party/spirv-headers" + "third_party/spirv-tools-angle" + "third_party/sqlite" + "third_party/swiftshader" + "third_party/swiftshader/third_party" + "third_party/usb_ids" + "third_party/usrsctp" + "third_party/vulkan" + "third_party/vulkan-validation-layers" + "third_party/WebKit" + "third_party/web-animations-js" + "third_party/webrtc" + "third_party/webrtc_overrides" + "third_party/widevine/cdm/widevine_cdm_version.h" + "third_party/widevine/cdm/widevine_cdm_common.h" + "third_party/woff2" + "third_party/xdg-utils" + "third_party/yasm/run_yasm.py" + "third_party/zlib/google" + "url/third_party/mozilla" + "v8/src/third_party/valgrind" + "v8/third_party/inspector_protocol")))) + + ;; This is an implementation of + ;; "build/linux/unbundle/remove_bundled_libraries.py". + ;; It traverses any "third_party" directory and deletes + ;; files that are: + ;; * not ending with ".gn" or ".gni"; or + ;; * not explicitly named as argument (folder or file). + ;; TODO: Remove empty directories. + (define (delete-files-except exceptions dir) + + (define (enter? name stat result) + (not (member name exceptions))) + + (define (leaf name stat result) + (let ((protected-files (make-regexp "\\.(gn|gyp)i?$" + regexp/icase))) + (unless (or (member name exceptions) + (regexp-exec protected-files name)) + (delete-file name)))) + + (file-system-fold enter? + leaf + (lambda (dir stat result) result) ;down + (lambda (dir stat result) result) ;up + (lambda (dir stat result) result) ;skip + (lambda (dir stat result) result) ;error + #t + dir)) + + (for-each (lambda (third-party) + (delete-files-except preserved-files + third-party)) + (find-files "." "^third_party$" #:directories? #t)) + + ;; Replace GN files from third_party with shims for building + ;; against system libraries. Keep this list in sync with + ;; "build/linux/unbundle/replace_gn_files.py". + (for-each (lambda (pair) + (let ((source (string-append + "build/linux/unbundle/" (car pair))) + (dest (cdr pair))) + (copy-file source dest))) + (list + '("ffmpeg.gn" . "third_party/ffmpeg/BUILD.gn") + '("flac.gn" . "third_party/flac/BUILD.gn") + '("freetype.gn" . "third_party/freetype/BUILD.gn") + ;; FIXME: This is no longer supported since 63. + ;;'("harfbuzz-ng.gn" . "third_party/harfbuzz-ng/BUILD.gn") + '("icu.gn" . "third_party/icu/BUILD.gn") + '("libdrm.gn" . "third_party/libdrm/BUILD.gn") + '("libevent.gn" . "base/third_party/libevent/BUILD.gn") + '("libjpeg.gn" . + "build/secondary/third_party/libjpeg_turbo/BUILD.gn") + '("libpng.gn" . "third_party/libpng/BUILD.gn") + '("libvpx.gn" . "third_party/libvpx/BUILD.gn") + '("libwebp.gn" . "third_party/libwebp/BUILD.gn") + '("libxml.gn" . "third_party/libxml/BUILD.gn") ;TODO + '("libxslt.gn" . "third_party/libxslt/BUILD.gn") + '("openh264.gn" . "third_party/openh264/BUILD.gn") + '("opus.gn" . "third_party/opus/BUILD.gn") + '("re2.gn" . "third_party/re2/BUILD.gn") + '("snappy.gn" . "third_party/snappy/BUILD.gn") + '("yasm.gn" . "third_party/yasm/yasm_assemble.gni") + '("zlib.gn" . "third_party/zlib/BUILD.gn"))) + #t))))) + (build-system gnu-build-system) + (arguments + `(#:tests? #f + ;; FIXME: There is a "gn" option specifically for setting -rpath, but + ;; it's not recognized when passed. + #:validate-runpath? #f + #:modules ((srfi srfi-26) + (ice-9 ftw) + (ice-9 regex) + (guix build gnu-build-system) + (guix build utils)) + #:phases + (modify-phases %standard-phases + (add-after 'unpack 'patch-stuff + (lambda* (#:key inputs #:allow-other-keys) + (substitute* "printing/cups_config_helper.py" + (("cups_config =.*") + (string-append "cups_config = '" (assoc-ref inputs "cups") + "/bin/cups-config'\n"))) + + (substitute* + '("base/process/launch_posix.cc" + "base/third_party/dynamic_annotations/dynamic_annotations.c" + "sandbox/linux/seccomp-bpf/sandbox_bpf.cc" + "sandbox/linux/services/credentials.cc" + "sandbox/linux/services/namespace_utils.cc" + "sandbox/linux/services/syscall_wrappers.cc" + "sandbox/linux/syscall_broker/broker_host.cc") + (("include \"base/third_party/valgrind/") "include \"valgrind/")) + + (for-each (lambda (file) + (substitute* file + ;; Fix opus include path. + ;; Do not substitute opus_private.h. + (("#include \"opus\\.h\"") + "#include \"opus/opus.h\"") + (("#include \"opus_custom\\.h\"") + "#include \"opus/opus_custom.h\"") + (("#include \"opus_defines\\.h\"") + "#include \"opus/opus_defines.h\"") + (("#include \"opus_multistream\\.h\"") + "#include \"opus/opus_multistream.h\"") + (("#include \"opus_types\\.h\"") + "#include \"opus/opus_types.h\""))) + (append (find-files "third_party/opus/src/celt") + (find-files "third_party/opus/src/src") + (find-files (string-append "third_party/webrtc/modules" + "/audio_coding/codecs/opus")))) + + (substitute* "chrome/common/chrome_paths.cc" + (("/usr/share/chromium/extensions") + ;; TODO: Add ~/.guix-profile. + "/run/current-system/profile/share/chromium/extensions")) + + (substitute* + "third_party/breakpad/breakpad/src/common/linux/libcurl_wrapper.h" + (("include \"third_party/curl") "include \"curl")) + (substitute* "media/base/decode_capabilities.cc" + (("third_party/libvpx/source/libvpx/") "")) + + ;; We don't cross compile most packages, so get rid of the + ;; unnecessary ARCH-linux-gnu* prefix. + (substitute* "build/toolchain/linux/BUILD.gn" + (("aarch64-linux-gnu-") "") + (("arm-linux-gnueabihf-") "")) + #t)) + (replace 'configure + (lambda* (#:key inputs outputs #:allow-other-keys) + (let ((gn-flags + (list + ;; See tools/gn/docs/cookbook.md and + ;; https://www.chromium.org/developers/gn-build-configuration + ;; for usage. Run "./gn args . --list" in the Release + ;; directory for an exhaustive list of supported flags. + "is_debug=false" + "is_official_build=false" + "is_clang=false" + "use_gold=false" + "use_lld=false" + "linux_use_bundled_binutils=false" + "use_custom_libcxx=false" + "use_sysroot=false" + "goma_dir=\"\"" + "enable_precompiled_headers=false" + "enable_nacl=false" + "enable_nacl_nonsfi=false" + "use_allocator=\"none\"" ;don't use tcmalloc + "override_build_date=\"01 01 2000 05:00:00\"" + "use_unofficial_version_number=false" + ;; Optimize for building everything at once, as opposed + ;; to incrementally for development. See "docs/jumbo.md". + ;; XXX: On some systems this may trigger a compiler error. + ;;"use_jumbo_build=true" + ;; Disable debugging features to save space. + "remove_webcore_debug_symbols=true" + "enable_iterator_debugging=false" + ;; Some of the unbundled libraries throws deprecation + ;; warnings, etc. Ignore it. + "treat_warnings_as_errors=false" + ;; Don't add any API keys. End users can set them in the + ;; environment if desired. See + ;; . + "use_official_google_api_keys=false" + ;; Disable "field trials". + "fieldtrial_testing_like_official_build=true" + + "use_system_freetype=true" + "use_system_harfbuzz=true" + "use_system_libjpeg=true" + "use_system_lcms2=true" + "use_system_zlib=true" + ;; This is currently not supported on Linux: + ;; https://bugs.chromium.org/p/chromium/issues/detail?id=22208 + ;;"use_system_sqlite=true" + + "use_gconf=false" ;deprecated by gsettings + "use_gnome_keyring=false" ;deprecated by libsecret + "use_gtk3=true" + "use_openh264=true" + "use_xkbcommon=true" + "link_pulseaudio=true" + + ;; Don't arbitrarily restrict formats supported by system ffmpeg. + "proprietary_codecs=true" + "ffmpeg_branding=\"Chrome\"" + + ;; WebRTC stuff. + "rtc_use_h264=true" + ;; Don't use bundled sources. + "rtc_build_json=false" + "rtc_build_libevent=false" + "rtc_build_libvpx=false" + "rtc_build_opus=false" + "rtc_build_ssl=false" + ;; TODO: Package these. + "rtc_build_libsrtp=true" ;2.0 + "rtc_build_libyuv=true" + "rtc_build_openmax_dl=true" + "rtc_build_usrsctp=true" + (string-append "rtc_jsoncpp_root=\"" + (assoc-ref inputs "jsoncpp") + "/include/jsoncpp/json\"") + (string-append "rtc_ssl_root=\"" + (assoc-ref inputs "openssl") + "/include/openssl\"")))) + + ;; XXX: How portable is this. + (mkdir-p "third_party/node/linux/node-linux-x64") + (symlink (string-append (assoc-ref inputs "node") "/bin") + "third_party/node/linux/node-linux-x64/bin") + + (setenv "CC" "gcc") + (setenv "CXX" "g++") + ;; TODO: pre-compile instead. Avoids a race condition. + (setenv "PYTHONDONTWRITEBYTECODE" "1") + (and + ;; Build the "gn" tool. + (invoke "python" + "tools/gn/bootstrap/bootstrap.py" "-s" "-v") + ;; Generate ninja build files. + (invoke "./out/Release/gn" "gen" "out/Release" + (string-append "--args=" + (string-join gn-flags " "))))))) + (replace 'build + (lambda* (#:key outputs #:allow-other-keys) + (invoke "ninja" "-C" "out/Release" + "-j" (number->string (parallel-job-count)) + "chrome"))) + (replace 'install + (lambda* (#:key inputs outputs #:allow-other-keys) + (let* ((out (assoc-ref outputs "out")) + (bin (string-append out "/bin")) + (exe (string-append bin "/chromium")) + (lib (string-append out "/lib")) + (man (string-append out "/share/man/man1")) + (applications (string-append out "/share/applications")) + (install-regexp (make-regexp "\\.(bin|pak)$")) + (locales (string-append lib "/locales")) + (resources (string-append lib "/resources")) + (gtk+ (assoc-ref inputs "gtk+")) + (mesa (assoc-ref inputs "mesa")) + (nss (assoc-ref inputs "nss")) + (udev (assoc-ref inputs "udev")) + (sh (which "sh"))) + + (substitute* '("chrome/app/resources/manpage.1.in" + "chrome/installer/linux/common/desktop.template") + (("@@MENUNAME@@") "Chromium") + (("@@PACKAGE@@") "chromium") + (("/usr/bin/@@USR_BIN_SYMLINK_NAME@@") exe)) + (mkdir-p man) + (copy-file "chrome/app/resources/manpage.1.in" + (string-append man "/chromium.1")) + (mkdir-p applications) + (copy-file "chrome/installer/linux/common/desktop.template" + (string-append applications "/chromium.desktop")) + + (with-directory-excursion "out/Release" + (for-each (lambda (file) + (install-file file lib)) + (scandir "." (cut regexp-exec install-regexp <>))) + (copy-file "chrome" (string-append lib "/chromium")) + + ;; TODO: Install icons from "../../chrome/app/themes" into + ;; "out/share/icons/hicolor/$size". + (install-file + "product_logo_48.png" + (string-append out "/share/icons/48x48/chromium.png")) + + (copy-recursively "locales" locales) + (copy-recursively "resources" resources) + + (mkdir-p bin) + ;; Add a thin wrapper to prevent the user from inadvertently + ;; installing non-free software through the Web Store. + ;; TODO: Discover extensions from the profile and pass + ;; something like "--disable-extensions-except=...". + (call-with-output-file exe + (lambda (port) + (format port + "#!~a~@ + if [ -z \"$CHROMIUM_ENABLE_WEB_STORE\" ]~@ + then~@ + CHROMIUM_FLAGS=\" \\~@ + --disable-background-networking \\~@ + --disable-extensions \\~@ + \"~@ + fi~@ + exec ~a $CHROMIUM_FLAGS \"$@\"~%" + sh (string-append lib "/chromium")))) + (chmod exe #o755) + + (wrap-program exe + ;; TODO: Get these in RUNPATH. + `("LD_LIBRARY_PATH" ":" prefix + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib:" + mesa "/lib:" udev "/lib"))) + ;; Avoid file manager crash. See . + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/share")))) + #t))))))) + (native-inputs + `(("bison" ,bison) + ("git" ,git) ;last_commit_position.py + ("gperf" ,gperf) + ("ninja" ,ninja) + ("node" ,node) + ("pkg-config" ,pkg-config) + ("which" ,which) + ("yasm" ,yasm) + + ("python-beautifulsoup4" ,python2-beautifulsoup4) + ("python-html5lib" ,python2-html5lib) + ("python" ,python-2))) + (inputs + `(("alsa-lib" ,alsa-lib) + ("atk" ,atk) + ("cups" ,cups) + ("curl" ,curl) + ("dbus" ,dbus) + ("dbus-glib" ,dbus-glib) + ("expat" ,expat) + ("flac" ,flac) + ("ffmpeg" ,ffmpeg) + ("fontconfig" ,fontconfig) + ("freetype" ,freetype) + ("gdk-pixbuf" ,gdk-pixbuf) + ("glib" ,glib) + ("gtk+-2" ,gtk+-2) + ("gtk+" ,gtk+) + ("harfbuzz" ,harfbuzz) + ("icu4c" ,icu4c) + ("jsoncpp" ,jsoncpp) + ("lcms" ,lcms) + ("libevent" ,libevent) + ("libffi" ,libffi) + ("libjpeg-turbo" ,libjpeg-turbo) + ("libpng" ,libpng) + ("libusb" ,libusb) + ("libvpx" ,libvpx+experimental) + ("libwebp" ,libwebp) + ("libx11" ,libx11) + ("libxcb" ,libxcb) + ("libxcomposite" ,libxcomposite) + ("libxcursor" ,libxcursor) + ("libxdamage" ,libxdamage) + ("libxext" ,libxext) + ("libxfixes" ,libxfixes) + ("libxi" ,libxi) + ("libxkbcommon" ,libxkbcommon) + ("libxml2" ,libxml2) + ("libxrandr" ,libxrandr) + ("libxrender" ,libxrender) + ("libxscrnsaver" ,libxscrnsaver) + ("libxslt" ,libxslt) + ("libxtst" ,libxtst) + ("mesa" ,mesa) + ("minizip" ,minizip) + ("mit-krb5" ,mit-krb5) + ("nss" ,nss) + ("openh264" ,openh264) + ("openssl" ,openssl) + ("opus" ,opus+custom) + ("pango" ,pango) + ("pciutils" ,pciutils) + ("protobuf" ,protobuf) + ("pulseaudio" ,pulseaudio) + ("re2" ,re2) + ("snappy" ,snappy) + ("speech-dispatcher" ,speech-dispatcher) + ("sqlite" ,sqlite) + ("udev" ,eudev) + ("valgrind" ,valgrind))) + (home-page "https://www.chromium.org/") + (description + "Chromium is a web browser designed for speed and security. This +version incorporates patches from +@url{https://github.com/gcarq/inox-patchset,Inox} and +@url{https://www.debian.org/,Debian} in order to protect the users privacy.") + ;; Chromium is developed as BSD-3, but bundles a large number of third-party + ;; components with other licenses. For full information, see chrome://credits. + (license (list license:bsd-3 + license:bsd-2 + license:expat + license:asl2.0 + license:mpl2.0 + license:public-domain + license:lgpl2.1+)))) diff --git a/gnu/packages/patches/chromium-gcc5.patch b/gnu/packages/patches/chromium-gcc5.patch new file mode 100644 index 000000000..56b2cd6ef --- /dev/null +++ b/gnu/packages/patches/chromium-gcc5.patch @@ -0,0 +1,39 @@ +Work around a GCC5 bug where it fails to choose the correct base::span +constructor. + +Adapted from this commit: +https://gitweb.gentoo.org/repo/gentoo.git/commit/www-client/chromium?id=7843d29ab07411a9c70962fb90b4cd1546910242 + +--- a/gpu/ipc/common/mailbox_struct_traits.h ++++ b/gpu/ipc/common/mailbox_struct_traits.h +@@ -15,7 +15,7 @@ namespace mojo { + template <> + struct StructTraits { + static base::span name(const gpu::Mailbox& mailbox) { +- return mailbox.name; ++ return base::make_span(mailbox.name); + } + static bool Read(gpu::mojom::MailboxDataView data, gpu::Mailbox* out); + }; +--- a/services/viz/public/cpp/compositing/filter_operation_struct_traits.h ++++ b/services/viz/public/cpp/compositing/filter_operation_struct_traits.h +@@ -134,7 +134,7 @@ struct StructTraits { + static base::span matrix(const cc::FilterOperation& operation) { + if (operation.type() != cc::FilterOperation::COLOR_MATRIX) + return base::span(); +- return operation.matrix(); ++ return base::make_span(operation.matrix()); + } + + static base::span shape( +--- a/services/viz/public/cpp/compositing/quads_struct_traits.h ++++ b/services/viz/public/cpp/compositing/quads_struct_traits.h +@@ -308,7 +308,7 @@ + static base::span vertex_opacity(const viz::DrawQuad& input) { + const viz::TextureDrawQuad* quad = + viz::TextureDrawQuad::MaterialCast(&input); +- return quad->vertex_opacity; ++ return base::make_span(quad->vertex_opacity); + } + + static bool y_flipped(const viz::DrawQuad& input) { diff --git a/gnu/packages/patches/chromium-remove-default-history.patch b/gnu/packages/patches/chromium-remove-default-history.patch new file mode 100644 index 000000000..38be10820 --- /dev/null +++ b/gnu/packages/patches/chromium-remove-default-history.patch @@ -0,0 +1,13 @@ +Don't pre-populate the New Tab Page for new profiles. + +--- a/chrome/browser/history/top_sites_factory.cc ++++ b/chrome/browser/history/top_sites_factory.cc +@@ -74,7 +74,7 @@ + + void InitializePrepopulatedPageList( + history::PrepopulatedPageList* prepopulated_pages) { +-#if !defined(OS_ANDROID) ++#if false + DCHECK(prepopulated_pages); + prepopulated_pages->reserve(arraysize(kRawPrepopulatedPages)); + for (size_t i = 0; i < arraysize(kRawPrepopulatedPages); ++i) { -- 2.16.2 From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 26 15:01:32 2018 Received: (at 28004) by debbugs.gnu.org; 26 Feb 2018 20:01:32 +0000 Received: from localhost ([127.0.0.1]:33950 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqOxo-0003Kx-7c for submit@debbugs.gnu.org; Mon, 26 Feb 2018 15:01:32 -0500 Received: from aibo.runbox.com ([91.220.196.211]:44538) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqOxl-0003Ko-Sc for 28004@debbugs.gnu.org; Mon, 26 Feb 2018 15:01:30 -0500 Received: from [10.9.9.212] (helo=mailfront12.runbox.com) by mailtransmit03.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1eqOxh-0002kX-9K; Mon, 26 Feb 2018 21:01:25 +0100 Received: from dslb-178-001-153-226.178.001.pools.vodafone-ip.de ([178.1.153.226] helo=localhost) by mailfront12.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1eqOxf-0007gL-GT; Mon, 26 Feb 2018 21:01:23 +0100 Date: Mon, 26 Feb 2018 20:01:33 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180226200133.zsnahblbgzovrtmu@abyayala> References: <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="fflbbbzhlu4c3sef" Content-Disposition: inline In-Reply-To: <87vaejvclc.fsf@fastmail.com> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: Mike Gerwitz , 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --fflbbbzhlu4c3sef Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 2.1K bytes: > Mike Gerwitz writes: >=20 > > On Tue, Jan 16, 2018 at 20:01:34 +0100, Marius Bakke wrote: > >> If there are no objections, expect to see this in 'master' in 1-2 week= s. > > > > I want to express gratitude for your hard work on this---given that > > IceCat does not contain many of the FF devtool updates, Chromium is very > > desirable for web development. It's also needed for certain Node.js > > tools, like node-inspector. > > > > So, thank you! >=20 > Thank *you* for the kind words! :-) >=20 > Here is the latest iteration of this patch. New in this version: >=20 > * Chromium 64 (duh). > * The 'delete-bundled-software' phase has been moved to a snippet, > shaving ~100MiB (~22%) off the compressed tarball size (and > drastically reduces (de)compression time). > * The New Tab page does not show any thumbnails for new profiles. I think you forgot to attach the patches :) > I've also added more comments about the patches and other flags. >=20 > Now, when launching the browser for the first time, it *still* connects > to Google services. After a while it also does a lookup for AdWords... > However subsequent launches are "silent" as long as the Web Store is > disabled and "--disable-background-networking" is passed, like the > wrapper script does. >=20 > Incidentally, now that IceCat supports WebRTC (and somehow plugged the > IP address leak[0]!), I no longer *need* this package. However, having > multiple high quality browsers at hand is a huge advantage IMO, so I'd > still like to have it in Guix. >=20 > What do y'all think? Feedback on the snippet and description very > welcome. I still would like to have Chromium in Guix too. Icecat doesn't work for everyone's needs and requirements. I'd help volunteering time to building and updating, when it's possible for me. > [0] https://en.wikipedia.org/wiki/WebRTC#Concerns --=20 ng0 A88C8ADD129828D7EAC02E52E22F9BBFEE348588 http://krosos.org | https://n0.is/~ng0/ | https://crash.cx --fflbbbzhlu4c3sef Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlqUZ50ACgkQ4i+bv+40 hYhRRhAAsEF+sW7/SVVp7ROYvltI65fhb6jK7GSoBq5VUicYQLaRWKo3HiAQuuyL 3NhFGEIi6UH5fQHr22kSYCcx2uNmX494JYhGIJ38nj3A3wiumVG6zZtFPgPllrqO XPP7GMcWiNIwbhCnzPtBCl6KPllJMxa3tdbgsb7pWio9fRtcZUE7+7RPVtMBa5q/ R4pd3stwA7lYl8VB9wR87YesSeeGMsRGSRi8DN8eF8nfiuiwDkzsYhRWomvR5Ocd KhehTcoQkFuzdsLICHWjPrGaxZfBzwktTHiy4seo8cOaU/LLK1n4yK9Y6djrAWx1 pwXtkRMQ87L89R0mM38CrVE+GPxgnhL1/WzSe10GjT5vRsXdVB/NwKuF0X4BXGAa gN5EIjHJdFaW7Yb5OK78EehbezR55WHArOOaesEB1ktFwPFG6o5uDDPJhgitqg4J JPy3oNX5EiLua7uywd7f+j/UEcVY3GD8MwakzqcyN3cFzUDno9Y4pdGaVaOGXudu 1WYg3QG0pQtASCRmgXlcKJc5Fju4kYRasuCfmR59E013VsnaRAJCVJPKn1bRFUNo /Rvk25Nzb6NblgpAAummXhwdbe5lpwEgHf8CZyJC3RVKiJ9oCeshGhomJmDqt1sj 092lVphpvGJMIcDANnU6aTywg650G9T+lLnXycHhjHZOTBEchUA= =NLO2 -----END PGP SIGNATURE----- --fflbbbzhlu4c3sef-- From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 26 15:07:15 2018 Received: (at 28004) by debbugs.gnu.org; 26 Feb 2018 20:07:15 +0000 Received: from localhost ([127.0.0.1]:33963 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqP3C-0003Sy-8m for submit@debbugs.gnu.org; Mon, 26 Feb 2018 15:07:15 -0500 Received: from out2-smtp.messagingengine.com ([66.111.4.26]:45253) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqP35-0003SV-Fm for 28004@debbugs.gnu.org; Mon, 26 Feb 2018 15:07:04 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 6667320C4A; Mon, 26 Feb 2018 15:06:59 -0500 (EST) Received: from frontend2 ([10.202.2.161]) by compute5.internal (MEProxy); Mon, 26 Feb 2018 15:06:59 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; bh=zcdiWmUEvjUidwONYN3GmXOwm3+EbItxQsRlp/IsHqo=; b=hNvLkEAr a6WTq9AkOnczgx3l342J3EkN4vxHQkK9Wy4XL8HnpExVoguWvMyObZMNamOeRQDB NOcGG73DaYAdKyfCmUske34LHhjtaxjN0g8t+xQnP1tZxy5epgJ66PHVnhlCzW1U g0DRhP5XjNvPKoluNgW1GKxzvw0+6ceBw6Pp8s8C/rm0v8/rNuCG2Xyhtgib9+07 hJGJpt9T/YglYNEf5RkjsemQbwaOAagWDLtGnLL755JLiJhPYmOIVqZDuZUvotq/ Mh95EA8SBdVXyN4sikcstXeW2KHGBvm8g254K3cPsE4Z2Uz+ik9QMgjcZyRRF6/4 6md+wxEmn9xNVg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm2; bh=zcdiWmUEvjUidwONYN3GmXOwm3+Eb ItxQsRlp/IsHqo=; b=EotWOYdSXFiIAgwghSJMFjbxVkaIbq98zapGJAf9UD96t ixJ19+Q2mXIDDcysp+kcJmww0l0NQPCQx6G3zAeO0EZYQBMkMRcju8vjoO9U6jel Ic5SbvGo7+2Ahelu6QD4E7p1nd5IrdzeAKgFlz1m0w5A6ZmYwtdm/ZBv1OZfU9h/ Jp90YUUIpiX8+TidrIU8v//KzGGD/I3iWOgsw3UaKNV8CaSV9keOCMMb3vIvrHvU /gDR+wjZPk0YQOxNore5vmwr2xKH0JncjHGKuguO7zJSKd1gNoIXwSoA4hU4q4Cu wNl/FDGqWWH4zSWBb8/Z8fXt2ghlOjf8AM0soscjA== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id A35CF24591; Mon, 26 Feb 2018 15:06:58 -0500 (EST) From: Marius Bakke To: ng0 Subject: Re: [bug#28004] Chromium In-Reply-To: <20180226200133.zsnahblbgzovrtmu@abyayala> References: <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> User-Agent: Notmuch/0.26 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Mon, 26 Feb 2018 21:06:57 +0100 Message-ID: <87muzvv7ku.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: Mike Gerwitz , 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.0 (/) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable ng0 writes: > Marius Bakke transcribed 2.1K bytes: >> Mike Gerwitz writes: >>=20 >> > On Tue, Jan 16, 2018 at 20:01:34 +0100, Marius Bakke wrote: >> >> If there are no objections, expect to see this in 'master' in 1-2 wee= ks. >> > >> > I want to express gratitude for your hard work on this---given that >> > IceCat does not contain many of the FF devtool updates, Chromium is ve= ry >> > desirable for web development. It's also needed for certain Node.js >> > tools, like node-inspector. >> > >> > So, thank you! >>=20 >> Thank *you* for the kind words! :-) >>=20 >> Here is the latest iteration of this patch. New in this version: >>=20 >> * Chromium 64 (duh). >> * The 'delete-bundled-software' phase has been moved to a snippet, >> shaving ~100MiB (~22%) off the compressed tarball size (and >> drastically reduces (de)compression time). >> * The New Tab page does not show any thumbnails for new profiles. > > I think you forgot to attach the patches :) Derp. I realized that and just used `git send-email`[0], but have attached it here for convenience since the debbugs web UI doesn't allow easy download of a raw message. [0] https://debbugs.gnu.org/cgi/bugreport.cgi?msg=3D131;bug=3D28004#131 --=-=-= Content-Type: text/x-patch; charset=utf-8 Content-Disposition: attachment; filename=0001-gnu-Add-chromium.patch Content-Transfer-Encoding: quoted-printable From=20f00529f4cd9e2e5efef146915d217cbb413d1f1a Mon Sep 17 00:00:00 2001 From: Marius Bakke Date: Wed, 12 Oct 2016 17:25:05 +0100 Subject: [PATCH] gnu: Add chromium. * gnu/packages/chromium.scm: New file. * gnu/packages/patches/chromium-gcc.patch, gnu/packages/patches/chromium-remove-default-history.patch: New files. * gnu/local.mk: Record it. =2D-- gnu/local.mk | 3 + gnu/packages/chromium.scm | 756 +++++++++++++++++= ++++ gnu/packages/patches/chromium-gcc5.patch | 39 ++ .../patches/chromium-remove-default-history.patch | 13 + 4 files changed, 811 insertions(+) create mode 100644 gnu/packages/chromium.scm create mode 100644 gnu/packages/patches/chromium-gcc5.patch create mode 100644 gnu/packages/patches/chromium-remove-default-history.pa= tch diff --git a/gnu/local.mk b/gnu/local.mk index fa98810d6..fb1320f7b 100644 =2D-- a/gnu/local.mk +++ b/gnu/local.mk @@ -92,6 +92,7 @@ GNU_SYSTEM_MODULES =3D \ %D%/packages/check.scm \ %D%/packages/chemistry.scm \ %D%/packages/chez.scm \ + %D%/packages/chromium.scm \ %D%/packages/ci.scm \ %D%/packages/cinnamon.scm \ %D%/packages/cmake.scm \ @@ -581,6 +582,8 @@ dist_patch_DATA =3D \ %D%/packages/patches/ceph-skip-collect-sys-info-test.patch \ %D%/packages/patches/ceph-skip-unittest_blockdev.patch \ %D%/packages/patches/chmlib-inttypes.patch \ + %D%/packages/patches/chromium-gcc5.patch \ + %D%/packages/patches/chromium-remove-default-history.patch \ %D%/packages/patches/clang-libc-search-path.patch \ %D%/packages/patches/clang-3.8-libc-search-path.patch \ %D%/packages/patches/clang-runtime-asan-build-fixes.patch \ diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm new file mode 100644 index 000000000..1dd77b089 =2D-- /dev/null +++ b/gnu/packages/chromium.scm @@ -0,0 +1,756 @@ +;;; GNU Guix --- Functional package management for GNU +;;; Copyright =C2=A9 2016, 2017, 2018 Marius Bakke +;;; +;;; This file is part of GNU Guix. +;;; +;;; GNU Guix is free software; you can redistribute it and/or modify it +;;; under the terms of the GNU General Public License as published by +;;; the Free Software Foundation; either version 3 of the License, or (at +;;; your option) any later version. +;;; +;;; GNU Guix is distributed in the hope that it will be useful, but +;;; WITHOUT ANY WARRANTY; without even the implied warranty of +;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +;;; GNU General Public License for more details. +;;; +;;; You should have received a copy of the GNU General Public License +;;; along with GNU Guix. If not, see . + +(define-module (gnu packages chromium) + #:use-module ((guix licenses) #:prefix license:) + #:use-module (guix packages) + #:use-module (guix download) + #:use-module (guix git-download) + #:use-module (guix utils) + #:use-module (guix build-system gnu) + #:use-module (gnu packages) + #:use-module (gnu packages assembly) + #:use-module (gnu packages base) + #:use-module (gnu packages bison) + #:use-module (gnu packages compression) + #:use-module (gnu packages cups) + #:use-module (gnu packages curl) + #:use-module (gnu packages databases) + #:use-module (gnu packages fontutils) + #:use-module (gnu packages ghostscript) + #:use-module (gnu packages gl) + #:use-module (gnu packages glib) + #:use-module (gnu packages gnome) + #:use-module (gnu packages gnuzilla) + #:use-module (gnu packages gperf) + #:use-module (gnu packages gtk) + #:use-module (gnu packages icu4c) + #:use-module (gnu packages image) + #:use-module (gnu packages libevent) + #:use-module (gnu packages libffi) + #:use-module (gnu packages libusb) + #:use-module (gnu packages linux) + #:use-module (gnu packages kerberos) + #:use-module (gnu packages ninja) + #:use-module (gnu packages node) + #:use-module (gnu packages pciutils) + #:use-module (gnu packages photo) + #:use-module (gnu packages pkg-config) + #:use-module (gnu packages protobuf) + #:use-module (gnu packages pulseaudio) + #:use-module (gnu packages python) + #:use-module (gnu packages python-web) + #:use-module (gnu packages regex) + #:use-module (gnu packages serialization) + #:use-module (gnu packages speech) + #:use-module (gnu packages tls) + #:use-module (gnu packages valgrind) + #:use-module (gnu packages version-control) + #:use-module (gnu packages video) + #:use-module (gnu packages xiph) + #:use-module (gnu packages xml) + #:use-module (gnu packages xdisorg) + #:use-module (gnu packages xorg)) + +(define (strip-directory-prefix pathspec) + "Return everything after the last '/' in PATHSPEC." + (let ((index (string-rindex pathspec #\/))) + (if index + (string-drop pathspec (+ 1 index)) + pathspec))) + +(define (chromium-patch-file-name pathspec) + (let ((patch-name (strip-directory-prefix pathspec))) + (if (string-prefix? "chromium-" patch-name) + patch-name + (string-append "chromium-" patch-name)))) + +;; https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/tree/debi= an/patches +(define (debian-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append + "https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git" + "/plain/debian/patches/" pathspec "?id=3D" revision)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://gitweb.gentoo.org/repo/gentoo.git/tree/www-client/chromium/files +(define (gentoo-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-client" + "/chromium/files/" pathspec "?id=3D" revision)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://github.com/gcarq/inox-patchset +(define (inox-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append "https://raw.githubusercontent.com/gcarq/inox-patc= hset/" + revision "/" pathspec)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://github.com/NixOS/nixpkgs/tree/master/pkgs/applications/networki= ng/browsers/chromium +(define (nixos-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append "https://raw.githubusercontent.com/NixOS/nixpkgs/" + revision "/pkgs/applications/networking/browsers" + "/chromium/patches/" pathspec)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; Fix build for older versions of GCC. +(define %chromium-angle-gcc-compat.patch + (gentoo-patch "chromium-angle-r0.patch" + "08971011b4d6fa37aa906920fba7564e48b9e60b" + "0izdrqwsyr48117dhvwdsk8c6dkrnq2njida1q4mb1lagvwbz7gc")) + +;; https://webrtc-review.googlesource.com/9384 +(define %chromium-webrtc-gcc-compat.patch + (gentoo-patch "chromium-webrtc-r0.patch" + "08971011b4d6fa37aa906920fba7564e48b9e60b" + "0qj5b4w9kav51ylpdf38vm5w7p2gx4qp8p45vrfggp7miicg9cmw")) + +;; https://chromium-review.googlesource.com/813737 +(define %chromium-memcpy.patch + (gentoo-patch "chromium-memcpy-r0.patch" + "08971011b4d6fa37aa906920fba7564e48b9e60b" + "1d3vra59wjg2lva7ddv55ff6l57mk9k50llsplr0b7vxk0lh0ps5")) + +(define %chromium-system-nspr.patch + (debian-patch "system/nspr.patch" + "debian/64.0.3282.119-2" + "0pcwk3jsx8hjzd4s1v7p11jd8vpdqfnq82di31222cjx0bl6275r")) + +(define %chromium-system-libevent.patch + (debian-patch "system/event.patch" + "debian/64.0.3282.119-2" + "1dxzn1yf05mzf21c25sczj4zhkknf03x9bc3xzznqpvnsf3cjpr0")) + +(define %chromium-system-icu.patch + (debian-patch "system/icu.patch" + "debian/64.0.3282.119-2" + "0kf77d8lyma3w0xpgfv2k0c741zp6ii08gzllfja6d5s59c15ylv")) + +;; Don't show a warning about missing API keys. +(define %chromium-disable-api-keys-warning.patch + (debian-patch "disable/google-api-warning.patch" + "debian/64.0.3282.119-2" + "1932xkrskm4nnglzj6xfjpycx4chsycj9ay3ipkq5f6xk21a1xm0")) + +;; Add DuckDuckGo and set it as the default search engine. +(define %chromium-duckduckgo.patch + (inox-patch "0011-add-duckduckgo-search-engine.patch" + "d655594419af6b82a2a070e4d3eedd926a04fa79" + "0p8x98g71ngkd3wbl5q36wrl18ff185sfrr5fcwjbgrv3v7r6ra7")) + +;; Don't start a "Login Wizard" at first launch. +(define %chromium-first-run.patch + (inox-patch "0018-disable-first-run-behaviour.patch" + "d655594419af6b82a2a070e4d3eedd926a04fa79" + "1y4zsqqf2125jkb1phwy9g5hcbd9xhyv5lr4xcaly66rpdzx2ayb")) + +;; Use privacy-preserving defaults. +(define %chromium-default-preferences.patch + (inox-patch "0006-modify-default-prefs.patch" + "d655594419af6b82a2a070e4d3eedd926a04fa79" + "0qpd5l3wiw7325cicjzvdql0gay7jl4afml4nrbmy3w40i1ai2rf")) + +;; Recent versions of Chromium may load a remote search engine on the +;; New Tab Page, causing unnecessary and involuntary network traffic. +(define %chromium-restore-classic-ntp.patch + (inox-patch "0008-restore-classic-ntp.patch" + "d655594419af6b82a2a070e4d3eedd926a04fa79" + "0lj018q6vd6m43cj8rnraqgi4lp2iq76i1i0078dav4cxnzdryfs")) + +(define opus+custom + (package (inherit opus) + (name "opus+custom") + (arguments + `(;; Opus Custom is an optional extension of the Opus + ;; specification that allows for unsupported frame + ;; sizes. Chromium requires that this is enabled. + #:configure-flags '("--enable-custom-modes") + ,@(package-arguments opus))))) + +(define libvpx+experimental + (package + (inherit libvpx) + (name "libvpx+experimental") + (arguments + `(,@(substitute-keyword-arguments (package-arguments libvpx) + ((#:configure-flags flags ''()) + ;; Spatial SVC is an experimental VP9 encoder required by Chro= mium. + `(cons* "--enable-experimental" "--enable-spatial-svc" + ,flags))))))) + +(define-public chromium + (package + (name "chromium") + (version "64.0.3282.186") + (synopsis "Graphical web browser") + (source (origin + (method url-fetch) + (uri (string-append "https://commondatastorage.googleapis.co= m/" + "chromium-browser-official/chromium-" + version ".tar.xz")) + (sha256 + (base32 + "0q0q1whspmzyln04gxhgl3jd2vrgb4imh8r9qw6c06i3b63j3l2z")) + (patches (list %chromium-duckduckgo.patch + %chromium-default-preferences.patch + %chromium-first-run.patch + %chromium-restore-classic-ntp.patch + %chromium-angle-gcc-compat.patch + %chromium-webrtc-gcc-compat.patch + %chromium-memcpy.patch + %chromium-system-icu.patch + %chromium-system-nspr.patch + %chromium-system-libevent.patch + %chromium-disable-api-keys-warning.patch + (search-patch "chromium-gcc5.patch") + (search-patch "chromium-remove-default-histor= y.patch"))) + (modules '((srfi srfi-1) + (ice-9 ftw) + (ice-9 regex) + (guix build utils))) + (snippet + '(begin + (let ((preserved-files + (map + (lambda (path) (string-append "./" path)) + (list + "base/third_party/dmg_fp" + "base/third_party/dynamic_annotations" + "base/third_party/icu" + "base/third_party/libevent" + "base/third_party/nspr" + "base/third_party/superfasthash" + "base/third_party/symbolize" ;glog + "base/third_party/xdg_mime" + "base/third_party/xdg_user_dirs" + "buildtools/third_party/libc++" + "chrome/third_party/mozilla_security_manager" + "courgette/third_party" + "net/third_party/mozilla_security_manager" + "net/third_party/nss" + "third_party/adobe/flash/flapper_version.h" + ;; FIXME: This is used in: + ;; * ui/webui/resources/js/analytics.js + ;; * ui/file_manager/ + "third_party/analytics" + "third_party/angle" + "third_party/angle/src/common/third_party/base" + "third_party/angle/src/common/third_party/smhas= her" + "third_party/angle/src/third_party/compiler" + "third_party/angle/src/third_party/libXNVCtrl" + "third_party/angle/src/third_party/trace_event" + "third_party/blink" + "third_party/boringssl" + "third_party/boringssl/src/third_party/fiat" + "third_party/breakpad" + "third_party/brotli" + "third_party/cacheinvalidation" + "third_party/catapult" + "third_party/catapult/common/py_vulcanize/third= _party/rcssmin" + "third_party/catapult/common/py_vulcanize/third= _party/rjsmin" + "third_party/catapult/third_party/polymer" + "third_party/catapult/tracing/third_party/d3" + "third_party/catapult/tracing/third_party/gl-ma= trix" + "third_party/catapult/tracing/third_party/jszip" + "third_party/catapult/tracing/third_party/mannw= hitneyu" + "third_party/catapult/tracing/third_party/oboe" + "third_party/catapult/tracing/third_party/pako" + "third_party/ced" + "third_party/cld_3" + "third_party/crc32c" + "third_party/cros_system_api" + "third_party/dom_distiller_js" + "third_party/fips181" + "third_party/flatbuffers" + ;; PDFium requires a private freetype API. + ;; + "third_party/freetype/src/src/psnames/pstables.= h" + "third_party/glslang-angle" + "third_party/google_input_tools" + "third_party/google_input_tools/third_party/clo= sure_library" + (string-append "third_party/google_input_tools/= third_party" + "/closure_library/third_party/cl= osure") + "third_party/googletest" + "third_party/harfbuzz-ng" + "third_party/hunspell" + "third_party/iccjpeg" + "third_party/inspector_protocol" + "third_party/jinja2" + "third_party/jstemplate" + "third_party/khronos" + "third_party/leveldatabase" + "third_party/libXNVCtrl" + "third_party/libaddressinput" + "third_party/libjingle_xmpp" + "third_party/libphonenumber" + "third_party/libsecret" ;FIXME: needs pkg-confi= g support. + "third_party/libsrtp" ;TODO: Requires libsrtp= @2. + "third_party/libudev" + "third_party/libwebm" + "third_party/libxml" + "third_party/libyuv" + "third_party/lss" + "third_party/lzma_sdk" + "third_party/markupsafe" + "third_party/mesa" + "third_party/metrics_proto" + "third_party/modp_b64" + "third_party/mt19937ar" + "third_party/node" + (string-append "third_party/node/node_modules/" + "polymer-bundler/lib/third_party= /UglifyJS2") + "third_party/openmax_dl" + "third_party/ots" + "third_party/pdfium" + "third_party/pdfium/third_party" + "third_party/ply" + "third_party/polymer" + "third_party/protobuf" + "third_party/protobuf/third_party/six" + "third_party/qcms" + "third_party/sfntly" + "third_party/skia" + "third_party/skia/third_party/vulkan" + "third_party/skia/third_party/gif" + "third_party/smhasher" + "third_party/speech-dispatcher" + "third_party/spirv-headers" + "third_party/spirv-tools-angle" + "third_party/sqlite" + "third_party/swiftshader" + "third_party/swiftshader/third_party" + "third_party/usb_ids" + "third_party/usrsctp" + "third_party/vulkan" + "third_party/vulkan-validation-layers" + "third_party/WebKit" + "third_party/web-animations-js" + "third_party/webrtc" + "third_party/webrtc_overrides" + "third_party/widevine/cdm/widevine_cdm_version.= h" + "third_party/widevine/cdm/widevine_cdm_common.h" + "third_party/woff2" + "third_party/xdg-utils" + "third_party/yasm/run_yasm.py" + "third_party/zlib/google" + "url/third_party/mozilla" + "v8/src/third_party/valgrind" + "v8/third_party/inspector_protocol")))) + + ;; This is an implementation of + ;; "build/linux/unbundle/remove_bundled_libraries.py". + ;; It traverses any "third_party" directory and deletes + ;; files that are: + ;; * not ending with ".gn" or ".gni"; or + ;; * not explicitly named as argument (folder or file). + ;; TODO: Remove empty directories. + (define (delete-files-except exceptions dir) + + (define (enter? name stat result) + (not (member name exceptions))) + + (define (leaf name stat result) + (let ((protected-files (make-regexp "\\.(gn|gyp)i?= $" + regexp/icase))) + (unless (or (member name exceptions) + (regexp-exec protected-files name)) + (delete-file name)))) + + (file-system-fold enter? + leaf + (lambda (dir stat result) result) = ;down + (lambda (dir stat result) result) = ;up + (lambda (dir stat result) result) = ;skip + (lambda (dir stat result) result) = ;error + #t + dir)) + + (for-each (lambda (third-party) + (delete-files-except preserved-files + third-party)) + (find-files "." "^third_party$" #:directorie= s? #t)) + + ;; Replace GN files from third_party with shims for bu= ilding + ;; against system libraries. Keep this list in sync w= ith + ;; "build/linux/unbundle/replace_gn_files.py". + (for-each (lambda (pair) + (let ((source (string-append + "build/linux/unbundle/" (ca= r pair))) + (dest (cdr pair))) + (copy-file source dest))) + (list + '("ffmpeg.gn" . "third_party/ffmpeg/BUILD.g= n") + '("flac.gn" . "third_party/flac/BUILD.gn") + '("freetype.gn" . "third_party/freetype/BUI= LD.gn") + ;; FIXME: This is no longer supported since= 63. + ;;'("harfbuzz-ng.gn" . "third_party/harfbuz= z-ng/BUILD.gn") + '("icu.gn" . "third_party/icu/BUILD.gn") + '("libdrm.gn" . "third_party/libdrm/BUILD.g= n") + '("libevent.gn" . "base/third_party/libeven= t/BUILD.gn") + '("libjpeg.gn" . + "build/secondary/third_party/libjpeg_turb= o/BUILD.gn") + '("libpng.gn" . "third_party/libpng/BUILD.g= n") + '("libvpx.gn" . "third_party/libvpx/BUILD.g= n") + '("libwebp.gn" . "third_party/libwebp/BUILD= .gn") + '("libxml.gn" . "third_party/libxml/BUILD.g= n") ;TODO + '("libxslt.gn" . "third_party/libxslt/BUILD= .gn") + '("openh264.gn" . "third_party/openh264/BUI= LD.gn") + '("opus.gn" . "third_party/opus/BUILD.gn") + '("re2.gn" . "third_party/re2/BUILD.gn") + '("snappy.gn" . "third_party/snappy/BUILD.g= n") + '("yasm.gn" . "third_party/yasm/yasm_assemb= le.gni") + '("zlib.gn" . "third_party/zlib/BUILD.gn"))) + #t))))) + (build-system gnu-build-system) + (arguments + `(#:tests? #f + ;; FIXME: There is a "gn" option specifically for setting -rpath, b= ut + ;; it's not recognized when passed. + #:validate-runpath? #f + #:modules ((srfi srfi-26) + (ice-9 ftw) + (ice-9 regex) + (guix build gnu-build-system) + (guix build utils)) + #:phases + (modify-phases %standard-phases + (add-after 'unpack 'patch-stuff + (lambda* (#:key inputs #:allow-other-keys) + (substitute* "printing/cups_config_helper.py" + (("cups_config =3D.*") + (string-append "cups_config =3D '" (assoc-ref inputs "cups= ") + "/bin/cups-config'\n"))) + + (substitute* + '("base/process/launch_posix.cc" + "base/third_party/dynamic_annotations/dynamic_annotatio= ns.c" + "sandbox/linux/seccomp-bpf/sandbox_bpf.cc" + "sandbox/linux/services/credentials.cc" + "sandbox/linux/services/namespace_utils.cc" + "sandbox/linux/services/syscall_wrappers.cc" + "sandbox/linux/syscall_broker/broker_host.cc") + (("include \"base/third_party/valgrind/") "include \"valgri= nd/")) + + (for-each (lambda (file) + (substitute* file + ;; Fix opus include path. + ;; Do not substitute opus_private.h. + (("#include \"opus\\.h\"") + "#include \"opus/opus.h\"") + (("#include \"opus_custom\\.h\"") + "#include \"opus/opus_custom.h\"") + (("#include \"opus_defines\\.h\"") + "#include \"opus/opus_defines.h\"") + (("#include \"opus_multistream\\.h\"") + "#include \"opus/opus_multistream.h\"") + (("#include \"opus_types\\.h\"") + "#include \"opus/opus_types.h\""))) + (append (find-files "third_party/opus/src/celt") + (find-files "third_party/opus/src/src") + (find-files (string-append "third_party/web= rtc/modules" + "/audio_coding/c= odecs/opus")))) + + (substitute* "chrome/common/chrome_paths.cc" + (("/usr/share/chromium/extensions") + ;; TODO: Add ~/.guix-profile. + "/run/current-system/profile/share/chromium/extensions")) + + (substitute* + "third_party/breakpad/breakpad/src/common/linux/libcurl_w= rapper.h" + (("include \"third_party/curl") "include \"curl")) + (substitute* "media/base/decode_capabilities.cc" + (("third_party/libvpx/source/libvpx/") "")) + + ;; We don't cross compile most packages, so get rid of the + ;; unnecessary ARCH-linux-gnu* prefix. + (substitute* "build/toolchain/linux/BUILD.gn" + (("aarch64-linux-gnu-") "") + (("arm-linux-gnueabihf-") "")) + #t)) + (replace 'configure + (lambda* (#:key inputs outputs #:allow-other-keys) + (let ((gn-flags + (list + ;; See tools/gn/docs/cookbook.md and + ;; https://www.chromium.org/developers/gn-build-confi= guration + ;; for usage. Run "./gn args . --list" in the Release + ;; directory for an exhaustive list of supported flag= s. + "is_debug=3Dfalse" + "is_official_build=3Dfalse" + "is_clang=3Dfalse" + "use_gold=3Dfalse" + "use_lld=3Dfalse" + "linux_use_bundled_binutils=3Dfalse" + "use_custom_libcxx=3Dfalse" + "use_sysroot=3Dfalse" + "goma_dir=3D\"\"" + "enable_precompiled_headers=3Dfalse" + "enable_nacl=3Dfalse" + "enable_nacl_nonsfi=3Dfalse" + "use_allocator=3D\"none\"" ;don't use tcmalloc + "override_build_date=3D\"01 01 2000 05:00:00\"" + "use_unofficial_version_number=3Dfalse" + ;; Optimize for building everything at once, as oppos= ed + ;; to incrementally for development. See "docs/jumbo= .md". + ;; XXX: On some systems this may trigger a compiler e= rror. + ;;"use_jumbo_build=3Dtrue" + ;; Disable debugging features to save space. + "remove_webcore_debug_symbols=3Dtrue" + "enable_iterator_debugging=3Dfalse" + ;; Some of the unbundled libraries throws deprecation + ;; warnings, etc. Ignore it. + "treat_warnings_as_errors=3Dfalse" + ;; Don't add any API keys. End users can set them in= the + ;; environment if desired. See + ;; . + "use_official_google_api_keys=3Dfalse" + ;; Disable "field trials". + "fieldtrial_testing_like_official_build=3Dtrue" + + "use_system_freetype=3Dtrue" + "use_system_harfbuzz=3Dtrue" + "use_system_libjpeg=3Dtrue" + "use_system_lcms2=3Dtrue" + "use_system_zlib=3Dtrue" + ;; This is currently not supported on Linux: + ;; https://bugs.chromium.org/p/chromium/issues/detail= ?id=3D22208 + ;;"use_system_sqlite=3Dtrue" + + "use_gconf=3Dfalse" ;deprecated by gsettings + "use_gnome_keyring=3Dfalse" ;deprecated by libsecret + "use_gtk3=3Dtrue" + "use_openh264=3Dtrue" + "use_xkbcommon=3Dtrue" + "link_pulseaudio=3Dtrue" + + ;; Don't arbitrarily restrict formats supported by sy= stem ffmpeg. + "proprietary_codecs=3Dtrue" + "ffmpeg_branding=3D\"Chrome\"" + + ;; WebRTC stuff. + "rtc_use_h264=3Dtrue" + ;; Don't use bundled sources. + "rtc_build_json=3Dfalse" + "rtc_build_libevent=3Dfalse" + "rtc_build_libvpx=3Dfalse" + "rtc_build_opus=3Dfalse" + "rtc_build_ssl=3Dfalse" + ;; TODO: Package these. + "rtc_build_libsrtp=3Dtrue" ;2.0 + "rtc_build_libyuv=3Dtrue" + "rtc_build_openmax_dl=3Dtrue" + "rtc_build_usrsctp=3Dtrue" + (string-append "rtc_jsoncpp_root=3D\"" + (assoc-ref inputs "jsoncpp") + "/include/jsoncpp/json\"") + (string-append "rtc_ssl_root=3D\"" + (assoc-ref inputs "openssl") + "/include/openssl\"")))) + + ;; XXX: How portable is this. + (mkdir-p "third_party/node/linux/node-linux-x64") + (symlink (string-append (assoc-ref inputs "node") "/bin") + "third_party/node/linux/node-linux-x64/bin") + + (setenv "CC" "gcc") + (setenv "CXX" "g++") + ;; TODO: pre-compile instead. Avoids a race condition. + (setenv "PYTHONDONTWRITEBYTECODE" "1") + (and + ;; Build the "gn" tool. + (invoke "python" + "tools/gn/bootstrap/bootstrap.py" "-s" "-v") + ;; Generate ninja build files. + (invoke "./out/Release/gn" "gen" "out/Release" + (string-append "--args=3D" + (string-join gn-flags " "))))))) + (replace 'build + (lambda* (#:key outputs #:allow-other-keys) + (invoke "ninja" "-C" "out/Release" + "-j" (number->string (parallel-job-count)) + "chrome"))) + (replace 'install + (lambda* (#:key inputs outputs #:allow-other-keys) + (let* ((out (assoc-ref outputs "out")) + (bin (string-append out "/bin")) + (exe (string-append bin "/chromium")) + (lib (string-append out "/lib")) + (man (string-append out "/share/man/man1")) + (applications (string-append out "/share/application= s")) + (install-regexp (make-regexp "\\.(bin|pak)$")) + (locales (string-append lib "/locales")) + (resources (string-append lib "/resources")) + (gtk+ (assoc-ref inputs "gtk+")) + (mesa (assoc-ref inputs "mesa")) + (nss (assoc-ref inputs "nss")) + (udev (assoc-ref inputs "udev")) + (sh (which "sh"))) + + (substitute* '("chrome/app/resources/manpage.1.in" + "chrome/installer/linux/common/desktop.templ= ate") + (("@@MENUNAME@@") "Chromium") + (("@@PACKAGE@@") "chromium") + (("/usr/bin/@@USR_BIN_SYMLINK_NAME@@") exe)) + (mkdir-p man) + (copy-file "chrome/app/resources/manpage.1.in" + (string-append man "/chromium.1")) + (mkdir-p applications) + (copy-file "chrome/installer/linux/common/desktop.template" + (string-append applications "/chromium.desktop")) + + (with-directory-excursion "out/Release" + (for-each (lambda (file) + (install-file file lib)) + (scandir "." (cut regexp-exec install-regexp <>= ))) + (copy-file "chrome" (string-append lib "/chromium")) + + ;; TODO: Install icons from "../../chrome/app/themes" into + ;; "out/share/icons/hicolor/$size". + (install-file + "product_logo_48.png" + (string-append out "/share/icons/48x48/chromium.png")) + + (copy-recursively "locales" locales) + (copy-recursively "resources" resources) + + (mkdir-p bin) + ;; Add a thin wrapper to prevent the user from inadverten= tly + ;; installing non-free software through the Web Store. + ;; TODO: Discover extensions from the profile and pass + ;; something like "--disable-extensions-except=3D...". + (call-with-output-file exe + (lambda (port) + (format port + "#!~a~@ + if [ -z \"$CHROMIUM_ENABLE_WEB_STORE\" ]~@ + then~@ + CHROMIUM_FLAGS=3D\" \\~@ + --disable-background-networking \\~@ + --disable-extensions \\~@ + \"~@ + fi~@ + exec ~a $CHROMIUM_FLAGS \"$@\"~%" + sh (string-append lib "/chromium")))) + (chmod exe #o755) + + (wrap-program exe + ;; TODO: Get these in RUNPATH. + `("LD_LIBRARY_PATH" ":" prefix + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib:" + mesa "/lib:" udev "/lib"))) + ;; Avoid file manager crash. See . + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/sh= are")))) + #t))))))) + (native-inputs + `(("bison" ,bison) + ("git" ,git) ;last_commit_position.py + ("gperf" ,gperf) + ("ninja" ,ninja) + ("node" ,node) + ("pkg-config" ,pkg-config) + ("which" ,which) + ("yasm" ,yasm) + + ("python-beautifulsoup4" ,python2-beautifulsoup4) + ("python-html5lib" ,python2-html5lib) + ("python" ,python-2))) + (inputs + `(("alsa-lib" ,alsa-lib) + ("atk" ,atk) + ("cups" ,cups) + ("curl" ,curl) + ("dbus" ,dbus) + ("dbus-glib" ,dbus-glib) + ("expat" ,expat) + ("flac" ,flac) + ("ffmpeg" ,ffmpeg) + ("fontconfig" ,fontconfig) + ("freetype" ,freetype) + ("gdk-pixbuf" ,gdk-pixbuf) + ("glib" ,glib) + ("gtk+-2" ,gtk+-2) + ("gtk+" ,gtk+) + ("harfbuzz" ,harfbuzz) + ("icu4c" ,icu4c) + ("jsoncpp" ,jsoncpp) + ("lcms" ,lcms) + ("libevent" ,libevent) + ("libffi" ,libffi) + ("libjpeg-turbo" ,libjpeg-turbo) + ("libpng" ,libpng) + ("libusb" ,libusb) + ("libvpx" ,libvpx+experimental) + ("libwebp" ,libwebp) + ("libx11" ,libx11) + ("libxcb" ,libxcb) + ("libxcomposite" ,libxcomposite) + ("libxcursor" ,libxcursor) + ("libxdamage" ,libxdamage) + ("libxext" ,libxext) + ("libxfixes" ,libxfixes) + ("libxi" ,libxi) + ("libxkbcommon" ,libxkbcommon) + ("libxml2" ,libxml2) + ("libxrandr" ,libxrandr) + ("libxrender" ,libxrender) + ("libxscrnsaver" ,libxscrnsaver) + ("libxslt" ,libxslt) + ("libxtst" ,libxtst) + ("mesa" ,mesa) + ("minizip" ,minizip) + ("mit-krb5" ,mit-krb5) + ("nss" ,nss) + ("openh264" ,openh264) + ("openssl" ,openssl) + ("opus" ,opus+custom) + ("pango" ,pango) + ("pciutils" ,pciutils) + ("protobuf" ,protobuf) + ("pulseaudio" ,pulseaudio) + ("re2" ,re2) + ("snappy" ,snappy) + ("speech-dispatcher" ,speech-dispatcher) + ("sqlite" ,sqlite) + ("udev" ,eudev) + ("valgrind" ,valgrind))) + (home-page "https://www.chromium.org/") + (description + "Chromium is a web browser designed for speed and security. This +version incorporates patches from +@url{https://github.com/gcarq/inox-patchset,Inox} and +@url{https://www.debian.org/,Debian} in order to protect the users privacy= .") + ;; Chromium is developed as BSD-3, but bundles a large number of third= -party + ;; components with other licenses. For full information, see chrome:/= /credits. + (license (list license:bsd-3 + license:bsd-2 + license:expat + license:asl2.0 + license:mpl2.0 + license:public-domain + license:lgpl2.1+)))) diff --git a/gnu/packages/patches/chromium-gcc5.patch b/gnu/packages/patche= s/chromium-gcc5.patch new file mode 100644 index 000000000..56b2cd6ef =2D-- /dev/null +++ b/gnu/packages/patches/chromium-gcc5.patch @@ -0,0 +1,39 @@ +Work around a GCC5 bug where it fails to choose the correct base::span +constructor. + +Adapted from this commit: +https://gitweb.gentoo.org/repo/gentoo.git/commit/www-client/chromium?id=3D= 7843d29ab07411a9c70962fb90b4cd1546910242 + +--- a/gpu/ipc/common/mailbox_struct_traits.h ++++ b/gpu/ipc/common/mailbox_struct_traits.h +@@ -15,7 +15,7 @@ namespace mojo { + template <> + struct StructTraits { + static base::span name(const gpu::Mailbox& mailbox) { +- return mailbox.name; ++ return base::make_span(mailbox.name); + } + static bool Read(gpu::mojom::MailboxDataView data, gpu::Mailbox* out); + }; +--- a/services/viz/public/cpp/compositing/filter_operation_struct_traits.h ++++ b/services/viz/public/cpp/compositing/filter_operation_struct_traits.h +@@ -134,7 +134,7 @@ struct StructTraits { + static base::span matrix(const cc::FilterOperation& operat= ion) { + if (operation.type() !=3D cc::FilterOperation::COLOR_MATRIX) + return base::span(); +- return operation.matrix(); ++ return base::make_span(operation.matrix()); + } + + static base::span shape( +--- a/services/viz/public/cpp/compositing/quads_struct_traits.h ++++ b/services/viz/public/cpp/compositing/quads_struct_traits.h +@@ -308,7 +308,7 @@ + static base::span vertex_opacity(const viz::DrawQuad& inpu= t) { + const viz::TextureDrawQuad* quad =3D + viz::TextureDrawQuad::MaterialCast(&input); +- return quad->vertex_opacity; ++ return base::make_span(quad->vertex_opacity); + } +=20 + static bool y_flipped(const viz::DrawQuad& input) { diff --git a/gnu/packages/patches/chromium-remove-default-history.patch b/g= nu/packages/patches/chromium-remove-default-history.patch new file mode 100644 index 000000000..38be10820 =2D-- /dev/null +++ b/gnu/packages/patches/chromium-remove-default-history.patch @@ -0,0 +1,13 @@ +Don't pre-populate the New Tab Page for new profiles. + +--- a/chrome/browser/history/top_sites_factory.cc ++++ b/chrome/browser/history/top_sites_factory.cc +@@ -74,7 +74,7 @@ +=20 + void InitializePrepopulatedPageList( + history::PrepopulatedPageList* prepopulated_pages) { +-#if !defined(OS_ANDROID) ++#if false + DCHECK(prepopulated_pages); + prepopulated_pages->reserve(arraysize(kRawPrepopulatedPages)); + for (size_t i =3D 0; i < arraysize(kRawPrepopulatedPages); ++i) { =2D-=20 2.16.2 --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlqUaOEACgkQoqBt8qM6 VPp+iggAvr9wYNhGdMfXaMVCqNG/bC20MBmGdhGWvurkvNCuzr4uXPXuxfhjFTC2 cOCkxZ8Af2eL/+lTyM+s0C+LAuBLdfSQsiQHVYK8At0520K6e4QY8zhXu87/y5KG xjYABvUA5UUj7ryArOeBffpStb9KSJ79kuXB4K76cswvRSrEb0GX01tCqcAe7Zu4 ODWL9A25XHfTzBJ2wa8tsaw3DSZ5IGczl5KpvyPpF5ddQ9MLZm4x7AKiXeJCCiGk XAdIDzFwLrYLA3ZxIIyawqsK2U+ifA5jAoDsjAaHlHey7BoAEccLrdNHMGH3QJel sTz73/q50Lkyk7dF+3OFkcLeT0RNow== =o25f -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 26 15:34:34 2018 Received: (at 28004) by debbugs.gnu.org; 26 Feb 2018 20:34:34 +0000 Received: from localhost ([127.0.0.1]:33977 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqPTm-00047B-JD for submit@debbugs.gnu.org; Mon, 26 Feb 2018 15:34:34 -0500 Received: from aibo.runbox.com ([91.220.196.211]:58464) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqPTk-000472-99 for 28004@debbugs.gnu.org; Mon, 26 Feb 2018 15:34:33 -0500 Received: from [10.9.9.212] (helo=mailfront12.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1eqPTh-0007DV-AW; Mon, 26 Feb 2018 21:34:29 +0100 Received: from dslb-178-001-153-226.178.001.pools.vodafone-ip.de ([178.1.153.226] helo=localhost) by mailfront12.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1eqPTc-0000kN-E9; Mon, 26 Feb 2018 21:34:24 +0100 Date: Mon, 26 Feb 2018 20:34:34 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180226203434.s4rtbfprzwvziutz@abyayala> References: <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="6bhmuwtunj4qmmll" Content-Disposition: inline In-Reply-To: <87muzvv7ku.fsf@fastmail.com> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: Mike Gerwitz , ng0 , 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --6bhmuwtunj4qmmll Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 43K bytes: > ng0 writes: >=20 > > Marius Bakke transcribed 2.1K bytes: > >> Mike Gerwitz writes: > >>=20 > >> > On Tue, Jan 16, 2018 at 20:01:34 +0100, Marius Bakke wrote: > >> >> If there are no objections, expect to see this in 'master' in 1-2 w= eeks. > >> > > >> > I want to express gratitude for your hard work on this---given that > >> > IceCat does not contain many of the FF devtool updates, Chromium is = very > >> > desirable for web development. It's also needed for certain Node.js > >> > tools, like node-inspector. > >> > > >> > So, thank you! > >>=20 > >> Thank *you* for the kind words! :-) > >>=20 > >> Here is the latest iteration of this patch. New in this version: > >>=20 > >> * Chromium 64 (duh). > >> * The 'delete-bundled-software' phase has been moved to a snippet, > >> shaving ~100MiB (~22%) off the compressed tarball size (and > >> drastically reduces (de)compression time). > >> * The New Tab page does not show any thumbnails for new profiles. > > > > I think you forgot to attach the patches :) >=20 > Derp. I realized that and just used `git send-email`[0], but have > attached it here for convenience since the debbugs web UI doesn't allow > easy download of a raw message. >=20 > [0] https://debbugs.gnu.org/cgi/bugreport.cgi?msg=3D131;bug=3D28004#131 >=20 Great, thanks! I'll comment after building (so the usual 3 - 16 hours ;D). Something I noticed in the past: A succesful build for Chromium depends on the system libraries we use. The last version broke a while back when icu4c got updated I think. So changes need to be adjusted. We can not know when this happens, but we can act when it happens. --=20 ng0 A88C8ADD129828D7EAC02E52E22F9BBFEE348588 http://krosos.org | https://n0.is/~ng0/ | https://crash.cx --6bhmuwtunj4qmmll Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlqUb1oACgkQ4i+bv+40 hYiK5g/+K/WMXSSybQ4bpNeGfutyEqW0dn0DvSHYcl9IrtvtAIWZ/BVZJ35fkbWL cJ53PDD/fHcVYlFQAaWSwZmDY8UI5u4IWwx+I/bssAOm9ki1e6pu4AyXytgCXf07 f1B7y3lxIKqB3A3m/dPGRLKyuQOH/vIyPHIgKTDpX1YNzJ1hix2mOZpYbJVdPlQ0 pBCIq0n1H0qpkRsrj5ppRMfmye4Yx65ZeTnZzTEy+CZwHx9OjJjkbfUFYI/y4DFn I+RevT0CGgZ4ItYx5uqQCibdlPBIeZ/o5JJqbb1ekQ3lx98df9Riv6Xj/vpxL6Uu dhy8R9cv/uB3aFoU/3S7vUfwCnQQHYrUhjENMHgcSVFCL7sup0eO+KI09IoNkH4f Pf2s7vtL/4gB3bAkavQRSBjtkYhV+WbZg5oEtK0491RcAx0L/eFvAE3ne5qSQwfZ PLmedJ8Ek/9jlse46imDSeiKhaboZQk4z7vYOxlubFGAuaufqe1Lep6Z3MQ8G2XY h7jKfOmeU3HiUbIU07m77Wq5A6jf/eW5kxfrJOuECu893nKJWduGn0RsIrZT7ymh OEGOKvtVc4a91I9A3Arg7fbZMJGxFHYntq/E/pVSo1xVBfB/lXKliGZNfKJKLtGJ ecxfRjCmXisYs+Q8LvahHn0mWmh6YG6Aur0AfkQoghVOZHQVr+o= =iYgb -----END PGP SIGNATURE----- --6bhmuwtunj4qmmll-- From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 26 17:41:53 2018 Received: (at 28004) by debbugs.gnu.org; 26 Feb 2018 22:41:53 +0000 Received: from localhost ([127.0.0.1]:34088 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqRSz-0000X7-IH for submit@debbugs.gnu.org; Mon, 26 Feb 2018 17:41:53 -0500 Received: from m4s11.vlinux.de ([83.151.27.109]:44155 helo=bjoernhoefling.de) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqRSx-0000Wx-QF for 28004@debbugs.gnu.org; Mon, 26 Feb 2018 17:41:52 -0500 Received: from alma-ubu (pD951FC9C.dip0.t-ipconnect.de [217.81.252.156]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by bjoernhoefling.de (Postfix) with ESMTPSA id 95ECC3FF4E; Mon, 26 Feb 2018 23:41:49 +0100 (CET) Date: Mon, 26 Feb 2018 23:41:44 +0100 From: =?UTF-8?B?QmrDtnJuIEjDtmZsaW5n?= To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180226234144.032af030@alma-ubu> In-Reply-To: <87muzvv7ku.fsf@fastmail.com> References: <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> X-Mailer: Claws Mail 3.13.2 (GTK+ 2.24.30; x86_64-pc-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; boundary="Sig_/fxb2NNCr_6_UdHqSisnLt8i"; protocol="application/pgp-signature" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.0 (/) --Sig_/fxb2NNCr_6_UdHqSisnLt8i Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable Hi Marius, On Mon, 26 Feb 2018 21:06:57 +0100 Marius Bakke wrote: > ng0 writes: >=20 > > Marius Bakke transcribed 2.1K bytes: =20 > >> Mike Gerwitz writes: > >> =20 > >> > On Tue, Jan 16, 2018 at 20:01:34 +0100, Marius Bakke wrote: =20 > >> >> If there are no objections, expect to see this in 'master' in > >> >> 1-2 weeks. =20 > >> > > >> > I want to express gratitude for your hard work on this---given > >> > that IceCat does not contain many of the FF devtool updates, > >> > Chromium is very desirable for web development. It's also > >> > needed for certain Node.js tools, like node-inspector. > >> > > >> > So, thank you! =20 > >>=20 > >> Thank *you* for the kind words! :-) > >>=20 > >> Here is the latest iteration of this patch. New in this version: > >>=20 > >> * Chromium 64 (duh). > >> * The 'delete-bundled-software' phase has been moved to a snippet, > >> shaving ~100MiB (~22%) off the compressed tarball size (and > >> drastically reduces (de)compression time). > >> * The New Tab page does not show any thumbnails for new profiles. =20 > > > > I think you forgot to attach the patches :) =20 >=20 > Derp. I realized that and just used `git send-email`[0], but have > attached it here for convenience since the debbugs web UI doesn't > allow easy download of a raw message. >=20 > [0] https://debbugs.gnu.org/cgi/bugreport.cgi?msg=3D131;bug=3D28004#131 >=20 This looks like a lot of work. Thank you! I quickly tried to apply and build the patch and have two first remarks: The file says: ;;; Copyright =C2=A9 2016, 2017, 2018 Marius Bakke I haven't followed history, have you worked on this since 2016? One patch has a hash-mismatch: Starting download of /gnu/store/q8hlws48cjfcmz6i40jrnxn3kp750gy4-chromium-i= cu.patch =46rom https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/plain/de= bian/patches/system/icu.patch?id=3Ddebian/64.0.3282.119-2... icu.patch 2KiB 1.8MiB/s 00:00 [####################] 1= 00.0% output path `/gnu/store/q8hlws48cjfcmz6i40jrnxn3kp750gy4-chromium-icu.patch= ' should have sha256 hash `0kf77d8lyma3w0xpgfv2k0c741zp6ii08gzllfja6d5s59c1= 5ylv', instead has `19r0bpv2hapzq5m0m7rlz1dwn3h2ijgkilb2hmhw56qvwpbw0b59' @ build-failed /gnu/store/cqdllqn8ig5wnjn0yqvnh4vlzsvnpzv6-chromium-icu.pat= ch.drv - 1 output path `/gnu/store/q8hlws48cjfcmz6i40jrnxn3kp750gy4-chromiu= m-icu.patch' should have sha256 hash `0kf77d8lyma3w0xpgfv2k0c741zp6ii08gzll= fja6d5s59c15ylv', instead has `19r0bpv2hapzq5m0m7rlz1dwn3h2ijgkilb2hmhw56qv= wpbw0b59' cannot build derivation `/gnu/store/vacxbwsprcp52vp6q975450zi091dak2-chromi= um-64.0.3282.186.tar.xz.drv': 1 dependencies couldn't be built @ build-started /gnu/store/7q53inn1v32b5fain0h0wcrliclf0ff1-libvpx+experime= ntal-1.7.0.drv - x86_64-linux /var/log/guix/drvs/7q//53inn1v32b5fain0h0wcrl= iclf0ff1-libvpx+experimental-1.7.0.drv.bz2 cannot build derivation `/gnu/store/5qv7anaaqk4576pma9mhcsz1nhrx1n01-chromi= um-64.0.3282.186.drv': 1 dependencies couldn't be built guix build: error: build failed: build of `/gnu/store/5qv7anaaqk4576pma9mhc= sz1nhrx1n01-chromium-64.0.3282.186.drv' failed I looked into the file and it looks reasonable, like a patch-file. It has n= o download errors. It starts like this: description: backwards compatibility for older versions of icu author: Michael Gilbert --- a/v8/src/runtime/runtime-intl.cc +++ b/v8/src/runtime/runtime-intl.cc @@ -627,7 +627,11 @@ RUNTIME_FUNCTION(Runtime_PluralRulesSele ... Can you check this file again? Bj=C3=B6rn --Sig_/fxb2NNCr_6_UdHqSisnLt8i Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- Version: GnuPG v2 iEYEARECAAYFAlqUjSkACgkQvyhstlk+X/3RbACgoiitBCu1qBpIOijeNOOUXK7t 8yUAn1Gu6XXYAOwrG82NpCf0PDWqp3Km =1Egd -----END PGP SIGNATURE----- --Sig_/fxb2NNCr_6_UdHqSisnLt8i-- From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 26 21:02:04 2018 Received: (at 28004) by debbugs.gnu.org; 27 Feb 2018 02:02:04 +0000 Received: from localhost ([127.0.0.1]:34166 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqUai-0006y6-El for submit@debbugs.gnu.org; Mon, 26 Feb 2018 21:02:04 -0500 Received: from eggs.gnu.org ([208.118.235.92]:51549) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqUag-0006xc-3o for 28004@debbugs.gnu.org; Mon, 26 Feb 2018 21:02:02 -0500 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1eqUaa-0004EO-2I for 28004@debbugs.gnu.org; Mon, 26 Feb 2018 21:01:57 -0500 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,T_RP_MATCHES_RCVD autolearn=disabled version=3.3.2 Received: from fencepost.gnu.org ([2001:4830:134:3::e]:58129) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1eqUaZ-0004EI-U2; Mon, 26 Feb 2018 21:01:55 -0500 Received: from localhost ([::1]:33029 helo=mikegerwitz-pc.gerwitz.local) by fencepost.gnu.org with esmtps (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.82) (envelope-from ) id 1eqUaZ-0006wG-Ho; Mon, 26 Feb 2018 21:01:55 -0500 From: Mike Gerwitz To: Marius Bakke Subject: Re: [bug#28004] Chromium In-Reply-To: <87vaejvclc.fsf@fastmail.com> (Marius Bakke's message of "Mon, 26 Feb 2018 19:18:39 +0100") Date: Mon, 26 Feb 2018 21:00:49 -0500 Message-ID: <87k1uznqcu.fsf@gnu.org> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/25.3 (gnu/linux) OpenPGP: id=22175B02E626BC98D7C0C2E5F22BB8158EE30EAB MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Received-From: 2001:4830:134:3::e X-Spam-Score: -5.0 (-----) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -5.0 (-----) --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable On Mon, Feb 26, 2018 at 19:18:39 +0100, Marius Bakke wrote: > Now, when launching the browser for the first time, it *still* connects > to Google services. After a while it also does a lookup for AdWords... Do you know what code initiates this? Would it be easy to remove, and would that harm other functionality? Saying that it only runs the first time implies to me that there's a flag, and that perhaps the flag can either be permanently set or the conditional triggering this behavior removed. =2D-=20 Mike Gerwitz Free Software Hacker+Activist | GNU Maintainer & Volunteer GPG: D6E9 B930 028A 6C38 F43B 2388 FEF6 3574 5E6F 6D05 https://mikegerwitz.com --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- Version: GnuPG v2 iQIcBAEBCgAGBQJalLvRAAoJEIyRe39dxRuigesP+wTO/zFQ29yQM6Q/PjL8rMoJ LXkpDz+FNhMHgHHFVZ8AakPeRT+EqURy6lUybc3xyY0c+09Y0GvB51GJaFccHqIC VYGUIrAWqvAQVfZBmu/DJ2olDt2RDfRTy2KmIYU8ML97tNg9JaxUb48VLLcuNoRY n9nSecLBtmJAqoAAN8SguoV3wMVnMXprtjMeUfF9vrrJLRLmshs8eD84YWXJpxmq Vxa2MbkyQFYpR4aLbKiCQ5eb9guH0AA0DC1iqq5AJ5svaR/bFz8xKbPVbCnsva3S cXF7YJOCpCwTmzSkE7BQ/PaYMg3aOPyFWoFPwy0dQ2xsNiLwN8dwvhwuclbiXDwK 1FziPXIzva6Z+FYbHDTCWj1w4IVNUCLl078gQXhwPqz64ImBlM5zLPwZJGNTj5iJ H6O1DgkTB1YpgVl0iXM4DBZUbfXimVFfhKeD9ufJIHwsUX2wAmJ5HfWrQhro71xy BqluXS5b24E0ImJQsDp5DzgCO0jvAjbh0kigpAvkpq9V3GQHvFVk1u4XgXWEqhJ5 75pRRrXfBwbn/duR1e8Y0E7HxJbR8Ihtjae8GYkvBWfpjhtwnQCcWD8EfSGDG4Pb lApFzxGBGtcEwtNHbbMbcXNFppUfipXM2vrSh1nJ7FKFXKzSkBlIOTgkMgxSVcbH 5HHvXtQ7KRkA5MdOF1yO =sK36 -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Tue Feb 27 16:57:29 2018 Received: (at 28004) by debbugs.gnu.org; 27 Feb 2018 21:57:29 +0000 Received: from localhost ([127.0.0.1]:36070 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqnFY-0001f2-Ns for submit@debbugs.gnu.org; Tue, 27 Feb 2018 16:57:29 -0500 Received: from aibo.runbox.com ([91.220.196.211]:38656) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqnFW-0001et-KS for 28004@debbugs.gnu.org; Tue, 27 Feb 2018 16:57:27 -0500 Received: from [10.9.9.211] (helo=mailfront11.runbox.com) by mailtransmit03.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1eqnFU-00068T-Mu; Tue, 27 Feb 2018 22:57:24 +0100 Received: from dslb-092-073-159-161.092.073.pools.vodafone-ip.de ([92.73.159.161] helo=localhost) by mailfront11.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1eqnFD-0002MP-LX; Tue, 27 Feb 2018 22:57:07 +0100 Date: Tue, 27 Feb 2018 21:57:17 +0000 From: ng0 To: =?utf-8?B?QmrDtnJuIEjDtmZsaW5n?= Subject: Re: [bug#28004] Chromium Message-ID: <20180227215717.bie4f2zdrn5s5oyo@abyayala> References: <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="bwzlrzka7gfznhcm" Content-Disposition: inline In-Reply-To: <20180226234144.032af030@alma-ubu> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Marius Bakke X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --bwzlrzka7gfznhcm Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Bj=C3=B6rn H=C3=B6fling transcribed 4.0K bytes: > Hi Marius, >=20 > On Mon, 26 Feb 2018 21:06:57 +0100 > Marius Bakke wrote: >=20 > > ng0 writes: > >=20 > > > Marius Bakke transcribed 2.1K bytes: =20 > > >> Mike Gerwitz writes: > > >> =20 > > >> > On Tue, Jan 16, 2018 at 20:01:34 +0100, Marius Bakke wrote: =20 > > >> >> If there are no objections, expect to see this in 'master' in > > >> >> 1-2 weeks. =20 > > >> > > > >> > I want to express gratitude for your hard work on this---given > > >> > that IceCat does not contain many of the FF devtool updates, > > >> > Chromium is very desirable for web development. It's also > > >> > needed for certain Node.js tools, like node-inspector. > > >> > > > >> > So, thank you! =20 > > >>=20 > > >> Thank *you* for the kind words! :-) > > >>=20 > > >> Here is the latest iteration of this patch. New in this version: > > >>=20 > > >> * Chromium 64 (duh). > > >> * The 'delete-bundled-software' phase has been moved to a snippet, > > >> shaving ~100MiB (~22%) off the compressed tarball size (and > > >> drastically reduces (de)compression time). > > >> * The New Tab page does not show any thumbnails for new profiles. = =20 > > > > > > I think you forgot to attach the patches :) =20 > >=20 > > Derp. I realized that and just used `git send-email`[0], but have > > attached it here for convenience since the debbugs web UI doesn't > > allow easy download of a raw message. > >=20 > > [0] https://debbugs.gnu.org/cgi/bugreport.cgi?msg=3D131;bug=3D28004#131 > >=20 >=20 >=20 > This looks like a lot of work. Thank you! >=20 > I quickly tried to apply and build the patch and have two first remarks: >=20 > The file says: >=20 > ;;; Copyright =C2=A9 2016, 2017, 2018 Marius Bakke >=20 > I haven't followed history, have you worked on this since 2016? Marius, myself (and others?) have been working on this at least since Octob= er 2017. I did a search, and indeed: Date: Tue, 27 Sep 2016 07:39:10 +0000 ... this = is when I first send the original Inox WIP. Wow. > One patch has a hash-mismatch: >=20 > Starting download of /gnu/store/q8hlws48cjfcmz6i40jrnxn3kp750gy4-chromium= -icu.patch > From https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/plain/= debian/patches/system/icu.patch?id=3Ddebian/64.0.3282.119-2... > icu.patch 2KiB 1.8MiB/s 00:00 [####################]= 100.0% > output path `/gnu/store/q8hlws48cjfcmz6i40jrnxn3kp750gy4-chromium-icu.pat= ch' should have sha256 hash `0kf77d8lyma3w0xpgfv2k0c741zp6ii08gzllfja6d5s59= c15ylv', instead has `19r0bpv2hapzq5m0m7rlz1dwn3h2ijgkilb2hmhw56qvwpbw0b59' > @ build-failed /gnu/store/cqdllqn8ig5wnjn0yqvnh4vlzsvnpzv6-chromium-icu.p= atch.drv - 1 output path `/gnu/store/q8hlws48cjfcmz6i40jrnxn3kp750gy4-chrom= ium-icu.patch' should have sha256 hash `0kf77d8lyma3w0xpgfv2k0c741zp6ii08gz= llfja6d5s59c15ylv', instead has `19r0bpv2hapzq5m0m7rlz1dwn3h2ijgkilb2hmhw56= qvwpbw0b59' > cannot build derivation `/gnu/store/vacxbwsprcp52vp6q975450zi091dak2-chro= mium-64.0.3282.186.tar.xz.drv': 1 dependencies couldn't be built > @ build-started /gnu/store/7q53inn1v32b5fain0h0wcrliclf0ff1-libvpx+experi= mental-1.7.0.drv - x86_64-linux /var/log/guix/drvs/7q//53inn1v32b5fain0h0wc= rliclf0ff1-libvpx+experimental-1.7.0.drv.bz2 > cannot build derivation `/gnu/store/5qv7anaaqk4576pma9mhcsz1nhrx1n01-chro= mium-64.0.3282.186.drv': 1 dependencies couldn't be built > guix build: error: build failed: build of `/gnu/store/5qv7anaaqk4576pma9m= hcsz1nhrx1n01-chromium-64.0.3282.186.drv' failed >=20 > I looked into the file and it looks reasonable, like a patch-file. It has= no download errors. >=20 > It starts like this: >=20 > description: backwards compatibility for older versions of icu > author: Michael Gilbert >=20 > --- a/v8/src/runtime/runtime-intl.cc > +++ b/v8/src/runtime/runtime-intl.cc > @@ -627,7 +627,11 @@ RUNTIME_FUNCTION(Runtime_PluralRulesSele >=20 > ... >=20 > Can you check this file again? With the patch Marius send yesterday it works for me. > Bj=C3=B6rn >=20 >=20 --=20 A88C8ADD129828D7EAC02E52E22F9BBFEE348588 https://n0.is --bwzlrzka7gfznhcm Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlqV1D0ACgkQ4i+bv+40 hYhqAQ//UY2/WT2moFhQDbhUIXhDTt/k+FmWuYcTbFJku1s6nYyPQDas90ctE1wH APbD7Zmv017EYCUIVSSiloboT1Q5EnNAHzgJwtcKCkRhVNpfTXaIG+vW6xXcbya0 bVcyKJ8KdjVrcOPlAopepI6uWuqSF6EL3LJG99iO6FySNDEDQ+20ZONXQX5g99UJ v7uSaFgc51OHu3LNaaT+1K1DC8CgwdekhTIr/dI1vfhh42Zz+HMVv7pm/8my4VlD KxUvaKRuNhU4SPbzWKSb9fKO0qfB2SysCMYpwPXkFCat2RALKNWxJfQj2ytTWIuN br80H7DwsWCtaUDcCG240JGX8+4cag/lwVBYK+w++5swbV+Li/TndPuJLDvUj1x4 v0xRu4IXC4vCZ3xLTMBjHLxARUxpcIobwSSUEirKliMAi6BXsNp4y/l4L/9TNlMN rIZYxosvPu3cZDPyJwnuAZuIAlBi0If+uKGht6GeThQKMpfktzvrdWfBEa+KQfjN nLHqu3tzrC7Z74h0su3DZpXrX2ftA1Zt8ixVszE4Bu47cfhjp3KahrGgsc/hfVXv KQxcYgCbW//gYJOjLmily/oR35X8nmQscXvdyp8KtTPQBWiCxWQZ+pia6TXw3/3c Klvd9263lF4zAmfM6sgWevzOQ+1zWikEm7IHmpsFr1lZRwz86MU= =ei6V -----END PGP SIGNATURE----- --bwzlrzka7gfznhcm-- From debbugs-submit-bounces@debbugs.gnu.org Tue Feb 27 17:18:12 2018 Received: (at 28004) by debbugs.gnu.org; 27 Feb 2018 22:18:12 +0000 Received: from localhost ([127.0.0.1]:36110 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqnZV-00046f-Aw for submit@debbugs.gnu.org; Tue, 27 Feb 2018 17:18:12 -0500 Received: from aibo.runbox.com ([91.220.196.211]:51632) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqnZM-000462-Ov for 28004@debbugs.gnu.org; Tue, 27 Feb 2018 17:18:02 -0500 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1eqnZL-0001qf-Bi; Tue, 27 Feb 2018 23:17:55 +0100 Received: from dslb-092-073-159-161.092.073.pools.vodafone-ip.de ([92.73.159.161] helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1eqnYS-0005BM-O4; Tue, 27 Feb 2018 23:17:01 +0100 Date: Tue, 27 Feb 2018 22:17:11 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180227221711.omdpbgemrjwinohb@abyayala> References: <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="wj6qt76xr6nidfo4" Content-Disposition: inline In-Reply-To: <87muzvv7ku.fsf@fastmail.com> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --wj6qt76xr6nidfo4 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 43K bytes: > ng0 writes: >=20 > > Marius Bakke transcribed 2.1K bytes: > >> Mike Gerwitz writes: > >>=20 > >> > On Tue, Jan 16, 2018 at 20:01:34 +0100, Marius Bakke wrote: > >> >> If there are no objections, expect to see this in 'master' in 1-2 w= eeks. > >> > > >> > I want to express gratitude for your hard work on this---given that > >> > IceCat does not contain many of the FF devtool updates, Chromium is = very > >> > desirable for web development. It's also needed for certain Node.js > >> > tools, like node-inspector. > >> > > >> > So, thank you! > >>=20 > >> Thank *you* for the kind words! :-) > >>=20 > >> Here is the latest iteration of this patch. New in this version: > >>=20 > >> * Chromium 64 (duh). > >> * The 'delete-bundled-software' phase has been moved to a snippet, > >> shaving ~100MiB (~22%) off the compressed tarball size (and > >> drastically reduces (de)compression time). > >> * The New Tab page does not show any thumbnails for new profiles. > > > > I think you forgot to attach the patches :) >=20 > Derp. I realized that and just used `git send-email`[0], but have > attached it here for convenience since the debbugs web UI doesn't allow > easy download of a raw message. >=20 > [0] https://debbugs.gnu.org/cgi/bugreport.cgi?msg=3D131;bug=3D28004#131 > Comments inlined, some words ahead. I think it's good that we will be able to handle extensions via Guix. But: We should point it out that you won't be able to install extensions manually, via the store or as a file. People who betatested this got confused. Once we have extensions as packages, we can describe how to get extensions. Gentoo (and Nix?) have done some work on handling the extensions via system tools. > From f00529f4cd9e2e5efef146915d217cbb413d1f1a Mon Sep 17 00:00:00 2001 > From: Marius Bakke > Date: Wed, 12 Oct 2016 17:25:05 +0100 > Subject: [PATCH] gnu: Add chromium. >=20 > * gnu/packages/chromium.scm: New file. > * gnu/packages/patches/chromium-gcc.patch, > gnu/packages/patches/chromium-remove-default-history.patch: New files. > * gnu/local.mk: Record it. > --- > gnu/local.mk | 3 + > gnu/packages/chromium.scm | 756 +++++++++++++++= ++++++ > gnu/packages/patches/chromium-gcc5.patch | 39 ++ > .../patches/chromium-remove-default-history.patch | 13 + > 4 files changed, 811 insertions(+) > create mode 100644 gnu/packages/chromium.scm > create mode 100644 gnu/packages/patches/chromium-gcc5.patch > create mode 100644 gnu/packages/patches/chromium-remove-default-history.= patch >=20 > diff --git a/gnu/local.mk b/gnu/local.mk > index fa98810d6..fb1320f7b 100644 > --- a/gnu/local.mk > +++ b/gnu/local.mk > @@ -92,6 +92,7 @@ GNU_SYSTEM_MODULES =3D \ > %D%/packages/check.scm \ > %D%/packages/chemistry.scm \ > %D%/packages/chez.scm \ > + %D%/packages/chromium.scm \ > %D%/packages/ci.scm \ > %D%/packages/cinnamon.scm \ > %D%/packages/cmake.scm \ > @@ -581,6 +582,8 @@ dist_patch_DATA =3D \ > %D%/packages/patches/ceph-skip-collect-sys-info-test.patch \ > %D%/packages/patches/ceph-skip-unittest_blockdev.patch \ > %D%/packages/patches/chmlib-inttypes.patch \ > + %D%/packages/patches/chromium-gcc5.patch \ > + %D%/packages/patches/chromium-remove-default-history.patch \ > %D%/packages/patches/clang-libc-search-path.patch \ > %D%/packages/patches/clang-3.8-libc-search-path.patch \ > %D%/packages/patches/clang-runtime-asan-build-fixes.patch \ > diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm > new file mode 100644 > index 000000000..1dd77b089 > --- /dev/null > +++ b/gnu/packages/chromium.scm > @@ -0,0 +1,756 @@ > +;;; GNU Guix --- Functional package management for GNU > +;;; Copyright =C2=A9 2016, 2017, 2018 Marius Bakke > +;;; > +;;; This file is part of GNU Guix. > +;;; > +;;; GNU Guix is free software; you can redistribute it and/or modify it > +;;; under the terms of the GNU General Public License as published by > +;;; the Free Software Foundation; either version 3 of the License, or (at > +;;; your option) any later version. > +;;; > +;;; GNU Guix is distributed in the hope that it will be useful, but > +;;; WITHOUT ANY WARRANTY; without even the implied warranty of > +;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the > +;;; GNU General Public License for more details. > +;;; > +;;; You should have received a copy of the GNU General Public License > +;;; along with GNU Guix. If not, see . > + > +(define-module (gnu packages chromium) > + #:use-module ((guix licenses) #:prefix license:) > + #:use-module (guix packages) > + #:use-module (guix download) > + #:use-module (guix git-download) > + #:use-module (guix utils) > + #:use-module (guix build-system gnu) > + #:use-module (gnu packages) > + #:use-module (gnu packages assembly) > + #:use-module (gnu packages base) > + #:use-module (gnu packages bison) > + #:use-module (gnu packages compression) > + #:use-module (gnu packages cups) > + #:use-module (gnu packages curl) > + #:use-module (gnu packages databases) > + #:use-module (gnu packages fontutils) > + #:use-module (gnu packages ghostscript) > + #:use-module (gnu packages gl) > + #:use-module (gnu packages glib) > + #:use-module (gnu packages gnome) > + #:use-module (gnu packages gnuzilla) > + #:use-module (gnu packages gperf) > + #:use-module (gnu packages gtk) > + #:use-module (gnu packages icu4c) > + #:use-module (gnu packages image) > + #:use-module (gnu packages libevent) > + #:use-module (gnu packages libffi) > + #:use-module (gnu packages libusb) > + #:use-module (gnu packages linux) > + #:use-module (gnu packages kerberos) > + #:use-module (gnu packages ninja) > + #:use-module (gnu packages node) > + #:use-module (gnu packages pciutils) > + #:use-module (gnu packages photo) > + #:use-module (gnu packages pkg-config) > + #:use-module (gnu packages protobuf) > + #:use-module (gnu packages pulseaudio) > + #:use-module (gnu packages python) > + #:use-module (gnu packages python-web) > + #:use-module (gnu packages regex) > + #:use-module (gnu packages serialization) > + #:use-module (gnu packages speech) > + #:use-module (gnu packages tls) > + #:use-module (gnu packages valgrind) > + #:use-module (gnu packages version-control) > + #:use-module (gnu packages video) > + #:use-module (gnu packages xiph) > + #:use-module (gnu packages xml) > + #:use-module (gnu packages xdisorg) > + #:use-module (gnu packages xorg)) > + > +(define (strip-directory-prefix pathspec) > + "Return everything after the last '/' in PATHSPEC." > + (let ((index (string-rindex pathspec #\/))) > + (if index > + (string-drop pathspec (+ 1 index)) > + pathspec))) > + > +(define (chromium-patch-file-name pathspec) > + (let ((patch-name (strip-directory-prefix pathspec))) > + (if (string-prefix? "chromium-" patch-name) > + patch-name > + (string-append "chromium-" patch-name)))) > + > +;; https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/tree/de= bian/patches > +(define (debian-patch pathspec revision hash) > + (origin > + (method url-fetch) > + (uri (string-append > + "https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git" > + "/plain/debian/patches/" pathspec "?id=3D" revision)) > + (sha256 (base32 hash)) > + (file-name (chromium-patch-file-name pathspec)))) > + > +;; https://gitweb.gentoo.org/repo/gentoo.git/tree/www-client/chromium/fi= les > +(define (gentoo-patch pathspec revision hash) > + (origin > + (method url-fetch) > + (uri (string-append > + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-client" > + "/chromium/files/" pathspec "?id=3D" revision)) > + (sha256 (base32 hash)) > + (file-name (chromium-patch-file-name pathspec)))) > + > +;; https://github.com/gcarq/inox-patchset > +(define (inox-patch pathspec revision hash) > + (origin > + (method url-fetch) > + (uri (string-append "https://raw.githubusercontent.com/gcarq/inox-pa= tchset/" > + revision "/" pathspec)) > + (sha256 (base32 hash)) > + (file-name (chromium-patch-file-name pathspec)))) > + > +;; https://github.com/NixOS/nixpkgs/tree/master/pkgs/applications/networ= king/browsers/chromium > +(define (nixos-patch pathspec revision hash) > + (origin > + (method url-fetch) > + (uri (string-append "https://raw.githubusercontent.com/NixOS/nixpkgs= /" > + revision "/pkgs/applications/networking/browsers" > + "/chromium/patches/" pathspec)) > + (sha256 (base32 hash)) > + (file-name (chromium-patch-file-name pathspec)))) > + > +;; Fix build for older versions of GCC. > +(define %chromium-angle-gcc-compat.patch > + (gentoo-patch "chromium-angle-r0.patch" > + "08971011b4d6fa37aa906920fba7564e48b9e60b" > + "0izdrqwsyr48117dhvwdsk8c6dkrnq2njida1q4mb1lagvwbz7gc")) > + > +;; https://webrtc-review.googlesource.com/9384 > +(define %chromium-webrtc-gcc-compat.patch > + (gentoo-patch "chromium-webrtc-r0.patch" > + "08971011b4d6fa37aa906920fba7564e48b9e60b" > + "0qj5b4w9kav51ylpdf38vm5w7p2gx4qp8p45vrfggp7miicg9cmw")) > + > +;; https://chromium-review.googlesource.com/813737 > +(define %chromium-memcpy.patch > + (gentoo-patch "chromium-memcpy-r0.patch" > + "08971011b4d6fa37aa906920fba7564e48b9e60b" > + "1d3vra59wjg2lva7ddv55ff6l57mk9k50llsplr0b7vxk0lh0ps5")) > + > +(define %chromium-system-nspr.patch > + (debian-patch "system/nspr.patch" > + "debian/64.0.3282.119-2" > + "0pcwk3jsx8hjzd4s1v7p11jd8vpdqfnq82di31222cjx0bl6275r")) > + > +(define %chromium-system-libevent.patch > + (debian-patch "system/event.patch" > + "debian/64.0.3282.119-2" > + "1dxzn1yf05mzf21c25sczj4zhkknf03x9bc3xzznqpvnsf3cjpr0")) > + > +(define %chromium-system-icu.patch > + (debian-patch "system/icu.patch" > + "debian/64.0.3282.119-2" > + "0kf77d8lyma3w0xpgfv2k0c741zp6ii08gzllfja6d5s59c15ylv")) > + > +;; Don't show a warning about missing API keys. > +(define %chromium-disable-api-keys-warning.patch > + (debian-patch "disable/google-api-warning.patch" > + "debian/64.0.3282.119-2" > + "1932xkrskm4nnglzj6xfjpycx4chsycj9ay3ipkq5f6xk21a1xm0")) > + > +;; Add DuckDuckGo and set it as the default search engine. > +(define %chromium-duckduckgo.patch > + (inox-patch "0011-add-duckduckgo-search-engine.patch" > + "d655594419af6b82a2a070e4d3eedd926a04fa79" > + "0p8x98g71ngkd3wbl5q36wrl18ff185sfrr5fcwjbgrv3v7r6ra7")) > + > +;; Don't start a "Login Wizard" at first launch. > +(define %chromium-first-run.patch > + (inox-patch "0018-disable-first-run-behaviour.patch" > + "d655594419af6b82a2a070e4d3eedd926a04fa79" > + "1y4zsqqf2125jkb1phwy9g5hcbd9xhyv5lr4xcaly66rpdzx2ayb")) > + > +;; Use privacy-preserving defaults. > +(define %chromium-default-preferences.patch > + (inox-patch "0006-modify-default-prefs.patch" > + "d655594419af6b82a2a070e4d3eedd926a04fa79" > + "0qpd5l3wiw7325cicjzvdql0gay7jl4afml4nrbmy3w40i1ai2rf")) > + > +;; Recent versions of Chromium may load a remote search engine on the > +;; New Tab Page, causing unnecessary and involuntary network traffic. > +(define %chromium-restore-classic-ntp.patch > + (inox-patch "0008-restore-classic-ntp.patch" > + "d655594419af6b82a2a070e4d3eedd926a04fa79" > + "0lj018q6vd6m43cj8rnraqgi4lp2iq76i1i0078dav4cxnzdryfs")) > + > +(define opus+custom > + (package (inherit opus) > + (name "opus+custom") > + (arguments > + `(;; Opus Custom is an optional extension of the Opus > + ;; specification that allows for unsupported frame > + ;; sizes. Chromium requires that this is enabled. > + #:configure-flags '("--enable-custom-modes") > + ,@(package-arguments opus))))) > + > +(define libvpx+experimental > + (package > + (inherit libvpx) > + (name "libvpx+experimental") > + (arguments > + `(,@(substitute-keyword-arguments (package-arguments libvpx) > + ((#:configure-flags flags ''()) > + ;; Spatial SVC is an experimental VP9 encoder required by Ch= romium. > + `(cons* "--enable-experimental" "--enable-spatial-svc" > + ,flags))))))) > + > +(define-public chromium > + (package > + (name "chromium") > + (version "64.0.3282.186") > + (synopsis "Graphical web browser") > + (source (origin > + (method url-fetch) > + (uri (string-append "https://commondatastorage.googleapis.= com/" > + "chromium-browser-official/chromium-" > + version ".tar.xz")) > + (sha256 > + (base32 > + "0q0q1whspmzyln04gxhgl3jd2vrgb4imh8r9qw6c06i3b63j3l2z")) > + (patches (list %chromium-duckduckgo.patch > + %chromium-default-preferences.patch > + %chromium-first-run.patch > + %chromium-restore-classic-ntp.patch > + %chromium-angle-gcc-compat.patch > + %chromium-webrtc-gcc-compat.patch > + %chromium-memcpy.patch > + %chromium-system-icu.patch > + %chromium-system-nspr.patch > + %chromium-system-libevent.patch > + %chromium-disable-api-keys-warning.patch > + (search-patch "chromium-gcc5.patch") > + (search-patch "chromium-remove-default-hist= ory.patch"))) > + (modules '((srfi srfi-1) > + (ice-9 ftw) > + (ice-9 regex) > + (guix build utils))) > + (snippet > + '(begin > + (let ((preserved-files > + (map > + (lambda (path) (string-append "./" path)) > + (list > + "base/third_party/dmg_fp" > + "base/third_party/dynamic_annotations" > + "base/third_party/icu" > + "base/third_party/libevent" > + "base/third_party/nspr" > + "base/third_party/superfasthash" > + "base/third_party/symbolize" ;glog > + "base/third_party/xdg_mime" > + "base/third_party/xdg_user_dirs" > + "buildtools/third_party/libc++" > + "chrome/third_party/mozilla_security_manager" > + "courgette/third_party" > + "net/third_party/mozilla_security_manager" > + "net/third_party/nss" > + "third_party/adobe/flash/flapper_version.h" > + ;; FIXME: This is used in: > + ;; * ui/webui/resources/js/analytics.js > + ;; * ui/file_manager/ > + "third_party/analytics" > + "third_party/angle" > + "third_party/angle/src/common/third_party/bas= e" > + "third_party/angle/src/common/third_party/smh= asher" > + "third_party/angle/src/third_party/compiler" > + "third_party/angle/src/third_party/libXNVCtrl" > + "third_party/angle/src/third_party/trace_even= t" > + "third_party/blink" > + "third_party/boringssl" > + "third_party/boringssl/src/third_party/fiat" > + "third_party/breakpad" > + "third_party/brotli" > + "third_party/cacheinvalidation" > + "third_party/catapult" > + "third_party/catapult/common/py_vulcanize/thi= rd_party/rcssmin" > + "third_party/catapult/common/py_vulcanize/thi= rd_party/rjsmin" > + "third_party/catapult/third_party/polymer" > + "third_party/catapult/tracing/third_party/d3" > + "third_party/catapult/tracing/third_party/gl-= matrix" > + "third_party/catapult/tracing/third_party/jsz= ip" > + "third_party/catapult/tracing/third_party/man= nwhitneyu" > + "third_party/catapult/tracing/third_party/obo= e" > + "third_party/catapult/tracing/third_party/pak= o" > + "third_party/ced" > + "third_party/cld_3" > + "third_party/crc32c" > + "third_party/cros_system_api" > + "third_party/dom_distiller_js" > + "third_party/fips181" > + "third_party/flatbuffers" > + ;; PDFium requires a private freetype API. > + ;; > + "third_party/freetype/src/src/psnames/pstable= s.h" > + "third_party/glslang-angle" > + "third_party/google_input_tools" > + "third_party/google_input_tools/third_party/c= losure_library" > + (string-append "third_party/google_input_tool= s/third_party" > + "/closure_library/third_party/= closure") > + "third_party/googletest" > + "third_party/harfbuzz-ng" > + "third_party/hunspell" > + "third_party/iccjpeg" > + "third_party/inspector_protocol" > + "third_party/jinja2" > + "third_party/jstemplate" > + "third_party/khronos" > + "third_party/leveldatabase" > + "third_party/libXNVCtrl" > + "third_party/libaddressinput" > + "third_party/libjingle_xmpp" > + "third_party/libphonenumber" > + "third_party/libsecret" ;FIXME: needs pkg-con= fig support. > + "third_party/libsrtp" ;TODO: Requires libsr= tp@2. > + "third_party/libudev" > + "third_party/libwebm" > + "third_party/libxml" > + "third_party/libyuv" > + "third_party/lss" > + "third_party/lzma_sdk" > + "third_party/markupsafe" > + "third_party/mesa" > + "third_party/metrics_proto" > + "third_party/modp_b64" > + "third_party/mt19937ar" > + "third_party/node" > + (string-append "third_party/node/node_modules= /" > + "polymer-bundler/lib/third_par= ty/UglifyJS2") > + "third_party/openmax_dl" > + "third_party/ots" > + "third_party/pdfium" > + "third_party/pdfium/third_party" > + "third_party/ply" > + "third_party/polymer" > + "third_party/protobuf" > + "third_party/protobuf/third_party/six" > + "third_party/qcms" > + "third_party/sfntly" > + "third_party/skia" > + "third_party/skia/third_party/vulkan" > + "third_party/skia/third_party/gif" > + "third_party/smhasher" > + "third_party/speech-dispatcher" > + "third_party/spirv-headers" > + "third_party/spirv-tools-angle" > + "third_party/sqlite" > + "third_party/swiftshader" > + "third_party/swiftshader/third_party" > + "third_party/usb_ids" > + "third_party/usrsctp" > + "third_party/vulkan" > + "third_party/vulkan-validation-layers" > + "third_party/WebKit" > + "third_party/web-animations-js" > + "third_party/webrtc" > + "third_party/webrtc_overrides" > + "third_party/widevine/cdm/widevine_cdm_versio= n.h" > + "third_party/widevine/cdm/widevine_cdm_common= =2Eh" > + "third_party/woff2" > + "third_party/xdg-utils" > + "third_party/yasm/run_yasm.py" > + "third_party/zlib/google" > + "url/third_party/mozilla" > + "v8/src/third_party/valgrind" > + "v8/third_party/inspector_protocol")))) > + > + ;; This is an implementation of > + ;; "build/linux/unbundle/remove_bundled_libraries.py= ". > + ;; It traverses any "third_party" directory and dele= tes > + ;; files that are: > + ;; * not ending with ".gn" or ".gni"; or > + ;; * not explicitly named as argument (folder or fil= e). > + ;; TODO: Remove empty directories. > + (define (delete-files-except exceptions dir) > + > + (define (enter? name stat result) > + (not (member name exceptions))) > + > + (define (leaf name stat result) > + (let ((protected-files (make-regexp "\\.(gn|gyp)= i?$" > + regexp/icase= ))) > + (unless (or (member name exceptions) > + (regexp-exec protected-files name)) > + (delete-file name)))) > + > + (file-system-fold enter? > + leaf > + (lambda (dir stat result) result= ) ;down > + (lambda (dir stat result) result= ) ;up > + (lambda (dir stat result) result= ) ;skip > + (lambda (dir stat result) result= ) ;error > + #t > + dir)) > + > + (for-each (lambda (third-party) > + (delete-files-except preserved-files > + third-party)) > + (find-files "." "^third_party$" #:director= ies? #t)) > + > + ;; Replace GN files from third_party with shims for = building > + ;; against system libraries. Keep this list in sync= with > + ;; "build/linux/unbundle/replace_gn_files.py". > + (for-each (lambda (pair) > + (let ((source (string-append > + "build/linux/unbundle/" (= car pair))) > + (dest (cdr pair))) > + (copy-file source dest))) > + (list > + '("ffmpeg.gn" . "third_party/ffmpeg/BUILD= =2Egn") > + '("flac.gn" . "third_party/flac/BUILD.gn") > + '("freetype.gn" . "third_party/freetype/B= UILD.gn") > + ;; FIXME: This is no longer supported sin= ce 63. > + ;;'("harfbuzz-ng.gn" . "third_party/harfb= uzz-ng/BUILD.gn") > + '("icu.gn" . "third_party/icu/BUILD.gn") > + '("libdrm.gn" . "third_party/libdrm/BUILD= =2Egn") > + '("libevent.gn" . "base/third_party/libev= ent/BUILD.gn") > + '("libjpeg.gn" . > + "build/secondary/third_party/libjpeg_tu= rbo/BUILD.gn") > + '("libpng.gn" . "third_party/libpng/BUILD= =2Egn") > + '("libvpx.gn" . "third_party/libvpx/BUILD= =2Egn") > + '("libwebp.gn" . "third_party/libwebp/BUI= LD.gn") > + '("libxml.gn" . "third_party/libxml/BUILD= =2Egn") ;TODO > + '("libxslt.gn" . "third_party/libxslt/BUI= LD.gn") > + '("openh264.gn" . "third_party/openh264/B= UILD.gn") > + '("opus.gn" . "third_party/opus/BUILD.gn") > + '("re2.gn" . "third_party/re2/BUILD.gn") > + '("snappy.gn" . "third_party/snappy/BUILD= =2Egn") > + '("yasm.gn" . "third_party/yasm/yasm_asse= mble.gni") > + '("zlib.gn" . "third_party/zlib/BUILD.gn"= ))) > + #t))))) > + (build-system gnu-build-system) > + (arguments > + `(#:tests? #f > + ;; FIXME: There is a "gn" option specifically for setting -rpath,= but > + ;; it's not recognized when passed. > + #:validate-runpath? #f > + #:modules ((srfi srfi-26) > + (ice-9 ftw) > + (ice-9 regex) > + (guix build gnu-build-system) > + (guix build utils)) > + #:phases > + (modify-phases %standard-phases > + (add-after 'unpack 'patch-stuff > + (lambda* (#:key inputs #:allow-other-keys) > + (substitute* "printing/cups_config_helper.py" > + (("cups_config =3D.*") > + (string-append "cups_config =3D '" (assoc-ref inputs "cu= ps") > + "/bin/cups-config'\n"))) > + > + (substitute* > + '("base/process/launch_posix.cc" > + "base/third_party/dynamic_annotations/dynamic_annotat= ions.c" > + "sandbox/linux/seccomp-bpf/sandbox_bpf.cc" > + "sandbox/linux/services/credentials.cc" > + "sandbox/linux/services/namespace_utils.cc" > + "sandbox/linux/services/syscall_wrappers.cc" > + "sandbox/linux/syscall_broker/broker_host.cc") > + (("include \"base/third_party/valgrind/") "include \"valg= rind/")) > + > + (for-each (lambda (file) > + (substitute* file > + ;; Fix opus include path. > + ;; Do not substitute opus_private.h. > + (("#include \"opus\\.h\"") > + "#include \"opus/opus.h\"") > + (("#include \"opus_custom\\.h\"") > + "#include \"opus/opus_custom.h\"") > + (("#include \"opus_defines\\.h\"") > + "#include \"opus/opus_defines.h\"") > + (("#include \"opus_multistream\\.h\"") > + "#include \"opus/opus_multistream.h\"") > + (("#include \"opus_types\\.h\"") > + "#include \"opus/opus_types.h\""))) > + (append (find-files "third_party/opus/src/celt") > + (find-files "third_party/opus/src/src") > + (find-files (string-append "third_party/w= ebrtc/modules" > + "/audio_coding= /codecs/opus")))) > + > + (substitute* "chrome/common/chrome_paths.cc" > + (("/usr/share/chromium/extensions") > + ;; TODO: Add ~/.guix-profile. > + "/run/current-system/profile/share/chromium/extensions")) I don't know if I asked you about this in the past, but = can you explain why you picked the run dir? I have to re-read the Gentoo eclass = and Nix integration for this. > + > + (substitute* > + "third_party/breakpad/breakpad/src/common/linux/libcurl= _wrapper.h" > + (("include \"third_party/curl") "include \"curl")) > + (substitute* "media/base/decode_capabilities.cc" > + (("third_party/libvpx/source/libvpx/") "")) > + > + ;; We don't cross compile most packages, so get rid of the > + ;; unnecessary ARCH-linux-gnu* prefix. > + (substitute* "build/toolchain/linux/BUILD.gn" > + (("aarch64-linux-gnu-") "") > + (("arm-linux-gnueabihf-") "")) > + #t)) > + (replace 'configure > + (lambda* (#:key inputs outputs #:allow-other-keys) > + (let ((gn-flags > + (list > + ;; See tools/gn/docs/cookbook.md and > + ;; https://www.chromium.org/developers/gn-build-con= figuration > + ;; for usage. Run "./gn args . --list" in the Rele= ase > + ;; directory for an exhaustive list of supported fl= ags. > + "is_debug=3Dfalse" > + "is_official_build=3Dfalse" > + "is_clang=3Dfalse" > + "use_gold=3Dfalse" > + "use_lld=3Dfalse" > + "linux_use_bundled_binutils=3Dfalse" > + "use_custom_libcxx=3Dfalse" > + "use_sysroot=3Dfalse" > + "goma_dir=3D\"\"" > + "enable_precompiled_headers=3Dfalse" > + "enable_nacl=3Dfalse" > + "enable_nacl_nonsfi=3Dfalse" > + "use_allocator=3D\"none\"" ;don't use tcmalloc > + "override_build_date=3D\"01 01 2000 05:00:00\"" > + "use_unofficial_version_number=3Dfalse" > + ;; Optimize for building everything at once, as opp= osed > + ;; to incrementally for development. See "docs/jum= bo.md". > + ;; XXX: On some systems this may trigger a compiler= error. > + ;;"use_jumbo_build=3Dtrue" > + ;; Disable debugging features to save space. > + "remove_webcore_debug_symbols=3Dtrue" > + "enable_iterator_debugging=3Dfalse" > + ;; Some of the unbundled libraries throws deprecati= on > + ;; warnings, etc. Ignore it. > + "treat_warnings_as_errors=3Dfalse" > + ;; Don't add any API keys. End users can set them = in the > + ;; environment if desired. See > + ;; . > + "use_official_google_api_keys=3Dfalse" > + ;; Disable "field trials". > + "fieldtrial_testing_like_official_build=3Dtrue" > + > + "use_system_freetype=3Dtrue" > + "use_system_harfbuzz=3Dtrue" > + "use_system_libjpeg=3Dtrue" > + "use_system_lcms2=3Dtrue" > + "use_system_zlib=3Dtrue" > + ;; This is currently not supported on Linux: > + ;; https://bugs.chromium.org/p/chromium/issues/deta= il?id=3D22208 > + ;;"use_system_sqlite=3Dtrue" > + > + "use_gconf=3Dfalse" ;deprecated by gsettings > + "use_gnome_keyring=3Dfalse" ;deprecated by libsecret > + "use_gtk3=3Dtrue" > + "use_openh264=3Dtrue" > + "use_xkbcommon=3Dtrue" > + "link_pulseaudio=3Dtrue" > + > + ;; Don't arbitrarily restrict formats supported by = system ffmpeg. > + "proprietary_codecs=3Dtrue" > + "ffmpeg_branding=3D\"Chrome\"" > + > + ;; WebRTC stuff. > + "rtc_use_h264=3Dtrue" > + ;; Don't use bundled sources. > + "rtc_build_json=3Dfalse" > + "rtc_build_libevent=3Dfalse" > + "rtc_build_libvpx=3Dfalse" > + "rtc_build_opus=3Dfalse" > + "rtc_build_ssl=3Dfalse" > + ;; TODO: Package these. > + "rtc_build_libsrtp=3Dtrue" ;2.0 > + "rtc_build_libyuv=3Dtrue" > + "rtc_build_openmax_dl=3Dtrue" > + "rtc_build_usrsctp=3Dtrue" > + (string-append "rtc_jsoncpp_root=3D\"" > + (assoc-ref inputs "jsoncpp") > + "/include/jsoncpp/json\"") > + (string-append "rtc_ssl_root=3D\"" > + (assoc-ref inputs "openssl") > + "/include/openssl\"")))) > + > + ;; XXX: How portable is this. Can you extend this comment? > + (mkdir-p "third_party/node/linux/node-linux-x64") > + (symlink (string-append (assoc-ref inputs "node") "/bin") > + "third_party/node/linux/node-linux-x64/bin") > + > + (setenv "CC" "gcc") > + (setenv "CXX" "g++") > + ;; TODO: pre-compile instead. Avoids a race condition. > + (setenv "PYTHONDONTWRITEBYTECODE" "1") > + (and > + ;; Build the "gn" tool. > + (invoke "python" > + "tools/gn/bootstrap/bootstrap.py" "-s" "-v") > + ;; Generate ninja build files. > + (invoke "./out/Release/gn" "gen" "out/Release" > + (string-append "--args=3D" > + (string-join gn-flags " "))))))) > + (replace 'build > + (lambda* (#:key outputs #:allow-other-keys) > + (invoke "ninja" "-C" "out/Release" > + "-j" (number->string (parallel-job-count)) > + "chrome"))) > + (replace 'install > + (lambda* (#:key inputs outputs #:allow-other-keys) > + (let* ((out (assoc-ref outputs "out")) > + (bin (string-append out "/bin")) > + (exe (string-append bin "/chromium")) > + (lib (string-append out "/lib")) > + (man (string-append out "/share/man/man1"= )) > + (applications (string-append out "/share/applicati= ons")) > + (install-regexp (make-regexp "\\.(bin|pak)$")) > + (locales (string-append lib "/locales")) > + (resources (string-append lib "/resources")) > + (gtk+ (assoc-ref inputs "gtk+")) > + (mesa (assoc-ref inputs "mesa")) > + (nss (assoc-ref inputs "nss")) > + (udev (assoc-ref inputs "udev")) > + (sh (which "sh"))) > + > + (substitute* '("chrome/app/resources/manpage.1.in" > + "chrome/installer/linux/common/desktop.tem= plate") > + (("@@MENUNAME@@") "Chromium") > + (("@@PACKAGE@@") "chromium") > + (("/usr/bin/@@USR_BIN_SYMLINK_NAME@@") exe)) > + (mkdir-p man) > + (copy-file "chrome/app/resources/manpage.1.in" > + (string-append man "/chromium.1")) > + (mkdir-p applications) > + (copy-file "chrome/installer/linux/common/desktop.templat= e" > + (string-append applications "/chromium.desktop= ")) > + > + (with-directory-excursion "out/Release" > + (for-each (lambda (file) > + (install-file file lib)) > + (scandir "." (cut regexp-exec install-regexp = <>))) > + (copy-file "chrome" (string-append lib "/chromium")) > + > + ;; TODO: Install icons from "../../chrome/app/themes" i= nto > + ;; "out/share/icons/hicolor/$size". > + (install-file > + "product_logo_48.png" > + (string-append out "/share/icons/48x48/chromium.png")) > + > + (copy-recursively "locales" locales) > + (copy-recursively "resources" resources) > + > + (mkdir-p bin) > + ;; Add a thin wrapper to prevent the user from inadvert= ently > + ;; installing non-free software through the Web Store. > + ;; TODO: Discover extensions from the profile and pass > + ;; something like "--disable-extensions-except=3D...". To be able to work on this, can you (at least in this b= ug ticket, explain the TODO part a bit more? > + (call-with-output-file exe > + (lambda (port) > + (format port > + "#!~a~@ > + if [ -z \"$CHROMIUM_ENABLE_WEB_STORE\" ]~@ > + then~@ > + CHROMIUM_FLAGS=3D\" \\~@ > + --disable-background-networking \\~@ > + --disable-extensions \\~@ > + \"~@ > + fi~@ > + exec ~a $CHROMIUM_FLAGS \"$@\"~%" > + sh (string-append lib "/chromium")))) > + (chmod exe #o755) > + > + (wrap-program exe > + ;; TODO: Get these in RUNPATH. > + `("LD_LIBRARY_PATH" ":" prefix > + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib= :" > + mesa "/lib:" udev "/lib"))) > + ;; Avoid file manager crash. See . > + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/= share")))) > + #t))))))) > + (native-inputs > + `(("bison" ,bison) > + ("git" ,git) ;last_commit_position.py > + ("gperf" ,gperf) > + ("ninja" ,ninja) > + ("node" ,node) > + ("pkg-config" ,pkg-config) > + ("which" ,which) > + ("yasm" ,yasm) > + > + ("python-beautifulsoup4" ,python2-beautifulsoup4) > + ("python-html5lib" ,python2-html5lib) > + ("python" ,python-2))) > + (inputs > + `(("alsa-lib" ,alsa-lib) > + ("atk" ,atk) > + ("cups" ,cups) > + ("curl" ,curl) > + ("dbus" ,dbus) > + ("dbus-glib" ,dbus-glib) > + ("expat" ,expat) > + ("flac" ,flac) > + ("ffmpeg" ,ffmpeg) > + ("fontconfig" ,fontconfig) > + ("freetype" ,freetype) > + ("gdk-pixbuf" ,gdk-pixbuf) > + ("glib" ,glib) > + ("gtk+-2" ,gtk+-2) > + ("gtk+" ,gtk+) > + ("harfbuzz" ,harfbuzz) > + ("icu4c" ,icu4c) > + ("jsoncpp" ,jsoncpp) > + ("lcms" ,lcms) > + ("libevent" ,libevent) > + ("libffi" ,libffi) > + ("libjpeg-turbo" ,libjpeg-turbo) > + ("libpng" ,libpng) > + ("libusb" ,libusb) > + ("libvpx" ,libvpx+experimental) > + ("libwebp" ,libwebp) > + ("libx11" ,libx11) > + ("libxcb" ,libxcb) > + ("libxcomposite" ,libxcomposite) > + ("libxcursor" ,libxcursor) > + ("libxdamage" ,libxdamage) > + ("libxext" ,libxext) > + ("libxfixes" ,libxfixes) > + ("libxi" ,libxi) > + ("libxkbcommon" ,libxkbcommon) > + ("libxml2" ,libxml2) > + ("libxrandr" ,libxrandr) > + ("libxrender" ,libxrender) > + ("libxscrnsaver" ,libxscrnsaver) > + ("libxslt" ,libxslt) > + ("libxtst" ,libxtst) > + ("mesa" ,mesa) > + ("minizip" ,minizip) > + ("mit-krb5" ,mit-krb5) > + ("nss" ,nss) > + ("openh264" ,openh264) > + ("openssl" ,openssl) > + ("opus" ,opus+custom) > + ("pango" ,pango) > + ("pciutils" ,pciutils) > + ("protobuf" ,protobuf) > + ("pulseaudio" ,pulseaudio) > + ("re2" ,re2) > + ("snappy" ,snappy) > + ("speech-dispatcher" ,speech-dispatcher) > + ("sqlite" ,sqlite) > + ("udev" ,eudev) > + ("valgrind" ,valgrind))) > + (home-page "https://www.chromium.org/") > + (description > + "Chromium is a web browser designed for speed and security. This > +version incorporates patches from > +@url{https://github.com/gcarq/inox-patchset,Inox} and > +@url{https://www.debian.org/,Debian} in order to protect the users priva= cy.") > + ;; Chromium is developed as BSD-3, but bundles a large number of thi= rd-party > + ;; components with other licenses. For full information, see chrome= ://credits. > + (license (list license:bsd-3 > + license:bsd-2 > + license:expat > + license:asl2.0 > + license:mpl2.0 > + license:public-domain > + license:lgpl2.1+)))) > diff --git a/gnu/packages/patches/chromium-gcc5.patch b/gnu/packages/patc= hes/chromium-gcc5.patch > new file mode 100644 > index 000000000..56b2cd6ef > --- /dev/null > +++ b/gnu/packages/patches/chromium-gcc5.patch > @@ -0,0 +1,39 @@ > +Work around a GCC5 bug where it fails to choose the correct base::span > +constructor. > + > +Adapted from this commit: > +https://gitweb.gentoo.org/repo/gentoo.git/commit/www-client/chromium?id= =3D7843d29ab07411a9c70962fb90b4cd1546910242 > + > +--- a/gpu/ipc/common/mailbox_struct_traits.h > ++++ b/gpu/ipc/common/mailbox_struct_traits.h > +@@ -15,7 +15,7 @@ namespace mojo { > + template <> > + struct StructTraits { > + static base::span name(const gpu::Mailbox& mailbox) { > +- return mailbox.name; > ++ return base::make_span(mailbox.name); > + } > + static bool Read(gpu::mojom::MailboxDataView data, gpu::Mailbox* out); > + }; > +--- a/services/viz/public/cpp/compositing/filter_operation_struct_traits= =2Eh > ++++ b/services/viz/public/cpp/compositing/filter_operation_struct_traits= =2Eh > +@@ -134,7 +134,7 @@ struct StructTraits { > + static base::span matrix(const cc::FilterOperation& oper= ation) { > + if (operation.type() !=3D cc::FilterOperation::COLOR_MATRIX) > + return base::span(); > +- return operation.matrix(); > ++ return base::make_span(operation.matrix()); > + } > + > + static base::span shape( > +--- a/services/viz/public/cpp/compositing/quads_struct_traits.h > ++++ b/services/viz/public/cpp/compositing/quads_struct_traits.h > +@@ -308,7 +308,7 @@ > + static base::span vertex_opacity(const viz::DrawQuad& in= put) { > + const viz::TextureDrawQuad* quad =3D > + viz::TextureDrawQuad::MaterialCast(&input); > +- return quad->vertex_opacity; > ++ return base::make_span(quad->vertex_opacity); > + } > +=20 > + static bool y_flipped(const viz::DrawQuad& input) { > diff --git a/gnu/packages/patches/chromium-remove-default-history.patch b= /gnu/packages/patches/chromium-remove-default-history.patch > new file mode 100644 > index 000000000..38be10820 > --- /dev/null > +++ b/gnu/packages/patches/chromium-remove-default-history.patch > @@ -0,0 +1,13 @@ > +Don't pre-populate the New Tab Page for new profiles. > + > +--- a/chrome/browser/history/top_sites_factory.cc > ++++ b/chrome/browser/history/top_sites_factory.cc > +@@ -74,7 +74,7 @@ > +=20 > + void InitializePrepopulatedPageList( > + history::PrepopulatedPageList* prepopulated_pages) { > +-#if !defined(OS_ANDROID) > ++#if false > + DCHECK(prepopulated_pages); > + prepopulated_pages->reserve(arraysize(kRawPrepopulatedPages)); > + for (size_t i =3D 0; i < arraysize(kRawPrepopulatedPages); ++i) { > --=20 > 2.16.2 >=20 Otherwise, LGTM. --=20 A88C8ADD129828D7EAC02E52E22F9BBFEE348588 https://n0.is --wj6qt76xr6nidfo4 Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlqV2OcACgkQ4i+bv+40 hYifLRAApm0yB/3PA0/l/lquHl/7zHHSIb6s6rUbRFD963FHyohC1ik49dTrhAY5 qo50m9vWFEAntwmq38oHCuWk7+m4v4mBUr5CellO6v8mhjMFHDl8+lODziy4IM9Y 07wGzHzdgMdDBq3ec0dUWTaJpP6QQ1F/583iSOlrOA8fcler+QMqUkVUPEMB4D5F ojZ9NRoUD7XCwGYj2GA3bM6mYQw0Bq2sQGXfxaz/dvGD12vC1SRhITzGAiMQevMU JQfLcwYi22cfJSo+1UQLjeXTxrKP41ZpmVxH+bkqnClbETxVonX0t8FY15rW3A7Z Zee1Try+nJ77PI4OEKlahGciZMRAbdBr9n7hdRO7ijhQz/E26hDH/iLOhMMCKGHZ uAghL9yhfZehQzJl3GoOKMSZMCekXOnHqjWYQVtyFJ3AoI9OPvV28iy+tUrFKJxo A5Vf+UY4LcJQoYw9maZfDlSd8UK3unPQAb/3KvdPFmvVF3NsT5/a4X+7iMEY8udl 6S3q9bqjKpjSofg/uSZrEN4oZaCW34PcO9h8wP0Djm9kweiHPuY/3ADrQnFNI5Xu Jml3/P7ZXR+yPibtww0Mh7t54VXzA9LysIdBtK/W43b8aX/nidpy1xAm868C/HaW ut+RZ5GmNy+Au0PGmHOFQuSTXppgq3viWIp/wOkNhV80mliCiYs= =+xOh -----END PGP SIGNATURE----- --wj6qt76xr6nidfo4-- From debbugs-submit-bounces@debbugs.gnu.org Wed Feb 28 03:17:11 2018 Received: (at 28004) by debbugs.gnu.org; 28 Feb 2018 08:17:11 +0000 Received: from localhost ([127.0.0.1]:36397 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqwvC-0005EU-KU for submit@debbugs.gnu.org; Wed, 28 Feb 2018 03:17:11 -0500 Received: from aibo.runbox.com ([91.220.196.211]:50248) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1eqwv7-0005Dw-VX for 28004@debbugs.gnu.org; Wed, 28 Feb 2018 03:17:05 -0500 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1eqwv3-0000wr-Ph; Wed, 28 Feb 2018 09:16:57 +0100 Received: from dslb-094-220-189-159.094.220.pools.vodafone-ip.de ([94.220.189.159] helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1eqwv3-0001nt-G3; Wed, 28 Feb 2018 09:16:57 +0100 Date: Wed, 28 Feb 2018 08:17:07 +0000 From: ng0 To: Mike Gerwitz Subject: Re: [bug#28004] Chromium Message-ID: <20180228081707.nnjoolzbgwwtcgq5@abyayala> References: <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <87k1uznqcu.fsf@gnu.org> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="mldnkusqxpt62dfu" Content-Disposition: inline In-Reply-To: <87k1uznqcu.fsf@gnu.org> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Marius Bakke X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --mldnkusqxpt62dfu Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Mike Gerwitz transcribed 1.6K bytes: > On Mon, Feb 26, 2018 at 19:18:39 +0100, Marius Bakke wrote: > > Now, when launching the browser for the first time, it *still* connects > > to Google services. After a while it also does a lookup for AdWords... >=20 > Do you know what code initiates this? Would it be easy to remove, and > would that harm other functionality? >=20 > Saying that it only runs the first time implies to me that there's a > flag, and that perhaps the flag can either be permanently set or the > conditional triggering this behavior removed. >=20 > --=20 > Mike Gerwitz > Free Software Hacker+Activist | GNU Maintainer & Volunteer > GPG: D6E9 B930 028A 6C38 F43B 2388 FEF6 3574 5E6F 6D05 > https://mikegerwitz.com Could this be a connectivity check? switch "--connectivity-check-url" exists: https://peter.sh/experiments/chromium-command-line-switches/ and there might be a flag here: chrome://flags/ We can also creatre our own settings file as suggested in this thread: https://www.jamf.com/jamf-nation/discussions/10331/chrome-master-preference= s-file-and-suppressing-first-run-browser Someone else suggested this file: http://www.google.com/codesearch/p?hl=3Dru#HLxzG3ShG8A/trunk/win/lib/lib_va= lues.cc&q=3D/tools/pso&sa=3DN&cd=3D1&ct=3Drc 404 now. Adwords query might really be rlz, but I'm just guessing for now. Post from= 2010: https://blog.chromium.org/2010/06/in-open-for-rlz.html > When we released a new stable version of Google Chrome last March, we tri= ed to improve the transparency and privacy options of Google Chrome. One ar= ea where ve seen a lot of interest and questions is the RLZ library that is= built into Google Chrome. RLZ gives us the ability to accurately measure t= he success of marketing promotions and distribution partnerships in order t= o meet our contractual and financial obligations. It assigns non-unique, no= n-personally identifiable promotion tracking labels to client products; the= se labels sometimes appear in Google search queries in Google Chrome.we This is the source code view: https://src.chromium.org/viewvc/chrome/trunk/src/chrome/browser/rlz/rlz.cc?= view=3Dmarkup https://src.chromium.org/viewvc/chrome/trunk/src/chrome/browser/rlz/rlz.h?v= iew=3Dmarkup Different topic. This will help us to integrate packaged extensions once we= get there: https://data.gpo.zugaina.org/gentoo/www-client/chromium/files/chromium-laun= cher-r3.sh and probably some more files. --=20 A88C8ADD129828D7EAC02E52E22F9BBFEE348588 https://n0.is --mldnkusqxpt62dfu Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlqWZYMACgkQ4i+bv+40 hYibBw/+NENBr9JWkdEKBrYDtr/QsggO0NHGsFJdbrVpG7lk6qjfzt8XZUIT54ZU 7j6Zitm+97BBovlK2BVaJkGXpOk5chPjBECpf78FZ5P+vJygbF9e5yMihBvEmW+S ffNEwR1cT1W1mV3+HHL9u87hTnNzkvMhjsAzwYb6EwozUkfa6Iuay3BNELsEc/8I btjC2CLGbeXeU74Vj9ZChkBjle6WVw+f7YZexUu+Q3fAi5q6BLMpsXs8tzA+qiC6 f3jG2ReegejOseMR7h5lEuA3jDi9rfncJD7cqgze3JLCaKQe41TLYfAoLDaQWqsD s5/KtarS1lN92zjRQdH7qkBwTjx2DdEakwzQunYZGDgblO/AMtt/o5DBKmhTFpZk oHjgMLHDjrVfzIaz9oF9GGHxZTolziUI+nVbVVfZMOlhTjgAR1CPBVzcw2QjUsMg O7RxWc1B4jRNLdzZz5SvgKOvYkOoxUjlTydt0xvrZ5lhRevt8/a2FsHSAT6ah6PW dn6PraygOhzyCtdxhh9OUCcHMyLTIhRO/qMMLOfIo3aXzr6J7noZtqAmtWT2i796 6ioVLmwVaCP+a4cXn9WJcCv0PZC4tQUJiX8JY9wlRvS9EQCNVi0ZlUZMkRiCI88c pwI3y9THfYyyl4XPlhs2fsBHsczcfvoDx6ve7Mi9MXb+UgNLIn4= =aUgs -----END PGP SIGNATURE----- --mldnkusqxpt62dfu-- From debbugs-submit-bounces@debbugs.gnu.org Wed Feb 28 12:14:12 2018 Received: (at 28004) by debbugs.gnu.org; 28 Feb 2018 17:14:12 +0000 Received: from localhost ([127.0.0.1]:37741 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1er5Iy-0003PD-Aw for submit@debbugs.gnu.org; Wed, 28 Feb 2018 12:14:12 -0500 Received: from out5-smtp.messagingengine.com ([66.111.4.29]:50719) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1er5Iw-0003P5-Sg for 28004@debbugs.gnu.org; Wed, 28 Feb 2018 12:14:11 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 6126420930; Wed, 28 Feb 2018 12:14:10 -0500 (EST) Received: from frontend1 ([10.202.2.160]) by compute5.internal (MEProxy); Wed, 28 Feb 2018 12:14:10 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; bh=wCEPOD+VpdvzI3GObZcWUilan9mnYqUNoN4uV8q7MLQ=; b=HuAmhHKG E/FSeCzIu66PNY3RI5ujE77NTCoADcOh8GfwN7K3DA3USUJ1AB2c4yIwjrf4LKAw E/S2CBBZhNg8qUq6BRS33pk6HXUsb0qH/JrXMNl8KPMEEcuAqj47UjijjvphRx+S +VnPDZWKYixqc3lqwjaoXzj85C+t0SVK9+iA30nA/jCUHa5c4v/+6M+ywvggSduZ kH6W3kB6V9yWyuAlzcjNNjeqYpDxsjKSS7DrIdaXwmvnUfkNTDkOr9QWhhM0gwOJ 1z3RvwWU2obLwAIkQSZpUArX+kWIw2CJoew1AoXp1qyFfnasPP9Pn8sTPjDo+hhH pMEfXhY0izt9WQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm2; bh=wCEPOD+VpdvzI3GObZcWUilan9mnY qUNoN4uV8q7MLQ=; b=X8rhqRZBYNU0doga8HbzG4YcJ+w+swnC/UkKGewkKVBv3 2UI4lmJJ9Pv7pVBMwb7nXR3IGKLgG1n4q2PL/xCMBihXeBP6WpHDRIvrPJksJjy3 F7hZnk9rrJM1yy1niTZihv7loNNi710Qxj58oUTNSJOVYgp4o8+wuUEc9Eac6yQe nY9yCQ9UI7innOvrCSpFJfttgsZWuc2TTt5uX2AASckeWkriZ2wXT/Ul8oBWOdjv SujBexyAuMtXrJnhqO/XNFI2RmKa+oY/q3Gs80wwG6Purffeg255RQcQbdfnwSRj Xh1AZ56Pt3kojMhg5aSwcSTKciI0DOZMEe9h9NTCw== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id D7FFF7E0ED; Wed, 28 Feb 2018 12:14:09 -0500 (EST) From: Marius Bakke To: ng0 Subject: Re: [bug#28004] Chromium In-Reply-To: <20180227221711.omdpbgemrjwinohb@abyayala> References: <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180227221711.omdpbgemrjwinohb@abyayala> User-Agent: Notmuch/0.26 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Wed, 28 Feb 2018 18:14:08 +0100 Message-ID: <87371lujdr.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable ng0 writes: > Marius Bakke transcribed 43K bytes: >> ng0 writes: >>=20 >> > Marius Bakke transcribed 2.1K bytes: >> >> Mike Gerwitz writes: >> >>=20 >> >> > On Tue, Jan 16, 2018 at 20:01:34 +0100, Marius Bakke wrote: >> >> >> If there are no objections, expect to see this in 'master' in 1-2 = weeks. >> >> > >> >> > I want to express gratitude for your hard work on this---given that >> >> > IceCat does not contain many of the FF devtool updates, Chromium is= very >> >> > desirable for web development. It's also needed for certain Node.js >> >> > tools, like node-inspector. >> >> > >> >> > So, thank you! >> >>=20 >> >> Thank *you* for the kind words! :-) >> >>=20 >> >> Here is the latest iteration of this patch. New in this version: >> >>=20 >> >> * Chromium 64 (duh). >> >> * The 'delete-bundled-software' phase has been moved to a snippet, >> >> shaving ~100MiB (~22%) off the compressed tarball size (and >> >> drastically reduces (de)compression time). >> >> * The New Tab page does not show any thumbnails for new profiles. >> > >> > I think you forgot to attach the patches :) >>=20 >> Derp. I realized that and just used `git send-email`[0], but have >> attached it here for convenience since the debbugs web UI doesn't allow >> easy download of a raw message. >>=20 >> [0] https://debbugs.gnu.org/cgi/bugreport.cgi?msg=3D131;bug=3D28004#131 >> > > Comments inlined, some words ahead. > > I think it's good that we will be able to handle extensions via Guix. > But: We should point it out that you won't be able to install extensions > manually, via the store or as a file. People who betatested this got > confused. I haven't tested installing from a file. Which error are you getting? You can use extensions from the store by setting the variable "CHROMIUM_ENABLE_WEB_STORE", as in Debian. But I don't see a need to document it since it's unsupported territory from a Guix viewpoint. >> + (substitute* "chrome/common/chrome_paths.cc" >> + (("/usr/share/chromium/extensions") >> + ;; TODO: Add ~/.guix-profile. >> + "/run/current-system/profile/share/chromium/extensions"= )) > > I don't know if I asked you about this in the past, bu= t can you explain why you > picked the run dir? I have to re-read the Gentoo eclas= s and Nix integration for this. The plan is to package extensions with Guix and place them in "out/share/chromium/extensions". Then you would be able to install extensions through the system profile, until a better solution is in place (like a search path). >> + (mkdir-p bin) >> + ;; Add a thin wrapper to prevent the user from inadver= tently >> + ;; installing non-free software through the Web Store. >> + ;; TODO: Discover extensions from the profile and pass >> + ;; something like "--disable-extensions-except=3D...". > > To be able to work on this, can you (at least in this= bug ticket, > explain the TODO part a bit more? This was inspired by Debians wrapper script, which discovers extensions installed by Apt and composes this command line. It allows disabling the web store while still using extensions. I'll see if I can improve the comment. Thanks for the feedback! --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlqW42AACgkQoqBt8qM6 VPpRnggAmE+MC7xBreY8GO/9yNrpRVG0PmbEFR8PD35yuxffA2p+yI4y3oCPB5Zb 1Qd96cW5GgViyYnHHlIy1Ljct98hqo7mFP8+Sedoyzp546Ol2dPYAXVf0fw+YX65 AZu9Mf2OYanye+lQAmgHookcjHyleym1mCxFIEYdiJqVqeiL1mCKS2C59AwPt97s k+jbiRJLZUeLbk9PN9fP8Wbi86WuO0poTpi6veamvFt3Irbn8jrmC2j+D0xS8J4C JzvkfDgCpT0lcYifO3vcUP23CqmVs74iMMEtz3k0V9ZU/mljeoCoZOQizZSvaHC9 nSwOHjh82/b0cjSLnrr0b7dDCWbZRQ== =/dbz -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Wed Feb 28 12:28:52 2018 Received: (at 28004) by debbugs.gnu.org; 28 Feb 2018 17:28:52 +0000 Received: from localhost ([127.0.0.1]:37751 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1er5X9-0003jY-5p for submit@debbugs.gnu.org; Wed, 28 Feb 2018 12:28:52 -0500 Received: from out5-smtp.messagingengine.com ([66.111.4.29]:57207) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1er5X7-0003jP-2H for 28004@debbugs.gnu.org; Wed, 28 Feb 2018 12:28:49 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 9BAD220BC3; Wed, 28 Feb 2018 12:28:48 -0500 (EST) Received: from frontend1 ([10.202.2.160]) by compute5.internal (MEProxy); Wed, 28 Feb 2018 12:28:48 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; bh=BoxzH5CDDRvENzcYmyUiBOfzQNSPX4keDnFeLHqQx3E=; b=unssKG+1 Li1bV3WmY5ut8YiHzUT0M7xWf7hHEoktNWjssUfaKNhdRHdzqXOy+VU9cIyeuXga eGOyxAKqaEqgMTDyxZRf/rQCsllMINJ+Mqn1TuDBPtZp3a8jMLnkESVzI1a3/hIG rUPHu2fOzD2eMeXngabiAKYMpvZU/kL3Ey0XVezumHuUaUL8GabjiLStuWpbRAqa LgRbjquqglYTz5wmmcz37hFmkzxjaHRd0ffOtpXhGJHQRwuOeZt3Jksv3oE3rgxb BWA+t4GnNesfqoDdWrtjT22gpsEBrE6dWb0Lbpw+QQba+Zx+wX3r7phuSlra0Yqj ESHAMMEB0kXl3A== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm2; bh=BoxzH5CDDRvENzcYmyUiBOfzQNSPX 4keDnFeLHqQx3E=; b=KNbqfkiTPPgmw+pxrfpH7NZoIBc7UkrX/4mCt2varAzVe VS6b9wJBS/KVjbdfIsOkzJwri2BMmfK5nyZD6pjTp0lI0netlcOOhqW/u5NPqxTb eImT5zNGtUn2380LMJTl9Rski+tcq2kOM/Dt2YLNn3bsSpaLNRMBHaE+uYXdlXVN LUdOD+YwbPr7ojEJmHWcmfcgdbqxgpYbd3obrgZ+vRu+8LsGWeAwZVYZ58Oju5YM JSVXIiX/MmYP9e5pkEChcs5XuXyuvJIghd1ORTEBY7FozLwLxlUrYH5//0IZiWt3 d3pKrksnI4RKZPgar0t8LyOWaoPDsW2JwRTKo/00A== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id 10AC47E26F; Wed, 28 Feb 2018 12:28:47 -0500 (EST) From: Marius Bakke To: Mike Gerwitz Subject: Re: [bug#28004] Chromium In-Reply-To: <87k1uznqcu.fsf@gnu.org> References: <87y3qvb15k.fsf@fastmail.com> <20171010131949.y43plpzxbppvrigr@abyayala> <87lgkha2cx.fsf@gnu.org> <20171012195628.GA31843@jasmine.lan> <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <87k1uznqcu.fsf@gnu.org> User-Agent: Notmuch/0.26 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Wed, 28 Feb 2018 18:28:46 +0100 Message-ID: <87zi3tt44x.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --=-=-= Content-Type: text/plain Mike Gerwitz writes: > On Mon, Feb 26, 2018 at 19:18:39 +0100, Marius Bakke wrote: >> Now, when launching the browser for the first time, it *still* connects >> to Google services. After a while it also does a lookup for AdWords... > > Do you know what code initiates this? Would it be easy to remove, and > would that harm other functionality? Unfortunately, I don't know what triggers it. Feel free to try picking some of the other Inox patches and see if it makes a difference: https://github.com/gcarq/inox-patchset Inox goes great lengths to "ungooglify" the browser. I've decided against picking *all* their patches, for two reasons: 1) I'd like users to be able to use Chromium with their Google account if they wish to (although I haven't actually tested this), and more importantly: 2) More patches means more porting work every new release. Usually major versions bumps come with a plethora of security fixes, so I wish to minimize maintenance overhead. Just figuring out the changed dependencies, build flags, and GCC bugs with every release is a lot of work already. > Saying that it only runs the first time implies to me that there's a > flag, and that perhaps the flag can either be permanently set or the > conditional triggering this behavior removed. Indeed. Any help figuring out the offender is very welcome! No external connectivity in the default configuration is a goal we should strive for. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlqW5s4ACgkQoqBt8qM6 VPottwf5AXGEfvNf79MnW8g1W7l9o436utStYCIs+CJD8ZyDG5PIZQSA+BwxZ0nA 9cfS/JUwdbDjt/pk6ByU9qauCvEwC/zurhWGaUr/yJyMBHikjyn0/Cmu4hfuRGHG hUPg1XnucEgDSsaCWRH2YStgDLfR2HHaVNKNHqgIVqcgvDJiY09lH5kNQIVDPeyH TwHowGxIYm18a0gvBnxKqWQm2izQV4xGMpqv/Ub38AieSIsbv3yyHbWf0kCBfKTK bohEWn2pApWJ0a+VUinXKyh5PILaHNq0DQMGGpcZH5givh94+Y2imNeEIKtDOjqp 7DD2qTLohAxjSmMoqsg23ojCfnkbug== =gTUK -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Wed Feb 28 12:39:06 2018 Received: (at 28004) by debbugs.gnu.org; 28 Feb 2018 17:39:06 +0000 Received: from localhost ([127.0.0.1]:37770 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1er5h0-0003zR-Ic for submit@debbugs.gnu.org; Wed, 28 Feb 2018 12:39:05 -0500 Received: from out5-smtp.messagingengine.com ([66.111.4.29]:38777) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1er5gx-0003z1-Aw for 28004@debbugs.gnu.org; Wed, 28 Feb 2018 12:38:59 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id D010F20930; Wed, 28 Feb 2018 12:38:58 -0500 (EST) Received: from frontend1 ([10.202.2.160]) by compute5.internal (MEProxy); Wed, 28 Feb 2018 12:38:58 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; bh=4WbAplZq0d5PI7DFxm3KQaEQH3FD3+deUNC1VZz0IlA=; b=afspLKOk brYSFkQj6FnLERXgUU1Ycx1/EDij9Voc+QU+IGYcRnSh03UDcttirpD7IKmYKy7x xKIPgW0TJzLbib89Hij7lTUFj8RN5tup2a4oJV/psNRaGbQpCP7qAIc9mEkt+AlQ c0O661y4K4eJPkwRxtSdUthClImVfcxM61oTMZOjxQJQDMSdwJoOl2rW65kAcNnJ yPdHfYG7nWwWlTvL7bh5eSEVnf13nUknS7sSATK9Y4dLFULEhGl8eJtRgFU6BWd1 umOV6kgE1Vj+Z837omwmrpbP6FFzxjVnPNYikfCj6jyIpgNGRKyvzVKbl4xbbKmp 9H2uTOloPvz6iw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm2; bh=4WbAplZq0d5PI7DFxm3KQaEQH3FD3 +deUNC1VZz0IlA=; b=bmD3L9Gh6zeNbjBR7EXEWvuJH+TCXsUmaG6DPjaPM+0FP PoMtI3KH5+Cz1xXM0RiEWf6tS0AErneA5g32+JCCpNUP0AyNF+1X+j5cY0bDYLtU ZNq5eAaq7ni7j1ku5Gf6/HKY0z5JmNe1Lg+zBwuXeAeYtuOedyedY4n0OQY368vA LcdZ6PaxVOWIbquSlTkAxilg95aadRHpoIvxl3JTi1jSAUPtUF2S0V2oz0PXyoDp u4p6I83bGrYCL8daCIkelYJLU8SS6WrT5g0DgBv/00bRHk4GIzEHZ4jnM2uhkYwN d3qZLl87vIw636F3G9mw6Osc9+TG7Q1vdv7o6yA0Q== X-ME-Sender: Received: from localhost (cm-84.214.173.174.getinternet.no [84.214.173.174]) by mail.messagingengine.com (Postfix) with ESMTPA id 45BC47E4EC; Wed, 28 Feb 2018 12:38:58 -0500 (EST) From: Marius Bakke To: =?utf-8?Q?Bj=C3=B6rn_H=C3=B6fling?= Subject: Re: [bug#28004] Chromium In-Reply-To: <20180226234144.032af030@alma-ubu> References: <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> User-Agent: Notmuch/0.26 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Wed, 28 Feb 2018 18:38:56 +0100 Message-ID: <87woyxt3nz.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: 0.4 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.4 (/) --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Bj=C3=B6rn H=C3=B6fling writes: > Hi Marius, > > On Mon, 26 Feb 2018 21:06:57 +0100 > Marius Bakke wrote: > >> ng0 writes: >>=20 >> > Marius Bakke transcribed 2.1K bytes:=20=20 >> >> Mike Gerwitz writes: >> >>=20=20=20 >> >> > On Tue, Jan 16, 2018 at 20:01:34 +0100, Marius Bakke wrote:=20=20 >> >> >> If there are no objections, expect to see this in 'master' in >> >> >> 1-2 weeks.=20=20 >> >> > >> >> > I want to express gratitude for your hard work on this---given >> >> > that IceCat does not contain many of the FF devtool updates, >> >> > Chromium is very desirable for web development. It's also >> >> > needed for certain Node.js tools, like node-inspector. >> >> > >> >> > So, thank you!=20=20 >> >>=20 >> >> Thank *you* for the kind words! :-) >> >>=20 >> >> Here is the latest iteration of this patch. New in this version: >> >>=20 >> >> * Chromium 64 (duh). >> >> * The 'delete-bundled-software' phase has been moved to a snippet, >> >> shaving ~100MiB (~22%) off the compressed tarball size (and >> >> drastically reduces (de)compression time). >> >> * The New Tab page does not show any thumbnails for new profiles.=20= =20 >> > >> > I think you forgot to attach the patches :)=20=20 >>=20 >> Derp. I realized that and just used `git send-email`[0], but have >> attached it here for convenience since the debbugs web UI doesn't >> allow easy download of a raw message. >>=20 >> [0] https://debbugs.gnu.org/cgi/bugreport.cgi?msg=3D131;bug=3D28004#131 >>=20 > > > This looks like a lot of work. Thank you! > > I quickly tried to apply and build the patch and have two first remarks: > > The file says: > > ;;; Copyright =C2=A9 2016, 2017, 2018 Marius Bakke > > I haven't followed history, have you worked on this since 2016? Yeah, I started this shortly after going full-GuixSD in October 2016. But I didn't submit it until now because I didn't think it met Guix's standards (and still think it's questionable due to privacy concerns). > One patch has a hash-mismatch: > > Starting download of /gnu/store/q8hlws48cjfcmz6i40jrnxn3kp750gy4-chromium= -icu.patch > From https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/plain/= debian/patches/system/icu.patch?id=3Ddebian/64.0.3282.119-2... > icu.patch 2KiB 1.8MiB/s 00:00 [####################]= 100.0% > output path `/gnu/store/q8hlws48cjfcmz6i40jrnxn3kp750gy4-chromium-icu.pat= ch' should have sha256 hash `0kf77d8lyma3w0xpgfv2k0c741zp6ii08gzllfja6d5s59= c15ylv', instead has `19r0bpv2hapzq5m0m7rlz1dwn3h2ijgkilb2hmhw56qvwpbw0b59' > @ build-failed /gnu/store/cqdllqn8ig5wnjn0yqvnh4vlzsvnpzv6-chromium-icu.p= atch.drv - 1 output path `/gnu/store/q8hlws48cjfcmz6i40jrnxn3kp750gy4-chrom= ium-icu.patch' should have sha256 hash `0kf77d8lyma3w0xpgfv2k0c741zp6ii08gz= llfja6d5s59c15ylv', instead has `19r0bpv2hapzq5m0m7rlz1dwn3h2ijgkilb2hmhw56= qvwpbw0b59' > cannot build derivation `/gnu/store/vacxbwsprcp52vp6q975450zi091dak2-chro= mium-64.0.3282.186.tar.xz.drv': 1 dependencies couldn't be built > @ build-started /gnu/store/7q53inn1v32b5fain0h0wcrliclf0ff1-libvpx+experi= mental-1.7.0.drv - x86_64-linux /var/log/guix/drvs/7q//53inn1v32b5fain0h0wc= rliclf0ff1-libvpx+experimental-1.7.0.drv.bz2 > cannot build derivation `/gnu/store/5qv7anaaqk4576pma9mhcsz1nhrx1n01-chro= mium-64.0.3282.186.drv': 1 dependencies couldn't be built > guix build: error: build failed: build of `/gnu/store/5qv7anaaqk4576pma9m= hcsz1nhrx1n01-chromium-64.0.3282.186.drv' failed > > I looked into the file and it looks reasonable, like a patch-file. It has= no download errors. > > It starts like this: > > description: backwards compatibility for older versions of icu > author: Michael Gilbert > > --- a/v8/src/runtime/runtime-intl.cc > +++ b/v8/src/runtime/runtime-intl.cc > @@ -627,7 +627,11 @@ RUNTIME_FUNCTION(Runtime_PluralRulesSele > > ... > > Can you check this file again? Whoops, indeed. I had an older patch in my store and apparently forgot to update the hash. The correct hash for %chromium-system-icu.patch is: 19r0bpv2hapzq5m0m7rlz1dwn3h2ijgkilb2hmhw56qvwpbw0b59 Thanks for letting me know! I'll send an updated patch later, with some other minor improvements. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlqW6TAACgkQoqBt8qM6 VPrVOQgAmxdpWrvUsJjBCD8ISMJ3fs5nDZt3/jDfiwj2glLjCjGvqjqytxhOYkXM CeeuO1Um8gb270ePmBAnY02dRL2Qx8oF6ORcw4xS7rh5MyJJzfbYk4pjx8MvvrI4 L4mV6piCMYj85BsYkud+9ni7P+HKoTaExve5DEImmz5ZiU5QkleJKoRspugIydQn ExEekgSvG7kOsNY1NyQw3CE2CYToFrKyLsaWWYvkGzh7hkie/9x9Z/kMfK6HSqoq 5twX9XKHn2g9I+V1IXTIRua16TVy8qsbNtxEqcNXpFu9emrEbC7l5OFyKAXV0+yV GEDEs14P/WnvwhFFADdNfTxI1JevNg== =UrxJ -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Wed Feb 28 13:10:10 2018 Received: (at 28004) by debbugs.gnu.org; 28 Feb 2018 18:10:10 +0000 Received: from localhost ([127.0.0.1]:37818 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1er6B8-0006ib-Gw for submit@debbugs.gnu.org; Wed, 28 Feb 2018 13:10:10 -0500 Received: from m4s11.vlinux.de ([83.151.27.109]:44160 helo=bjoernhoefling.de) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1er6B6-0006iQ-CR for 28004@debbugs.gnu.org; Wed, 28 Feb 2018 13:10:08 -0500 Received: from alma-ubu (unknown [46.183.103.8]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by bjoernhoefling.de (Postfix) with ESMTPSA id 0D55040A95; Wed, 28 Feb 2018 19:09:56 +0100 (CET) Date: Wed, 28 Feb 2018 19:09:25 +0100 From: =?UTF-8?B?QmrDtnJuIEjDtmZsaW5n?= To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180228190925.383c1e25@alma-ubu> In-Reply-To: <87woyxt3nz.fsf@fastmail.com> References: <87shensfq6.fsf@gnu.org> <87o9p45bb6.fsf@fastmail.com> <20180104191648.custe7w3l57fvbac@abyayala> <87wp0s2ewl.fsf@fastmail.com> <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> X-Mailer: Claws Mail 3.13.2 (GTK+ 2.24.30; x86_64-pc-linux-gnu) MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; boundary="Sig_/P.P8_uq_zGbgUSKa5vbrVf+"; protocol="application/pgp-signature" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.0 (/) --Sig_/P.P8_uq_zGbgUSKa5vbrVf+ Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable On Wed, 28 Feb 2018 18:38:56 +0100 Marius Bakke wrote: > Bj=C3=B6rn H=C3=B6fling writes: > > One patch has a hash-mismatch: > > > > Starting download > > of /gnu/store/q8hlws48cjfcmz6i40jrnxn3kp750gy4-chromium-icu.patch > > From > > https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/plain/deb= ian/patches/system/icu.patch?id=3Ddebian/64.0.3282.119-2... > > icu.patch 2KiB 1.8MiB/s 00:00 > > [####################] 100.0% output path > > `/gnu/store/q8hlws48cjfcmz6i40jrnxn3kp750gy4-chromium-icu.patch' > > should have sha256 hash > > `0kf77d8lyma3w0xpgfv2k0c741zp6ii08gzllfja6d5s59c15ylv', instead has > > `19r0bpv2hapzq5m0m7rlz1dwn3h2ijgkilb2hmhw56qvwpbw0b59' @ [..] >=20 > Whoops, indeed. I had an older patch in my store and apparently > forgot to update the hash. >=20 > The correct hash for %chromium-system-icu.patch is: >=20 > 19r0bpv2hapzq5m0m7rlz1dwn3h2ijgkilb2hmhw56qvwpbw0b59 >=20 > Thanks for letting me know! I'll send an updated patch later, with > some other minor improvements. With that confirmation, I could build the source derivation. Thanks. Bj=C3=B6rn --Sig_/P.P8_uq_zGbgUSKa5vbrVf+ Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- Version: GnuPG v2 iEYEARECAAYFAlqW8FYACgkQvyhstlk+X/2k1QCeJxC3BaMrYTTL6xTdWSBk6ZcG n8wAnjJTDY0qLaGgcFAYUabAJcXQtxmw =EDDB -----END PGP SIGNATURE----- --Sig_/P.P8_uq_zGbgUSKa5vbrVf+-- From debbugs-submit-bounces@debbugs.gnu.org Fri Mar 16 13:30:55 2018 Received: (at 28004) by debbugs.gnu.org; 16 Mar 2018 17:30:55 +0000 Received: from localhost ([127.0.0.1]:37251 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ewtBv-0003Xy-5V for submit@debbugs.gnu.org; Fri, 16 Mar 2018 13:30:55 -0400 Received: from aibo.runbox.com ([91.220.196.211]:46800) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ewtBt-0003Xq-Kc for 28004@debbugs.gnu.org; Fri, 16 Mar 2018 13:30:54 -0400 Received: from [10.9.9.211] (helo=mailfront11.runbox.com) by mailtransmit03.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1ewtBr-0001BO-3i; Fri, 16 Mar 2018 18:30:51 +0100 Received: from dslb-092-072-221-035.092.072.pools.vodafone-ip.de ([92.72.221.35] helo=localhost) by mailfront11.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1ewtBW-00058H-OJ; Fri, 16 Mar 2018 18:30:30 +0100 Date: Fri, 16 Mar 2018 17:30:44 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180316173044.dctlydfij7smndxd@abyayala> References: <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: 8bit In-Reply-To: <87woyxt3nz.fsf@fastmail.com> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: =?utf-8?B?QmrDtnJuIEjDtmZsaW5n?= , 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) Marius Bakke transcribed 4.8K bytes: > Björn Höfling writes: > > > Hi Marius, > > > > On Mon, 26 Feb 2018 21:06:57 +0100 > > Marius Bakke wrote: > > > >> ng0 writes: > >> > >> > Marius Bakke transcribed 2.1K bytes: > >> >> Mike Gerwitz writes: > >> >> > >> >> > On Tue, Jan 16, 2018 at 20:01:34 +0100, Marius Bakke wrote: > >> >> >> If there are no objections, expect to see this in 'master' in > >> >> >> 1-2 weeks. > >> >> > > >> >> > I want to express gratitude for your hard work on this---given > >> >> > that IceCat does not contain many of the FF devtool updates, > >> >> > Chromium is very desirable for web development. It's also > >> >> > needed for certain Node.js tools, like node-inspector. > >> >> > > >> >> > So, thank you! > >> >> > >> >> Thank *you* for the kind words! :-) > >> >> > >> >> Here is the latest iteration of this patch. New in this version: > >> >> > >> >> * Chromium 64 (duh). > >> >> * The 'delete-bundled-software' phase has been moved to a snippet, > >> >> shaving ~100MiB (~22%) off the compressed tarball size (and > >> >> drastically reduces (de)compression time). > >> >> * The New Tab page does not show any thumbnails for new profiles. > >> > > >> > I think you forgot to attach the patches :) > >> > >> Derp. I realized that and just used `git send-email`[0], but have > >> attached it here for convenience since the debbugs web UI doesn't > >> allow easy download of a raw message. > >> > >> [0] https://debbugs.gnu.org/cgi/bugreport.cgi?msg=131;bug=28004#131 > >> > > > > > > This looks like a lot of work. Thank you! > > > > I quickly tried to apply and build the patch and have two first remarks: > > > > The file says: > > > > ;;; Copyright © 2016, 2017, 2018 Marius Bakke > > > > I haven't followed history, have you worked on this since 2016? > > Yeah, I started this shortly after going full-GuixSD in October 2016. > But I didn't submit it until now because I didn't think it met Guix's > standards (and still think it's questionable due to privacy concerns). > > > One patch has a hash-mismatch: > > > > Starting download of /gnu/store/q8hlws48cjfcmz6i40jrnxn3kp750gy4-chromium-icu.patch > > From https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/plain/debian/patches/system/icu.patch?id=debian/64.0.3282.119-2... > > icu.patch 2KiB 1.8MiB/s 00:00 [####################] 100.0% > > output path `/gnu/store/q8hlws48cjfcmz6i40jrnxn3kp750gy4-chromium-icu.patch' should have sha256 hash `0kf77d8lyma3w0xpgfv2k0c741zp6ii08gzllfja6d5s59c15ylv', instead has `19r0bpv2hapzq5m0m7rlz1dwn3h2ijgkilb2hmhw56qvwpbw0b59' > > @ build-failed /gnu/store/cqdllqn8ig5wnjn0yqvnh4vlzsvnpzv6-chromium-icu.patch.drv - 1 output path `/gnu/store/q8hlws48cjfcmz6i40jrnxn3kp750gy4-chromium-icu.patch' should have sha256 hash `0kf77d8lyma3w0xpgfv2k0c741zp6ii08gzllfja6d5s59c15ylv', instead has `19r0bpv2hapzq5m0m7rlz1dwn3h2ijgkilb2hmhw56qvwpbw0b59' > > cannot build derivation `/gnu/store/vacxbwsprcp52vp6q975450zi091dak2-chromium-64.0.3282.186.tar.xz.drv': 1 dependencies couldn't be built > > @ build-started /gnu/store/7q53inn1v32b5fain0h0wcrliclf0ff1-libvpx+experimental-1.7.0.drv - x86_64-linux /var/log/guix/drvs/7q//53inn1v32b5fain0h0wcrliclf0ff1-libvpx+experimental-1.7.0.drv.bz2 > > cannot build derivation `/gnu/store/5qv7anaaqk4576pma9mhcsz1nhrx1n01-chromium-64.0.3282.186.drv': 1 dependencies couldn't be built > > guix build: error: build failed: build of `/gnu/store/5qv7anaaqk4576pma9mhcsz1nhrx1n01-chromium-64.0.3282.186.drv' failed > > > > I looked into the file and it looks reasonable, like a patch-file. It has no download errors. > > > > It starts like this: > > > > description: backwards compatibility for older versions of icu > > author: Michael Gilbert > > > > --- a/v8/src/runtime/runtime-intl.cc > > +++ b/v8/src/runtime/runtime-intl.cc > > @@ -627,7 +627,11 @@ RUNTIME_FUNCTION(Runtime_PluralRulesSele > > > > ... > > > > Can you check this file again? > > Whoops, indeed. I had an older patch in my store and apparently forgot > to update the hash. > > The correct hash for %chromium-system-icu.patch is: > > 19r0bpv2hapzq5m0m7rlz1dwn3h2ijgkilb2hmhw56qvwpbw0b59 > > Thanks for letting me know! I'll send an updated patch later, with some > other minor improvements. I think we found it to be good enough to be included in master, or did I miss anything? Would be nice if I could drop my local patch (and building). The team around Taler seems to be interested in it as well as far as I can remember our chats in Leipzig. -- A88C8ADD129828D7EAC02E52E22F9BBFEE348588 https://n0.is From debbugs-submit-bounces@debbugs.gnu.org Fri Mar 16 13:45:09 2018 Received: (at 28004) by debbugs.gnu.org; 16 Mar 2018 17:45:09 +0000 Received: from localhost ([127.0.0.1]:37259 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ewtPh-0003uS-JF for submit@debbugs.gnu.org; Fri, 16 Mar 2018 13:45:09 -0400 Received: from out5-smtp.messagingengine.com ([66.111.4.29]:34735) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ewtPf-0003uJ-Hq for 28004@debbugs.gnu.org; Fri, 16 Mar 2018 13:45:08 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id C651420DEA; Fri, 16 Mar 2018 13:45:06 -0400 (EDT) Received: from frontend1 ([10.202.2.160]) by compute5.internal (MEProxy); Fri, 16 Mar 2018 13:45:06 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; bh=4KJvXtZI4EHUztZBzC5IQXYaixbyfZ0ys2lgg5hsdKg=; b=HYl/pIA6 msUUkH4Ir4nxGv/O9473M3aUoF6WxbczjiQinx9kiXx3BssPEVxKY0BsultM2TQI V1x/6aagv4mrrX1YlfFS2kYVMA1r3+XTIMLeC1kAFkKW9pCG/KevmhusPIjmHvCB QVhR/2I9iNE91ADitujqqTUKHr0kJG3bjWj5UfE2+ArzEQGYv8YyITgMqzeulAyM WDk2IbltWWJf3QWMs3REa7fxE3PiwBWqrV4ac86SeMWPKHvzqsLKd2/Y9GDfXpQi GhZzc18diHel915+heZu6OlIT2bMqVhHQEmt5y7ZkuOGBKo3mXL/qHGkjTMHUYUc Uby5ktGfB+RLKw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm2; bh=4KJvXtZI4EHUztZBzC5IQXYaixbyf Z0ys2lgg5hsdKg=; b=APZ/mMu0mGMw7NqwcUdTQ7SiCjLZHKaSYhS6F4UdSUhWh 7MgEjcNVFCwliGaSCq3AlC8V4DrXzH1ZKB/NNToCwjSjr2whfZlgABSI0Zy9+/b2 yT0Pc/qS3C2Y11vq+4OEb/oiqltj+tUe/fOgKQvPG0vIyyuIOYGYslFJHd/jTlF5 xgRXWqatcNTSNX7cycWBGq/3e7bslOR0uD24z2ShRcxUJr6p7wBaR7FZaqvS84w6 gUa2dBK0FNL+ygtqIGeF6JHFuEYfPlotwuwaIt29wFHnNBRsYnZYShiXvbDZBpgY BNmZ8svORR0vk2XkItlXmD2pMoEI7C9YRVkydMz3w== X-ME-Sender: Received: from localhost (ti0005a400-2325.bb.online.no [80.212.254.34]) by mail.messagingengine.com (Postfix) with ESMTPA id 3C83F7E1FF; Fri, 16 Mar 2018 13:45:06 -0400 (EDT) From: Marius Bakke To: ng0 Subject: Re: [bug#28004] Chromium In-Reply-To: <20180316173044.dctlydfij7smndxd@abyayala> References: <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> <20180316173044.dctlydfij7smndxd@abyayala> User-Agent: Notmuch/0.26 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Fri, 16 Mar 2018 18:45:04 +0100 Message-ID: <87h8pfc3tr.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: =?utf-8?Q?Bj=C3=B6rn_H=C3=B6fling?= , 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --=-=-= Content-Type: text/plain ng0 writes: > I think we found it to be good enough to be included in master, or did I miss anything? > > Would be nice if I could drop my local patch (and building). The team around Taler seems > to be interested in it as well as far as I can remember our chats in Leipzig. Reading up on GNU Taler, Chromium seems like a poor choice for an anonymous payment system. Why not GNU IceCat? I don't see Chromium becoming stable enough for guaranteed privacy any time soon. And a full fork would require a large maintenance team. Unfortunately I got busy after the latest update, and haven't had time to work on 65 yet. I will send an update once I get around to it, and also try some other Inox patches and see if they help with the "first launch" issue -- hopefully within a week or two. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlqsAqAACgkQoqBt8qM6 VPpoYgf+ILajYD73EBu0xTFNQGJn2XIbTesjwIgVWEIKWdlLswDaoP+eD0WnrBsu 5o/GrYeWMwKpxJ7mc7PLYCuYB8zpgLQB4C/heNKNpljS2BHVevaHE8DHpNam5dIr fT001k7JHhZuXQQWauNfgmUBXP/oGp5+KyH+Co9zbXpX7OlegwNbc6DZwq+rRUG2 gmxgKxRKLDM51pAGQySV6eoBhGG1GJYxNdTeUdcEXoJtX0cBVcta9iswA2YQFMKL vNXZPfgGsOv75KIFEzhdV5BYw3x7uQBYtvkcu6G9OkCeNbk6HJNYpfapM0WqBZhs ymG1kcpiTDUD/e4uBDd80OrQnHhggQ== =0xjP -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Fri Mar 16 13:52:25 2018 Received: (at 28004) by debbugs.gnu.org; 16 Mar 2018 17:52:25 +0000 Received: from localhost ([127.0.0.1]:37263 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ewtWj-00046C-CS for submit@debbugs.gnu.org; Fri, 16 Mar 2018 13:52:25 -0400 Received: from aibo.runbox.com ([91.220.196.211]:55592) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ewtWh-000460-Iv for 28004@debbugs.gnu.org; Fri, 16 Mar 2018 13:52:24 -0400 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1ewtWf-0001Um-K2; Fri, 16 Mar 2018 18:52:21 +0100 Received: from dslb-092-072-221-035.092.072.pools.vodafone-ip.de ([92.72.221.35] helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1ewtWV-00088v-5F; Fri, 16 Mar 2018 18:52:11 +0100 Date: Fri, 16 Mar 2018 17:52:25 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180316175225.7jf4k2qaciyxnepp@abyayala> References: <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> <20180316173044.dctlydfij7smndxd@abyayala> <87h8pfc3tr.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="mkofdllgcgyb6gch" Content-Disposition: inline In-Reply-To: <87h8pfc3tr.fsf@fastmail.com> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: =?utf-8?B?QmrDtnJuIEjDtmZsaW5n?= , 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) --mkofdllgcgyb6gch Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 1.4K bytes: > ng0 writes: >=20 > > I think we found it to be good enough to be included in master, or did = I miss anything? > > > > Would be nice if I could drop my local patch (and building). The team a= round Taler seems > > to be interested in it as well as far as I can remember our chats in Le= ipzig. >=20 > Reading up on GNU Taler, Chromium seems like a poor choice for an > anonymous payment system. Why not GNU IceCat? I don't see Chromium > becoming stable enough for guaranteed privacy any time soon. And a full > fork would require a large maintenance team. Why: Ask Taler directly, I'm not involved with them. And on for what: It is just for the Browser extension. No one is forking Chromium again. > Unfortunately I got busy after the latest update, and haven't had time > to work on 65 yet. I will send an update once I get around to it, and > also try some other Inox patches and see if they help with the "first > launch" issue -- hopefully within a week or two. Cool, thanks! And thanks for your continued work on this. I'll definitely try to help out once it is in master. --=20 A88C8ADD129828D7EAC02E52E22F9BBFEE348588 https://n0.is --mkofdllgcgyb6gch Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlqsBFkACgkQ4i+bv+40 hYhN/Q/9FpjVSMbtxcBVIhXk56gnCGGhohJxTKVVqsGrru/ZpO3XO0Sq5aOhvyPx JkYG2iYL0pJboltQWFWw/NO4JRYVdTt/mNZMyaL/R3vd/eSQb7DqpohUOq9CKcJ8 a76LvqaLqTrAYrVCOLEYYayiKzxlky5HZLt1vkQ4MEW8h3gdVEicHa5axhICPuX+ brbXZTilWgCI2DZPhaSIdrEHeGMqXldhmskMz55Wq3mJiBStQisTbiIdd+KLHfMh Ur407LLJxzghb3X0HSMH49Lk1A1k9xWothMM0dIQ6M2rvh2mJD/RMEyBER/B9bTu 3c+rOIuspsyVs7r9E6+S+0dR84R/XY3Eg9jVArNy5cF7fnEqYxUFXqeXs4Zbntlb sDicqs/XpdxqTKHymzpIbL02LpLoF8j+zdSo9Hz3mVpqR3Kd55JkBZBV7I+WzHBy fa6MWMpLNvLblonUqgu83SmWetky0YfDQSApWpvM0kAbiGDbyoV1pPNcW39nJJ1k Vv4E0MwGFFCXRkWyX4zJgimkkPEZkaYUNz4IFbdxNazEhMdqp2HnuVzuHbfNvlX4 hGnpGhWwXyz3Z4mw/y5IkQlVD6WjziSIDUDHgdqTY/i71JfH9LdaDC6l2vKkgylE B2oc6nrQDGJ5J0pRryhSp0XTsQK3i0fy//ZuavF5etCa83PXhnY= =Ai+x -----END PGP SIGNATURE----- --mkofdllgcgyb6gch-- From debbugs-submit-bounces@debbugs.gnu.org Fri Mar 16 15:02:18 2018 Received: (at submit) by debbugs.gnu.org; 16 Mar 2018 19:02:18 +0000 Received: from localhost ([127.0.0.1]:37279 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ewucM-0005nJ-Bi for submit@debbugs.gnu.org; Fri, 16 Mar 2018 15:02:18 -0400 Received: from eggs.gnu.org ([208.118.235.92]:39567) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ewucL-0005n6-1M for submit@debbugs.gnu.org; Fri, 16 Mar 2018 15:02:17 -0400 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1ewucE-0001D0-TT for submit@debbugs.gnu.org; Fri, 16 Mar 2018 15:02:11 -0400 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=0.8 required=5.0 tests=BAYES_50 autolearn=disabled version=3.3.2 Received: from lists.gnu.org ([2001:4830:134:3::11]:47274) by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1ewucE-0001CT-PJ for submit@debbugs.gnu.org; Fri, 16 Mar 2018 15:02:10 -0400 Received: from eggs.gnu.org ([2001:4830:134:3::10]:58738) by lists.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1ewucD-0005ko-CQ for guix-patches@gnu.org; Fri, 16 Mar 2018 15:02:10 -0400 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1ewuc9-000187-D4 for guix-patches@gnu.org; Fri, 16 Mar 2018 15:02:09 -0400 Received: from relay2-d.mail.gandi.net ([217.70.183.194]:35313) by eggs.gnu.org with esmtps (TLS1.0:DHE_RSA_AES_256_CBC_SHA1:32) (Exim 4.71) (envelope-from ) id 1ewuc9-00015S-6N for guix-patches@gnu.org; Fri, 16 Mar 2018 15:02:05 -0400 X-Originating-IP: 181.221.158.128 Received: from adfeno-pc1 (unknown [181.221.158.128]) (Authenticated sender: adfeno@hyperbola.info) by relay2-d.mail.gandi.net (Postfix) with ESMTPSA id 19E3F4000D for ; Fri, 16 Mar 2018 20:02:01 +0100 (CET) From: Adonay Felipe Nogueira To: guix-patches@gnu.org Subject: Re: [bug#28004] Chromium References: <20180108232042.nqjurjr2bcfl2yyc@abyayala> <87373cey5b.fsf@fastmail.com> <87vag16g5z.fsf@gnu.org> <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> <20180316173044.dctlydfij7smndxd@abyayala> <87h8pfc3tr.fsf@fastmail.com> Date: Fri, 16 Mar 2018 16:01:50 -0300 In-Reply-To: <87h8pfc3tr.fsf@fastmail.com> (Marius Bakke's message of "Fri, 16 Mar 2018 18:45:04 +0100") Message-ID: <87po43rgip.fsf@hyperbola.info> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/25.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] [fuzzy] X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.6.x X-Received-From: 2001:4830:134:3::11 X-Spam-Score: -4.1 (----) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -4.1 (----) > Reading up on GNU Taler, Chromium seems like a poor choice for an > anonymous payment system. Why not GNU IceCat? I don't see Chromium > becoming stable enough for guaranteed privacy any time soon. And a full > fork would require a large maintenance team. +1 (I agree with you). --=20 - https://libreplanet.org/wiki/User:Adfeno - Palestrante e consultor sobre /software/ livre (n=C3=A3o confundir com gratis). - "WhatsApp"? Ele n=C3=A3o =C3=A9 livre. Por favor, veja formas de se comun= icar instantaneamente comigo no endere=C3=A7o abaixo. - Contato: https://libreplanet.org/wiki/User:Adfeno#vCard - Arquivos comuns aceitos (apenas sem DRM): Corel Draw, Microsoft Office, MP3, MP4, WMA, WMV. - Arquivos comuns aceitos e enviados: CSV, GNU Dia, GNU Emacs Org, GNU GIMP, Inkscape SVG, JPG, LibreOffice (padr=C3=A3o ODF), OGG, OPUS, PDF (apenas sem DRM), PNG, TXT, WEBM. From debbugs-submit-bounces@debbugs.gnu.org Fri Mar 16 15:34:42 2018 Received: (at 28004) by debbugs.gnu.org; 16 Mar 2018 19:34:42 +0000 Received: from localhost ([127.0.0.1]:37293 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ewv7i-0006Zo-Iy for submit@debbugs.gnu.org; Fri, 16 Mar 2018 15:34:42 -0400 Received: from aibo.runbox.com ([91.220.196.211]:36174) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ewv7g-0006Ze-4h for 28004@debbugs.gnu.org; Fri, 16 Mar 2018 15:34:40 -0400 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1ewv7e-0001S3-24; Fri, 16 Mar 2018 20:34:38 +0100 Received: from dslb-092-072-221-035.092.072.pools.vodafone-ip.de ([92.72.221.35] helo=localhost) by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1ewv7A-0005jB-N2; Fri, 16 Mar 2018 20:34:08 +0100 Date: Fri, 16 Mar 2018 19:34:22 +0000 From: ng0 To: Adonay Felipe Nogueira Subject: Re: [bug#28004] Chromium Message-ID: <20180316193422.wd6rybkpxpzyvqs7@abyayala> References: <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> <20180316173044.dctlydfij7smndxd@abyayala> <87h8pfc3tr.fsf@fastmail.com> <87po43rgip.fsf@hyperbola.info> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline In-Reply-To: <87po43rgip.fsf@hyperbola.info> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) Adonay Felipe Nogueira transcribed 890 bytes: > > Reading up on GNU Taler, Chromium seems like a poor choice for an > > anonymous payment system. Why not GNU IceCat? I don't see Chromium > > becoming stable enough for guaranteed privacy any time soon. And a full > > fork would require a large maintenance team. > > +1 (I agree with you). Read the follow-up emails I've sent. Also, 1 line emails which basically say "+1" are not really good, even more so when it goes offtopic (this is about getting Chrmium into Guix!). As we are already offtopic: Want Cross-Browser support so that the Browser *extension* (Taler is not *a* Browser) runs in legacy old cruft Icecat base and newer Firefox (which shares extension format with Chrome? Good, there's something to work on in Taler if you want it. Again, I am not a Taler developer, reach out to them. -- A88C8ADD129828D7EAC02E52E22F9BBFEE348588 https://n0.is From debbugs-submit-bounces@debbugs.gnu.org Fri Mar 16 17:20:35 2018 Received: (at 28004) by debbugs.gnu.org; 16 Mar 2018 21:20:35 +0000 Received: from localhost ([127.0.0.1]:37347 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ewwmB-0002aV-Hj for submit@debbugs.gnu.org; Fri, 16 Mar 2018 17:20:35 -0400 Received: from relay2-d.mail.gandi.net ([217.70.183.194]:39947) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1ewwm8-0002aJ-TO for 28004@debbugs.gnu.org; Fri, 16 Mar 2018 17:20:33 -0400 X-Originating-IP: 181.221.158.128 Received: from adfeno-pc1 (unknown [181.221.158.128]) (Authenticated sender: adfeno@hyperbola.info) by relay2-d.mail.gandi.net (Postfix) with ESMTPSA id EB80F40005 for <28004@debbugs.gnu.org>; Fri, 16 Mar 2018 22:20:30 +0100 (CET) From: Adonay Felipe Nogueira To: 28004@debbugs.gnu.org Subject: Re: [bug#28004] Chromium References: <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> <20180316173044.dctlydfij7smndxd@abyayala> <87h8pfc3tr.fsf@fastmail.com> <87po43rgip.fsf@hyperbola.info> <20180316193422.wd6rybkpxpzyvqs7@abyayala> Date: Fri, 16 Mar 2018 18:20:29 -0300 In-Reply-To: <20180316193422.wd6rybkpxpzyvqs7@abyayala> (ng0@n0.is's message of "Fri, 16 Mar 2018 19:34:22 +0000") Message-ID: <87in9vpvj6.fsf@hyperbola.info> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/25.3 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.7 (/) > Guix!). As we are already offtopic: Want Cross-Browser support > so that the Browser *extension* (Taler is not *a* Browser) runs > in legacy old cruft Icecat base and newer Firefox (which shares > extension format with Chrome? > Good, there's something to work on in Taler if you want it. > > Again, I am not a Taler developer, reach out to them. Indeed, sorry for the bother, I tought I was replying to Taler. I guess I'm somewhat asleep today. From debbugs-submit-bounces@debbugs.gnu.org Fri Apr 13 15:11:05 2018 Received: (at 28004) by debbugs.gnu.org; 13 Apr 2018 19:11:05 +0000 Received: from localhost ([127.0.0.1]:50938 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1f7467-0007c6-Q2 for submit@debbugs.gnu.org; Fri, 13 Apr 2018 15:11:05 -0400 Received: from out3-smtp.messagingengine.com ([66.111.4.27]:43093) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1f7461-0007bt-7F for 28004@debbugs.gnu.org; Fri, 13 Apr 2018 15:10:58 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id D01E521FC6 for <28004@debbugs.gnu.org>; Fri, 13 Apr 2018 15:10:52 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Fri, 13 Apr 2018 15:10:52 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= content-type:date:from:message-id:mime-version:subject:to :x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=8s9c0inl2pKs0AjYN 4OvSv96fJbjnUAfYwfAphKTu98=; b=iywqSJiRsVaLNDcNveFDto0bT8o4roJux slPsJiYyUHE1hXyG01yOugV0X/Cw9hAWKFo5ix5cyxkObO9QOI5jIeucziIyNKOp rFyvihp0P9GcWiR8JAmUP+kJPkh3lRsgoB6JT1+72X9lp0b9ZTuW92Z4ZQKVBAgK Rk7B7RsB1K4WHJSZkcxumk1X3QQYxoPtKES4c5b+GvxEvTLL34Ejdq4s4FrU0/wn Uv8pZS95Qq+g3KtOify3o+Y4ukkuFv/nJ7FrtSaYrRCBTzjsGSJTnZXIzBv1iLSb uaeI1BbPTM1E8sdVYZRlNCH1J2WXDS7MSsuon/yhfMCa1dMpykIoQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:message-id :mime-version:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; bh=8s9c0inl2pKs0AjYN4OvSv96fJbjnUAfYwfAphKTu98=; b=HoEfc6rK c7RlUTXfIpNJE0MolH+62WzIQw6j16aq0uH114bUSzkWemPZUVRVKakMkIQddz1n wLxHhYe8R8mPHD/d+wajUalPb3yTzF1XXPfuprNbgovZN0yqU1XWEjwJifF+WRqr XQYzY15SSCLbjDKnsIWUD4YxdALH4rci35mouFS34ijvBUVtj5pkuoHnCCXMjVDa n7g0corocKepy3/pOtyye1umMnJ3rALjZY9kEKAMHNZvTotxR+jp/fQ9SVjyfgyJ gmvFoj+q6y7TK584Irm74F+bVWgWoizK7kFZjd8CtBDpHmrSfu2oD7MTvmvHGhX/ WLCKr+k5JOtB8w== X-ME-Sender: Received: from localhost (ti0089a400-2222.bb.online.no [88.89.166.190]) by mail.messagingengine.com (Postfix) with ESMTPA id 0AD9710255 for <28004@debbugs.gnu.org>; Fri, 13 Apr 2018 15:10:50 -0400 (EDT) From: Marius Bakke To: 28004@debbugs.gnu.org Subject: Chromium 65 User-Agent: Notmuch/0.26.1 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Fri, 13 Apr 2018 21:10:48 +0200 Message-ID: <87po32c47b.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain Hello! Attached is a patch for Chromium 65. New in this version: * Deleting third party files is now done with a single traversal of the file system, instead of the "shotgun" approach used previously. I also added a second pass to scrub bundled JARs and tarballs, that will be incorporated in the "nftw" snippet eventually. * It's using Clang instead of GCC since the latter is no longer supported upstream (as in part of their continuous integration). GCC5 in particular is completely broken with this release. Debian and NixOS are apparently able to build it with GCC 6 and 7 respectively, but Arch and Gentoo changed to Clang with 65. Unfortunately GCC6 and later has other problems in Guix: . * Various tweaks to build options after reading the "GN" flags more closely. In particular, more debugging symbols have been removed. I haven't done anything on the privacy side since this update was difficult enough as-is. You'll notice a few hacks around Clang and libstdc++, and also that currently only x86_64 is supported due to unconditionally adding the x86_64 triplet to CPLUS_INCLUDE_PATH. Hopefully future updates will be easier. Any feedback on the Clang/libstdc++ issues mentioned in the patch are very welcome. --=-=-= Content-Type: text/x-patch; charset=utf-8 Content-Disposition: attachment; filename=0001-gnu-Add-chromium.patch Content-Transfer-Encoding: quoted-printable From=20759253a8966e2e6afbeaeb67255e4e067ce33b76 Mon Sep 17 00:00:00 2001 From: Marius Bakke Date: Wed, 12 Oct 2016 17:25:05 +0100 Subject: [PATCH] gnu: Add chromium. * gnu/packages/chromium.scm: New file. * gnu/packages/patches/chromium-glibc-compat.patch, gnu/packages/patches/chromium-remove-default-history.patch: New files. * gnu/local.mk: Record it. =2D-- gnu/local.mk | 3 + gnu/packages/chromium.scm | 894 ++++++++++++++++++ .../patches/chromium-glibc-compat.patch | 38 + .../chromium-remove-default-history.patch | 13 + 4 files changed, 948 insertions(+) create mode 100644 gnu/packages/chromium.scm create mode 100644 gnu/packages/patches/chromium-glibc-compat.patch create mode 100644 gnu/packages/patches/chromium-remove-default-history.pa= tch diff --git a/gnu/local.mk b/gnu/local.mk index 3d4b05c77..03f972130 100644 =2D-- a/gnu/local.mk +++ b/gnu/local.mk @@ -94,6 +94,7 @@ GNU_SYSTEM_MODULES =3D \ %D%/packages/check.scm \ %D%/packages/chemistry.scm \ %D%/packages/chez.scm \ + %D%/packages/chromium.scm \ %D%/packages/ci.scm \ %D%/packages/cinnamon.scm \ %D%/packages/cmake.scm \ @@ -591,6 +592,8 @@ dist_patch_DATA =3D \ %D%/packages/patches/ceph-skip-collect-sys-info-test.patch \ %D%/packages/patches/ceph-skip-unittest_blockdev.patch \ %D%/packages/patches/chmlib-inttypes.patch \ + %D%/packages/patches/chromium-glibc-compat.patch \ + %D%/packages/patches/chromium-remove-default-history.patch \ %D%/packages/patches/clang-3.5-libc-search-path.patch \ %D%/packages/patches/clang-3.8-libc-search-path.patch \ %D%/packages/patches/clang-6.0-libc-search-path.patch \ diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm new file mode 100644 index 000000000..cecbab7a1 =2D-- /dev/null +++ b/gnu/packages/chromium.scm @@ -0,0 +1,894 @@ +;;; GNU Guix --- Functional package management for GNU +;;; Copyright =C2=A9 2016, 2017, 2018 Marius Bakke +;;; +;;; This file is part of GNU Guix. +;;; +;;; GNU Guix is free software; you can redistribute it and/or modify it +;;; under the terms of the GNU General Public License as published by +;;; the Free Software Foundation; either version 3 of the License, or (at +;;; your option) any later version. +;;; +;;; GNU Guix is distributed in the hope that it will be useful, but +;;; WITHOUT ANY WARRANTY; without even the implied warranty of +;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +;;; GNU General Public License for more details. +;;; +;;; You should have received a copy of the GNU General Public License +;;; along with GNU Guix. If not, see . + +(define-module (gnu packages chromium) + #:use-module ((guix licenses) #:prefix license:) + #:use-module (guix packages) + #:use-module (guix download) + #:use-module (guix git-download) + #:use-module (guix utils) + #:use-module (guix build-system gnu) + #:use-module (guix build-system trivial) + #:use-module (gnu packages) + #:use-module (gnu packages assembly) + #:use-module (gnu packages base) + #:use-module (gnu packages bison) + #:use-module (gnu packages compression) + #:use-module (gnu packages cups) + #:use-module (gnu packages curl) + #:use-module (gnu packages databases) + #:use-module (gnu packages fontutils) + #:use-module (gnu packages gcc) + #:use-module (gnu packages ghostscript) + #:use-module (gnu packages gl) + #:use-module (gnu packages glib) + #:use-module (gnu packages gnome) + #:use-module (gnu packages gnuzilla) + #:use-module (gnu packages gperf) + #:use-module (gnu packages gtk) + #:use-module (gnu packages icu4c) + #:use-module (gnu packages image) + #:use-module (gnu packages libevent) + #:use-module (gnu packages libffi) + #:use-module (gnu packages libusb) + #:use-module (gnu packages linux) + #:use-module (gnu packages llvm) + #:use-module (gnu packages kerberos) + #:use-module (gnu packages ninja) + #:use-module (gnu packages node) + #:use-module (gnu packages pciutils) + #:use-module (gnu packages photo) + #:use-module (gnu packages pkg-config) + #:use-module (gnu packages protobuf) + #:use-module (gnu packages pulseaudio) + #:use-module (gnu packages python) + #:use-module (gnu packages python-web) + #:use-module (gnu packages regex) + #:use-module (gnu packages serialization) + #:use-module (gnu packages speech) + #:use-module (gnu packages tls) + #:use-module (gnu packages valgrind) + #:use-module (gnu packages version-control) + #:use-module (gnu packages video) + #:use-module (gnu packages xiph) + #:use-module (gnu packages xml) + #:use-module (gnu packages xdisorg) + #:use-module (gnu packages xorg)) + +(define (strip-directory-prefix pathspec) + "Return everything after the last '/' in PATHSPEC." + (let ((index (string-rindex pathspec #\/))) + (if index + (string-drop pathspec (+ 1 index)) + pathspec))) + +(define (chromium-patch-file-name pathspec) + (let ((patch-name (strip-directory-prefix pathspec))) + (if (string-prefix? "chromium-" patch-name) + patch-name + (string-append "chromium-" patch-name)))) + +;; https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/tree/debi= an/patches +(define (debian-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append + "https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git" + "/plain/debian/patches/" pathspec "?id=3D" revision)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://gitweb.gentoo.org/repo/gentoo.git/tree/www-client/chromium/files +(define (gentoo-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-client" + "/chromium/files/" pathspec "?id=3D" revision)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://github.com/gcarq/inox-patchset +(define (inox-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append "https://raw.githubusercontent.com/gcarq/inox-patc= hset/" + revision "/" pathspec)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://github.com/NixOS/nixpkgs/tree/master/pkgs/applications/networki= ng/browsers/chromium +(define (nixos-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append "https://raw.githubusercontent.com/NixOS/nixpkgs/" + revision "/pkgs/applications/networking/browsers" + "/chromium/patches/" pathspec)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; Fix an assignment bug when using Clang and libstdc++. +(define %chromium-clang-assignment.patch + (gentoo-patch "chromium-clang-r3.patch" + "804a0d7244a06736d01c353b45c20daf324f0722" + "1d10il3mjzyzwgqi8iifw3aw9jnbqfrzz8v1x7cmvqpwjkykwk2a")) + +;; Add missing stdint include. +(define %chromium-add-missing-stdint.patch + (gentoo-patch "chromium-stdint.patch" + "804a0d7244a06736d01c353b45c20daf324f0722" + "03r16zqi0hm3i00b9bwq2bdn2sp731rllizcxfl3i2q7y432a3f0")) + +(define %chromium-system-nspr.patch + (debian-patch "system/nspr.patch" + "debian/65.0.3325.146-4" + "1ggdrlz94d75ni21rx6ivvajjwhx7zwnl3s5aapysqn9kls4qsr2")) + +(define %chromium-system-libevent.patch + (debian-patch "system/event.patch" + "debian/65.0.3325.146-4" + "1k3zc59vpwc8rzbknxryjzzy99jk666whdablzcvxnyzaqk38kfx")) + +(define %chromium-system-icu.patch + (debian-patch "system/icu.patch" + "debian/65.0.3325.146-4" + "19wclidx1kyjbi3b3hnmkjs0h34d67p4dp6a48vbjbx9rxmfdk3b")) + +;; Don't show a warning about missing API keys. +(define %chromium-disable-api-keys-warning.patch + (debian-patch "disable/google-api-warning.patch" + "debian/65.0.3325.146-4" + "1g5yk51bl7svrqx8wjxsgpz545mnymnpi3bsa62kwdm4qd8bx10x")) + +;; Add DuckDuckGo and set it as the default search engine. +(define %chromium-duckduckgo.patch + (inox-patch "0011-add-duckduckgo-search-engine.patch" + "0c55cc9a81634244ad13fbbd6b5c5098b9132162" + "0mvw1ax0gw3d252c9b1pwbk0j7ny8z9nsfywcmhj56wm6yksgpkg")) + +;; Don't start a "Login Wizard" at first launch. +(define %chromium-first-run.patch + (inox-patch "0018-disable-first-run-behaviour.patch" + "0c55cc9a81634244ad13fbbd6b5c5098b9132162" + "1y4zsqqf2125jkb1phwy9g5hcbd9xhyv5lr4xcaly66rpdzx2ayb")) + +;; Use privacy-preserving defaults. +(define %chromium-default-preferences.patch + (inox-patch "0006-modify-default-prefs.patch" + "0c55cc9a81634244ad13fbbd6b5c5098b9132162" + "0zyshpl1hjssqrfhdfbgxdib4smdszjgf0ac98l978hrn9gwwk03")) + +;; Recent versions of Chromium may load a remote search engine on the +;; New Tab Page, causing unnecessary and involuntary network traffic. +(define %chromium-restore-classic-ntp.patch + (inox-patch "0008-restore-classic-ntp.patch" + "0c55cc9a81634244ad13fbbd6b5c5098b9132162" + "1h698cbp97g8lgmndfy6kswgwfvss7c3k609xgvyxbfldkzy7pd5")) + +(define opus+custom + (package (inherit opus) + (name "opus+custom") + (arguments + (substitute-keyword-arguments (package-arguments opus) + ((#:configure-flags flags ''()) + ;; Opus Custom is an optional extension of the Opus + ;; specification that allows for unsupported frame + ;; sizes. Chromium requires that this is enabled. + `(cons "--enable-custom-modes" + ,flags)))))) + +(define libvpx+experimental + (package (inherit libvpx) + (name "libvpx+experimental") + (arguments + (substitute-keyword-arguments (package-arguments libvpx) + ((#:configure-flags flags) + ;; Spatial SVC is an experimental VP9 encoder required + ;; by Chromium. + `(cons* "--enable-experimental" "--enable-spatial-svc" + ,flags)))))) + +;; XXX: This ugly libstdc++ variant stems from the fact that building +;; libstdc++ standalone is not officially supported by GCC upstream, and +;; the "make-libstdc++" procedure consequently builds a library without +;; threading support, since the configure script fails to detect gthreads. +;; +;; Fixing it properly would require building libgcc (which creates +;; gthr-default.h) before building libstdc++. This authors attempts +;; at doing so were unsuccessful, hence this hack. +;; +;; This behaviour changed upstream in this commit: +;; https://gcc.gnu.org/git/?p=3Dgcc.git;a=3Dcommit;h=3D630d52ca0a88d173f89= 634a5d7dd8aee07d04d80 +;; ...or around GCC 4.6. The libstdc++ docs are very explicit about it +;; not being designed to used standalone (even though it worked just fine +;; before 4.6, according to multiple mailing list threads around that time= ), +;; so upstream is not interested in improving the situation. +;; +;; In fact, there used to be an "INSTALL" document with libstdc++, which +;; is conspicuously missing in later releases. +;; +;; An alternative would be to change the GCC package to install C++ headers +;; in "include" rather than "include/c++". I tried that too; but it caused +;; a bootstrapping failure. The situation is further complicated by the +;; fact that GCC installs C++ headers in the default output, but libstdc++= .so +;; ends up in "lib". +;; +;; To be continued... + +(define (libstdc++-from-gcc gcc) + "Return a libstdc++ library extracted from gcc. The primary use case +is when using compilers other than GCC." + (package + (inherit gcc) + (source #f) + (name "libstdc++") + (build-system trivial-build-system) + (arguments + `(#:modules ((guix build utils)) + #:builder (begin + (use-modules (guix build utils)) + (let* ((out (assoc-ref %outputs "out")) + (lib (string-append out "/lib")) + (include (string-append out "/include")) + (gcc (assoc-ref %build-inputs "gcc")) + (gcc-lib (assoc-ref %build-inputs "gcc:lib"))) + (mkdir-p out) + (copy-recursively (string-append gcc "/include/c++") + include) + (for-each (lambda (file) + (install-file file lib)) + (find-files (string-append gcc-lib "/lib") + "^libstdc\\+\\+\\.so.*")) + #t)))) + (outputs '("out")) + (inputs `(("gcc" ,gcc) + ("gcc:lib" ,gcc "lib"))) + (native-inputs '()) + (propagated-inputs '()) + (synopsis "GNU C++ standard library"))) + +(define (make-clang-toolchain clang libcxx) + "Return a complete toolchain for Clang." + (package + (name "clang-toolchain") + (version (package-version clang)) + (source #f) + (build-system trivial-build-system) + (arguments + '(#:modules ((guix build union)) + #:builder (begin + (use-modules (ice-9 match) + (srfi srfi-26) + (guix build union)) + + (let ((out (assoc-ref %outputs "out"))) + + (match %build-inputs + (((names . directories) ...) + (union-build out directories))) + #t)))) + (native-search-paths (package-native-search-paths clang)) + (search-paths (package-search-paths clang)) + (license (package-license clang)) + (synopsis "Complete Clang tool chain for C/C++ development") + (description + "This package provides a complete Clang tool chain for C/C++. This +includes Clang, the Guix ld wrapper, glibc, a C++ library, and Binutils.") + (home-page "https://clang.llvm.org") + (outputs '("out")) + (inputs `(("clang" ,clang) + ("libcxx" ,libcxx) + ("ld-wrapper" ,(car (assoc-ref (%final-inputs) "ld-wrapper")= )) + ("binutils" ,binutils) + ("libc" ,glibc))))) + +;; When using Clang, Chromium expects to find "ar" and friends next +;; to the clang executable. For simplicity just create this union. +(define chromium-clang-toolchain + (make-clang-toolchain clang (libstdc++-from-gcc gcc-6))) + +(define-public chromium + (package + (name "chromium") + (version "65.0.3325.181") + (synopsis "Graphical web browser") + (source (origin + (method url-fetch) + (uri (string-append "https://commondatastorage.googleapis.co= m/" + "chromium-browser-official/chromium-" + version ".tar.xz")) + (sha256 + (base32 + "11w6wg862ixbgm7dpqag2lmbjknv83zlr9imd8zchvmrqr468rlk")) + (patches (list %chromium-duckduckgo.patch + %chromium-default-preferences.patch + %chromium-first-run.patch + %chromium-restore-classic-ntp.patch + + %chromium-clang-assignment.patch + %chromium-add-missing-stdint.patch + %chromium-system-icu.patch + %chromium-system-nspr.patch + %chromium-system-libevent.patch + %chromium-disable-api-keys-warning.patch + (search-patch "chromium-glibc-compat.patch") + (search-patch "chromium-remove-default-histor= y.patch"))) + (modules '((srfi srfi-1) + (srfi srfi-26) + (ice-9 ftw) + (ice-9 match) + (ice-9 regex) + (guix build utils))) + (snippet + '(begin + (let ((preserved-club + (map + (lambda (path) + ;; Prepend paths with "./" for comparison with= ftw. + (string-append "./" path)) + (list + "base/third_party/dmg_fp" + "base/third_party/dynamic_annotations" + "base/third_party/icu" + "base/third_party/libevent" + "base/third_party/nspr" + "base/third_party/superfasthash" + "base/third_party/symbolize" ;glog + "base/third_party/xdg_mime" + "base/third_party/xdg_user_dirs" + "buildtools/third_party/libc++" + "chrome/third_party/mozilla_security_manager" + "courgette/third_party" + "net/third_party/mozilla_security_manager" + "net/third_party/nss" + "third_party/adobe/flash/flapper_version.h" + ;; FIXME: This is used in: + ;; * ui/webui/resources/js/analytics.js + ;; * ui/file_manager/ + "third_party/analytics" + "third_party/angle" + "third_party/angle/src/common/third_party/base" + "third_party/angle/src/common/third_party/smhas= her" + "third_party/angle/src/third_party/compiler" + "third_party/angle/src/third_party/libXNVCtrl" + "third_party/angle/src/third_party/trace_event" + "third_party/blink" + "third_party/boringssl" + "third_party/boringssl/src/third_party/fiat" + "third_party/breakpad" + "third_party/brotli" + "third_party/cacheinvalidation" + "third_party/catapult" + "third_party/catapult/common/py_vulcanize/third= _party/rcssmin" + "third_party/catapult/common/py_vulcanize/third= _party/rjsmin" + "third_party/catapult/third_party/polymer" + "third_party/catapult/tracing/third_party/d3" + "third_party/catapult/tracing/third_party/gl-ma= trix" + "third_party/catapult/tracing/third_party/jszip" + "third_party/catapult/tracing/third_party/mannw= hitneyu" + "third_party/catapult/tracing/third_party/oboe" + "third_party/catapult/tracing/third_party/pako" + "third_party/ced" + "third_party/cld_3" + "third_party/crc32c" + "third_party/cros_system_api" + "third_party/dom_distiller_js" + "third_party/fips181" + "third_party/flatbuffers" + "third_party/glslang-angle" + "third_party/google_input_tools" + "third_party/google_input_tools/third_party/clo= sure_library" + (string-append "third_party/google_input_tools/= third_party" + "/closure_library/third_party/cl= osure") + "third_party/googletest" + "third_party/harfbuzz-ng" + "third_party/hunspell" + "third_party/iccjpeg" + "third_party/inspector_protocol" + "third_party/jinja2" + "third_party/jstemplate" + "third_party/khronos" + "third_party/leveldatabase" + "third_party/libXNVCtrl" + "third_party/libaddressinput" + "third_party/libjingle_xmpp" + "third_party/libphonenumber" + "third_party/libsecret" ;FIXME: needs pkg-confi= g support. + "third_party/libsrtp" ;TODO: Requires libsrtp= @2. + "third_party/libudev" + "third_party/libwebm" + "third_party/libxml" + "third_party/libyuv" + "third_party/lss" + "third_party/lzma_sdk" + "third_party/markupsafe" + "third_party/mesa" + "third_party/metrics_proto" + "third_party/modp_b64" + "third_party/mt19937ar" + "third_party/node" + (string-append "third_party/node/node_modules/" + "polymer-bundler/lib/third_party= /UglifyJS2") + "third_party/openmax_dl" + "third_party/ots" + ;; TODO: Build as extension. + "third_party/pdfium" + "third_party/pdfium/third_party" + (string-append "third_party/pdfium/third_party/= freetype" + "/include/psnames/pstables.h") + "third_party/ply" + "third_party/polymer" + "third_party/protobuf" + "third_party/protobuf/third_party/six" + "third_party/qcms" + "third_party/sfntly" + "third_party/skia" + "third_party/skia/third_party/vulkan" + "third_party/skia/third_party/gif" + "third_party/smhasher" + "third_party/speech-dispatcher" + "third_party/spirv-headers" + "third_party/spirv-tools-angle" + "third_party/sqlite" + "third_party/swiftshader" + "third_party/swiftshader/third_party" + "third_party/s2cellid" + "third_party/usb_ids" + "third_party/usrsctp" + "third_party/vulkan" + "third_party/vulkan-validation-layers" + "third_party/WebKit" + "third_party/web-animations-js" + "third_party/webrtc" + "third_party/webrtc_overrides" + "third_party/widevine/cdm/widevine_cdm_version.= h" + "third_party/widevine/cdm/widevine_cdm_common.h" + "third_party/woff2" + "third_party/xdg-utils" + "third_party/yasm/run_yasm.py" + "third_party/zlib/google" + "url/third_party/mozilla" + "v8/src/third_party/utf8-decoder" + "v8/src/third_party/valgrind" + "v8/third_party/inspector_protocol")))) + + (define (empty? dir) + (equal? (scandir dir) '("." ".."))) + + (define (third_party? file) + (if (string-contains file "third_party/") + #t + #f)) + + (define (parents child) + "Return a list of paths up to and including the clos= est third_party" + (let ((lst (reverse (string-split child #\/)))) + (let loop ((hierarchy lst) + (result '())) + (if (or (null? hierarchy) + (and (not (null? result)) + (string-suffix? "third_party" (car = result)))) + result + (loop (cdr hierarchy) + (cons (string-join (reverse hierarchy)= "/") + result)))))) + + (define (delete-unwanted child stat flag base level) + (let ((protected (make-regexp "\\.(gn|gyp)i?$"))) + (match flag + ((or 'regular 'symlink 'stale-symlink) + (when (third_party? child) + (unless (or (member child preserved-club) + (any (cute member <> preserved-cl= ub) + (parents child)) + (regexp-exec protected child)) + (delete-file child))) + #t) + ('directory-processed + (when (empty? child) + (rmdir child)) + #t) + (_ #t)))) + + (nftw "." delete-unwanted 'depth 'physical) + + ;; Do a second pass to get rid of various binary archi= ves. + (for-each delete-file + (find-files "." "\\.(zip|jar|tar.gz|exe)$")) + + ;; Replace "GN" files from third_party with shims for + ;; building against system libraries. Keep this list = in + ;; sync with "build/linux/unbundle/replace_gn_files.py= ". + (for-each (lambda (pair) + (let ((source (string-append + "build/linux/unbundle/" (ca= r pair))) + (dest (cdr pair))) + (copy-file source dest))) + (list + '("ffmpeg.gn" . "third_party/ffmpeg/BUILD.g= n") + '("flac.gn" . "third_party/flac/BUILD.gn") + '("fontconfig.gn" . "third_party/fontconfig= /BUILD.gn") + '("freetype.gn" . "build/config/freetype/fr= eetype.gni") + '("harfbuzz-ng.gn" . + "third_party/harfbuzz-ng/harfbuzz.gni") + '("icu.gn" . "third_party/icu/BUILD.gn") + '("libdrm.gn" . "third_party/libdrm/BUILD.g= n") + '("libevent.gn" . "base/third_party/libeven= t/BUILD.gn") + '("libjpeg.gn" . + "build/secondary/third_party/libjpeg_turb= o/BUILD.gn") + '("libpng.gn" . "third_party/libpng/BUILD.g= n") + '("libvpx.gn" . "third_party/libvpx/BUILD.g= n") + '("libwebp.gn" . "third_party/libwebp/BUILD= .gn") + '("libxml.gn" . "third_party/libxml/BUILD.g= n") + '("libxslt.gn" . "third_party/libxslt/BUILD= .gn") + '("openh264.gn" . "third_party/openh264/BUI= LD.gn") + '("opus.gn" . "third_party/opus/BUILD.gn") + '("re2.gn" . "third_party/re2/BUILD.gn") + '("snappy.gn" . "third_party/snappy/BUILD.g= n") + '("yasm.gn" . "third_party/yasm/yasm_assemb= le.gni") + '("zlib.gn" . "third_party/zlib/BUILD.gn"))) + #t))))) + (build-system gnu-build-system) + (arguments + `(#:tests? #f + ;; FIXME: There is a "gn" option specifically for setting -rpath, b= ut + ;; it overrides the RUNPATH set by the linker. + #:validate-runpath? #f + #:modules ((srfi srfi-26) + (ice-9 ftw) + (ice-9 regex) + (guix build gnu-build-system) + (guix build utils)) + #:phases + (modify-phases %standard-phases + (add-after 'unpack 'patch-stuff + (lambda* (#:key inputs #:allow-other-keys) + (substitute* "printing/cups_config_helper.py" + (("cups_config =3D.*") + (string-append "cups_config =3D '" (assoc-ref inputs "cups= ") + "/bin/cups-config'\n"))) + + (substitute* + '("base/process/launch_posix.cc" + "base/third_party/dynamic_annotations/dynamic_annotatio= ns.c" + "sandbox/linux/seccomp-bpf/sandbox_bpf.cc" + "sandbox/linux/services/credentials.cc" + "sandbox/linux/services/namespace_utils.cc" + "sandbox/linux/services/syscall_wrappers.cc" + "sandbox/linux/syscall_broker/broker_host.cc") + (("include \"base/third_party/valgrind/") "include \"valgri= nd/")) + + (for-each (lambda (file) + (substitute* file + ;; Fix opus include path. + ;; Do not substitute opus_private.h. + (("#include \"opus\\.h\"") + "#include \"opus/opus.h\"") + (("#include \"opus_custom\\.h\"") + "#include \"opus/opus_custom.h\"") + (("#include \"opus_defines\\.h\"") + "#include \"opus/opus_defines.h\"") + (("#include \"opus_multistream\\.h\"") + "#include \"opus/opus_multistream.h\"") + (("#include \"opus_types\\.h\"") + "#include \"opus/opus_types.h\""))) + (find-files (string-append "third_party/webrtc/modu= les" + "/audio_coding/codecs/op= us"))) + + (substitute* "chrome/common/chrome_paths.cc" + (("/usr/share/chromium/extensions") + ;; TODO: Add ~/.guix-profile. + "/run/current-system/profile/share/chromium/extensions")) + + (substitute* + "third_party/breakpad/breakpad/src/common/linux/libcurl_w= rapper.h" + (("include \"third_party/curl") "include \"curl")) + (substitute* "media/base/decode_capabilities.cc" + (("third_party/libvpx/source/libvpx/") "")) + + ;; We don't cross compile most packages, so get rid of the + ;; unnecessary ARCH-linux-gnu* prefix. + (substitute* "build/toolchain/linux/BUILD.gn" + (("aarch64-linux-gnu-") "") + (("arm-linux-gnueabihf-") "")) + #t)) + (replace 'configure + (lambda* (#:key inputs outputs #:allow-other-keys) + (let* ((out (assoc-ref outputs "out")) + (clang-toolchain (assoc-ref inputs "clang-toolchain")) + (gtk+ (assoc-ref inputs "gtk+")) + (mesa (assoc-ref inputs "mesa")) + (nss (assoc-ref inputs "nss")) + (udev (assoc-ref inputs "udev")) + (gn-flags + (list + ;; See tools/gn/docs/cookbook.md and + ;; https://www.chromium.org/developers/gn-build-conf= iguration + ;; for usage. Run "./gn args . --list" in the Relea= se + ;; directory for an exhaustive list of supported fla= gs. + "is_debug=3Dfalse" + "use_gold=3Dfalse" + "use_lld=3Dfalse" + "linux_use_bundled_binutils=3Dfalse" + "use_custom_libcxx=3Dfalse" + "use_sysroot=3Dfalse" + "enable_precompiled_headers=3Dfalse" + "goma_dir=3D\"\"" + "enable_nacl=3Dfalse" + "enable_nacl_nonsfi=3Dfalse" + "use_allocator=3D\"none\"" ;don't use tcmalloc + "override_build_date=3D\"01 01 2000 05:00:00\"" + "use_unofficial_version_number=3Dfalse" + + ;; GCC is poorly supported, so we use Clang for now. + (string-append "clang_base_path=3D\"" clang-toolchai= n "\"") + "clang_use_chrome_plugins=3Dfalse" + + ;; Optimize for building everything at once, as oppo= sed + ;; to incrementally for development. See "docs/jumb= o.md". + "use_jumbo_build=3Dtrue" + ;; Disable debugging features to save space. + "symbol_level=3D1" + "remove_webcore_debug_symbols=3Dtrue" + "enable_iterator_debugging=3Dfalse" + ;; Some of the unbundled libraries throws deprecation + ;; warnings, etc. Ignore it. + "treat_warnings_as_errors=3Dfalse" + ;; Don't add any API keys. End users can set them i= n the + ;; environment if desired. See + ;; . + "use_official_google_api_keys=3Dfalse" + ;; Disable "field trials". + "fieldtrial_testing_like_official_build=3Dtrue" + ;; Disable Chrome Remote Desktop (aka Chromoting). + "enable_remoting=3Dfalse" + + "use_system_freetype=3Dtrue" + "use_system_lcms2=3Dtrue" + "use_system_libjpeg=3Dtrue" + "use_system_libpng=3Dtrue" + "use_system_zlib=3Dtrue" + ;; This is currently not supported on GNU/Linux: + ;; https://bugs.chromium.org/p/chromium/issues/detai= l?id=3D22208 + ;;"use_system_sqlite=3Dtrue" + + "use_gnome_keyring=3Dfalse" ;deprecated by libsecret + "use_gtk3=3Dtrue" + "use_openh264=3Dtrue" + "use_xkbcommon=3Dtrue" + "use_pulseaudio=3Dtrue" + "link_pulseaudio=3Dtrue" + + ;; Don't arbitrarily restrict formats supported by s= ystem ffmpeg. + "proprietary_codecs=3Dtrue" + "ffmpeg_branding=3D\"Chrome\"" + + ;; WebRTC stuff. + "rtc_use_h264=3Dtrue" + ;; Don't use bundled sources. + "rtc_build_json=3Dfalse" + "rtc_build_libevent=3Dfalse" + "rtc_build_libvpx=3Dfalse" + "rtc_build_opus=3Dfalse" + "rtc_build_ssl=3Dfalse" + ;; TODO: Package these. + "rtc_build_libsrtp=3Dtrue" ;2.0 + "rtc_build_openmax_dl=3Dtrue" + "rtc_build_usrsctp=3Dtrue" + (string-append "rtc_jsoncpp_root=3D\"" + (assoc-ref inputs "jsoncpp") + "/include/jsoncpp/json\"") + (string-append "rtc_ssl_root=3D\"" + (assoc-ref inputs "openssl") + "/include/openssl\"")))) + + ;; XXX: How portable is this. + (mkdir-p "third_party/node/linux/node-linux-x64") + (symlink (string-append (assoc-ref inputs "node") "/bin") + "third_party/node/linux/node-linux-x64/bin") + + (setenv "CC" "clang") + (setenv "CXX" "clang++") + + ;; FIXME: This nasty hack works around a problem where + ;; Clang does not add the arch triplet to the libtsdc++ + ;; search path. Fixing it seems tricky, since it only + ;; searches "include/" when it detects libstdc++ + ;; in GCC which is not the case in Guix; the only reason + ;; libstdc++ works here is because it's already on the + ;; include path... + (setenv "CPLUS_INCLUDE_PATH" + (string-append (getenv "CPLUS_INCLUDE_PATH") + ":" clang-toolchain + "/include/x86_64-unknown-linux-gnu")) + + ;; TODO: pre-compile instead. Avoids a race condition. + (setenv "PYTHONDONTWRITEBYTECODE" "1") + (and + ;; Build the "gn" tool. + (invoke "python" + "tools/gn/bootstrap/bootstrap.py" "-s" "-v") + ;; Generate ninja build files. + (invoke "./out/Release/gn" "gen" "out/Release" + (string-append "--args=3D" + (string-join gn-flags " "))))))) + (replace 'build + (lambda* (#:key outputs #:allow-other-keys) + (invoke "ninja" "-C" "out/Release" + "-j" (number->string (parallel-job-count)) + "chrome"))) + (replace 'install + (lambda* (#:key inputs outputs #:allow-other-keys) + (let* ((out (assoc-ref outputs "out")) + (bin (string-append out "/bin")) + (exe (string-append bin "/chromium")) + (lib (string-append out "/lib")) + (man (string-append out "/share/man/man1")) + (applications (string-append out "/share/application= s")) + (install-regexp (make-regexp "\\.(bin|pak)$")) + (locales (string-append lib "/locales")) + (resources (string-append lib "/resources")) + (gtk+ (assoc-ref inputs "gtk+")) + (mesa (assoc-ref inputs "mesa")) + (nss (assoc-ref inputs "nss")) + (udev (assoc-ref inputs "udev")) + (sh (which "sh"))) + + (substitute* '("chrome/app/resources/manpage.1.in" + "chrome/installer/linux/common/desktop.templ= ate") + (("@@MENUNAME@@") "Chromium") + (("@@PACKAGE@@") "chromium") + (("/usr/bin/@@USR_BIN_SYMLINK_NAME@@") exe)) + (mkdir-p man) + (copy-file "chrome/app/resources/manpage.1.in" + (string-append man "/chromium.1")) + (mkdir-p applications) + (copy-file "chrome/installer/linux/common/desktop.template" + (string-append applications "/chromium.desktop")) + + (with-directory-excursion "out/Release" + (for-each (lambda (file) + (install-file file lib)) + (scandir "." (cut regexp-exec install-regexp <>= ))) + (copy-file "chrome" (string-append lib "/chromium")) + + ;; TODO: Install icons from "../../chrome/app/themes" into + ;; "out/share/icons/hicolor/$size". + (install-file + "product_logo_48.png" + (string-append out "/share/icons/48x48/chromium.png")) + + (copy-recursively "locales" locales) + (copy-recursively "resources" resources) + + (mkdir-p bin) + ;; Add a thin wrapper to prevent the user from inadverten= tly + ;; installing non-free software through the Web Store. + ;; TODO: Discover extensions from the profile and pass + ;; something like "--disable-extensions-except=3D...". + (call-with-output-file exe + (lambda (port) + (format port + "#!~a~@ + if [ -z \"$CHROMIUM_ENABLE_WEB_STORE\" ]~@ + then~@ + CHROMIUM_FLAGS=3D\" \\~@ + --disable-background-networking \\~@ + --disable-extensions \\~@ + \"~@ + fi~@ + exec ~a $CHROMIUM_FLAGS \"$@\"~%" + sh (string-append lib "/chromium")))) + (chmod exe #o755) + + (wrap-program exe + ;; TODO: Get these in RUNPATH. + `("LD_LIBRARY_PATH" ":" prefix + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib:" + mesa "/lib:" udev "/lib"))) + ;; Avoid file manager crash. See . + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/sh= are")))) + #t))))))) + (native-inputs + `(("bison" ,bison) + ("clang-toolchain" ,chromium-clang-toolchain) + ("git" ,git) ;last_commit_position.py + ("gperf" ,gperf) + ("ninja" ,ninja) + ("node" ,node) + ("pkg-config" ,pkg-config) + ("which" ,which) + ("yasm" ,yasm) + + ("python-beautifulsoup4" ,python2-beautifulsoup4) + ("python-html5lib" ,python2-html5lib) + ("python" ,python-2))) + (inputs + `(("alsa-lib" ,alsa-lib) + ("atk" ,atk) + ("cups" ,cups) + ("curl" ,curl) + ("dbus" ,dbus) + ("dbus-glib" ,dbus-glib) + ("expat" ,expat) + ("flac" ,flac) + ("ffmpeg" ,ffmpeg) + ("fontconfig" ,fontconfig) + ("freetype" ,freetype) + ("gdk-pixbuf" ,gdk-pixbuf) + ("glib" ,glib) + ("gtk+-2" ,gtk+-2) + ("gtk+" ,gtk+) + ("harfbuzz" ,harfbuzz) + ("icu4c" ,icu4c) + ("jsoncpp" ,jsoncpp) + ("lcms" ,lcms) + ("libevent" ,libevent) + ("libffi" ,libffi) + ("libjpeg-turbo" ,libjpeg-turbo) + ("libpng" ,libpng) + ("libusb" ,libusb) + ("libvpx" ,libvpx+experimental) + ("libwebp" ,libwebp) + ("libx11" ,libx11) + ("libxcb" ,libxcb) + ("libxcomposite" ,libxcomposite) + ("libxcursor" ,libxcursor) + ("libxdamage" ,libxdamage) + ("libxext" ,libxext) + ("libxfixes" ,libxfixes) + ("libxi" ,libxi) + ("libxkbcommon" ,libxkbcommon) + ("libxml2" ,libxml2) + ("libxrandr" ,libxrandr) + ("libxrender" ,libxrender) + ("libxscrnsaver" ,libxscrnsaver) + ("libxslt" ,libxslt) + ("libxtst" ,libxtst) + ("mesa" ,mesa) + ("minizip" ,minizip) + ("mit-krb5" ,mit-krb5) + ("nss" ,nss) + ("openh264" ,openh264) + ("openssl" ,openssl) + ("opus" ,opus+custom) + ("pango" ,pango) + ("pciutils" ,pciutils) + ("protobuf" ,protobuf) + ("pulseaudio" ,pulseaudio) + ("re2" ,re2) + ("snappy" ,snappy) + ("speech-dispatcher" ,speech-dispatcher) + ("sqlite" ,sqlite) + ("udev" ,eudev) + ("valgrind" ,valgrind))) + (home-page "https://www.chromium.org/") + (description + "Chromium is a web browser designed for speed and security. This +version incorporates patches from +@url{https://github.com/gcarq/inox-patchset,Inox} and +@url{https://www.debian.org/,Debian} in order to protect the users privacy= .") + ;; Chromium is developed as BSD-3, but bundles a large number of third= -party + ;; components with other licenses. For full information, see chrome:/= /credits. + (license (list license:bsd-3 + license:bsd-2 + license:expat + license:asl2.0 + license:mpl2.0 + license:public-domain + license:lgpl2.1+)))) diff --git a/gnu/packages/patches/chromium-glibc-compat.patch b/gnu/package= s/patches/chromium-glibc-compat.patch new file mode 100644 index 000000000..720adbeef =2D-- /dev/null +++ b/gnu/packages/patches/chromium-glibc-compat.patch @@ -0,0 +1,38 @@ +Upstream-Status: Backport + +Signed-off-by: Raphael Kubo da Costa +--- +From 9f63f94a11abc34d40ede8b8712fa15b5844a8c0 Mon Sep 17 00:00:00 2001 +From: Tom Anderson +Date: Sat, 27 Jan 2018 20:03:37 +0000 +Subject: [PATCH] Fix build with glibc 2.27 + +BUG=3D806340 +TBR=3Dhamelphi@chromium.org + +Change-Id: Ib4e5091212d874d9ad88f3e9a1fdfee3ed7e0d5e +Reviewed-on: https://chromium-review.googlesource.com/890059 +Reviewed-by: Thomas Anderson +Reviewed-by: Philippe Hamel +Commit-Queue: Thomas Anderson +Cr-Commit-Position: refs/heads/master@{#532249} +--- + components/assist_ranker/ranker_example_util.cc | 2 ++ + 1 file changed, 2 insertions(+) + +diff --git a/components/assist_ranker/ranker_example_util.cc b/components/= assist_ranker/ranker_example_util.cc +index 54d4dbd58f7d..ceedd8f9b18d 100644 +--- a/components/assist_ranker/ranker_example_util.cc ++++ b/components/assist_ranker/ranker_example_util.cc +@@ -2,6 +2,8 @@ + // Use of this source code is governed by a BSD-style license that can be + // found in the LICENSE file. +=20 ++#include ++ + #include "components/assist_ranker/ranker_example_util.h" + #include "base/bit_cast.h" + #include "base/format_macros.h" +--=20 +2.14.3 + diff --git a/gnu/packages/patches/chromium-remove-default-history.patch b/g= nu/packages/patches/chromium-remove-default-history.patch new file mode 100644 index 000000000..38be10820 =2D-- /dev/null +++ b/gnu/packages/patches/chromium-remove-default-history.patch @@ -0,0 +1,13 @@ +Don't pre-populate the New Tab Page for new profiles. + +--- a/chrome/browser/history/top_sites_factory.cc ++++ b/chrome/browser/history/top_sites_factory.cc +@@ -74,7 +74,7 @@ +=20 + void InitializePrepopulatedPageList( + history::PrepopulatedPageList* prepopulated_pages) { +-#if !defined(OS_ANDROID) ++#if false + DCHECK(prepopulated_pages); + prepopulated_pages->reserve(arraysize(kRawPrepopulatedPages)); + for (size_t i =3D 0; i < arraysize(kRawPrepopulatedPages); ++i) { =2D-=20 2.17.0 --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlrRALkACgkQoqBt8qM6 VPos9AgAsv1OBxLJCbBTyGUj+KeoliQrfjD68RN6kppnZSsAIWXR/PMZRdrydXGo TuBcigQdgRt/DNVS0p9MR3aJ01kFwZVZMSWLNNK+OTIOf+m9cuYcsFPP5RGfUEMc C7o8zHaBVH6V2j1o+rqAi7D8vKNrIDxmEBHjFgY+hn6yrSP7T1Rrv10wq0471ROF 8ybupERXIN0rvj9OCIqXpOhw+fN+nXKnaear2M7vidGumVvqhU544utWJVPZCNYX 4buP5dsEwzlu9qWz8A2ZXRnJFAY9QeUeCGtbcWpom3A+wfwtUVCIa+1cITQpTrHA 7Y8Z1+tbz7f+aaNAevzan5IG4EkOdQ== =eFI1 -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Tue Apr 17 15:10:28 2018 Received: (at 28004) by debbugs.gnu.org; 17 Apr 2018 19:10:28 +0000 Received: from localhost ([127.0.0.1]:57867 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1f8Vzo-0003L7-35 for submit@debbugs.gnu.org; Tue, 17 Apr 2018 15:10:28 -0400 Received: from mail-lf0-f54.google.com ([209.85.215.54]:43204) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1f8Vzl-0003Kt-6E for 28004@debbugs.gnu.org; Tue, 17 Apr 2018 15:10:27 -0400 Received: by mail-lf0-f54.google.com with SMTP id v207-v6so28931855lfa.10 for <28004@debbugs.gnu.org>; Tue, 17 Apr 2018 12:10:25 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:to:cc:subject:references:date:in-reply-to:message-id :user-agent:mime-version; bh=dsdpfiokvhezX1E4WmChcyWycUQxJ9y3YIfyS4HnT7Q=; b=fhDQFRSZUK2+kI9orNvjHrzRHZx7KOFa2eGF+4bgdBBtAKfbmAyt26fTLpmxmpXP4U geT9vjSo9gD3AfanSTUw0DZKSLoHcUMQ15rV7UJS42uYf7wPBEovYoAUJSt56fmftyFN ehUZeFIAMQjeohiPyXI5dUmAej0LWRAfFugr5qxsWUT1jZuaCeF4qoSqheFH8JT7/rMm 2gCAGYGEt4+89RUtECBgN25zU+jz2eOQP+67gYVUVqCFChCEB8G2xTYc2ieF6ItUvTQW 9PU3anEw7HnFmAg5RsTi/w61QeeNJAfT9AzttLYjOZzbZIzr4B9kU06qOzwsM+fY+A6w XzHA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:to:cc:subject:references:date:in-reply-to :message-id:user-agent:mime-version; bh=dsdpfiokvhezX1E4WmChcyWycUQxJ9y3YIfyS4HnT7Q=; b=tiQbX7Svg5VuCR5dPv1Q/F5OpJqtdraoV2ud95uJwSd1EapOUOoZXYNziPvmIRiPKx KEJeknMoqaIMqcNnUA9ikh3NWfPwoGfXC/4td2tmB7cB5k+wLbC/cj/1o5NI7rEpsUna GZo4IYyhJM6Kq1LlCKG1lpXnvPYFmFCwnKZ0UfB830AuyG1pBof2bI5AQ3humTCIMEym KBGnO4SUIFp8c4SeY4Ogss0i96UBeBgMy6yLLSx5DZwWapyjupKyQRDLnMmxaaSJgW4D XsvAElX8E/6M8//Gklr1xQDDRDSI9tWyUDdqpzRkRDEbHzKfya9jmkrEC9RGPvb64hKe 3zYw== X-Gm-Message-State: ALQs6tDBojNTrLZfJmjPayOH/rr8pqIbT3ILq/BkxE1tiOhh6DD48jRf ZhNw0SpIF/ETBr5QRBSua9mkTA== X-Google-Smtp-Source: AIpwx4/OES8yvalz+3/s/sLBBVErh+3tMvMJjqEMI6ajwM6f9O3QSUj8fZIKS5S78dz0QXjrN/MyOw== X-Received: by 2002:a19:a8d4:: with SMTP id r203-v6mr2516456lfe.146.1523992218837; Tue, 17 Apr 2018 12:10:18 -0700 (PDT) Received: from magnolia (ppp78-37-131-191.pppoe.avangarddsl.ru. [78.37.131.191]) by smtp.gmail.com with ESMTPSA id p9-v6sm3520530lfh.93.2018.04.17.12.10.17 (version=TLS1_2 cipher=ECDHE-RSA-CHACHA20-POLY1305 bits=256/256); Tue, 17 Apr 2018 12:10:18 -0700 (PDT) From: Oleg Pykhalov To: Marius Bakke Subject: Re: [bug#28004] Chromium 65 References: <87y3qvb15k.fsf@fastmail.com> <87po32c47b.fsf@fastmail.com> Date: Tue, 17 Apr 2018 22:10:10 +0300 In-Reply-To: <87po32c47b.fsf@fastmail.com> (Marius Bakke's message of "Fri, 13 Apr 2018 21:10:48 +0200") Message-ID: <877ep5myy5.fsf@gmail.com> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/25.3 (gnu/linux) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Hello Marius, First of all, thank you for working on this! Marius Bakke writes: > Attached is a patch for Chromium 65. I've built it successfully. Thank you for such a hard work! I build =E2=80=98chromium=E2=80=99 from my first day of using GuixSD (about= one year). Because of I cannot build it constantly, I always use out of date =E2=80=98chromium=E2=80=99 closure. It's more worse for privacy and securi= ty than unchecked new =E2=80=98chromium=E2=80=99 version in my case (I guess). Could we have it pushed to =E2=80=98origin/master=E2=80=99 for people like = me? :-) Thanks, Oleg. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAEBCgAdFiEEc+OyAXw1EaDPCmAPckbhHGm3lWkFAlrWRpIACgkQckbhHGm3 lWlZ5Q//S8RY1KguODn0MCqqmSF6LqIPT9x6loeetkM96cavvb2E/9RUXZZ0y1jN qFkoveGlyc5xV6zxze8LRmOdgc6bMyMfvbWZfoIlrd/93EjbYZl49UggTKFnj4/F k5y/Gl6mxEbZaNBgxOdBeYMU11Vql70+YR1id1U+QBXgsjwLjjBQNTU2FmqX8JDR oHvP9VeBoX/l3/EcqiHZDHdP8uegwYrQQIvnwchMR4zupBWwTi2hnGjnLN1rEWxY MDRZ14t2oRh/g9krj+Vm5le4VsXwmjhoh86F6kvnDye+4uWn7IZyfJoVNsTEkITF 7J1Q9sIvvjtOoyCVbpLssjYbnFrB2NONiAQs9P8AbfXJlPldPO5HlvV0E0bGadCm U2HvVVLOgxS3CABgpKHfpc8NdCzC3mTRpFhZfq0fS+gGdne9JXKubhGs6AIbsbnG Pmn8UUVQbMH4YW38NRMWnifSW6xYdmgxAkoFssdawZ+u4enf3n07wdIg7y+ZIa/v rRiAMj0tT+QxKe42mCpXuo87g6Zff4pm9KjoWLbSPhgZ365N66druRziFGLXN93d HmU76qAij7AG/PFVZynGPjZW9tAZnLarG4yYMGQK3m7zRZC3r3QaLhuLy1J+zZFV /FSgph6Cas/nanzVKWCYXpFqi4ynRccRv4G6ERsh3LDBm8ICkWI= =VX0B -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Tue Apr 24 13:05:54 2018 Received: (at 28004) by debbugs.gnu.org; 24 Apr 2018 17:05:54 +0000 Received: from localhost ([127.0.0.1]:38386 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fB1O6-000594-9z for submit@debbugs.gnu.org; Tue, 24 Apr 2018 13:05:54 -0400 Received: from dustycloud.org ([50.116.34.160]:53430) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fB1O4-00058w-Gh for 28004@debbugs.gnu.org; Tue, 24 Apr 2018 13:05:52 -0400 Received: from oolong (localhost [127.0.0.1]) by dustycloud.org (Postfix) with ESMTPS id B8B98266AB; Tue, 24 Apr 2018 13:05:51 -0400 (EDT) References: <87y3qvb15k.fsf@fastmail.com> <87po32c47b.fsf@fastmail.com> User-agent: mu4e 1.0; emacs 25.3.1 From: Christopher Lemmer Webber To: Marius Bakke Subject: Re: [bug#28004] Chromium 65 In-reply-to: <87po32c47b.fsf@fastmail.com> Date: Tue, 24 Apr 2018 12:05:39 -0500 Message-ID: <87po2own4s.fsf@dustycloud.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hello! I'd like to speak up in favor of getting Chromium merged into Guix master. As a web developer, sometimes I have to test things against multiple browsers. Having Chromium in GuixSD would help me out a lot. It looks like a mountain of hard work has been put into this. Could we get it merged rather than have that work languish? From debbugs-submit-bounces@debbugs.gnu.org Tue Apr 24 14:09:08 2018 Received: (at 28004) by debbugs.gnu.org; 24 Apr 2018 18:09:09 +0000 Received: from localhost ([127.0.0.1]:38406 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fB2NB-0006c4-A2 for submit@debbugs.gnu.org; Tue, 24 Apr 2018 14:09:08 -0400 Received: from out3-smtp.messagingengine.com ([66.111.4.27]:35269) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fB2N4-0006bp-E6 for 28004@debbugs.gnu.org; Tue, 24 Apr 2018 14:08:59 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 47B7B217A8; Tue, 24 Apr 2018 14:08:54 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Tue, 24 Apr 2018 14:08:54 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; bh=8AxvMnFya43mxg957Ir5yGH3qqr7reuNKcduR7C56Yo=; b=HJlDOouO KSQt2ajo1qme4WwMWyBWdkKnbhaFGSC2wvHP7Si2X7TeuQKyo8mKrYF0qXYSyUM6 9nkpUW2z4nEFt97LWv4pJR2rRiPnR22w+UzE0VW8s38Dp99P5COhStortz1HI02E 4tB12zO+lbLrozVDlm7knw8QW8eEnqG2gLupeXztSkvyZUNObmhZdgv43SQQiv/A MC64qPF5H0pXTTN7oG5gOvOmZfSHzZYEFRZCXJKswWRXOY2K/lEuOq/6zwJPDxXO iDJJxBrP6AyJZjekA5fUP9G4BJmfrZsPFuvCQTxsqN0XbXHjkORFf99eSEPzVe53 /0tVAoQaRU+eCQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm2; bh=8AxvMnFya43mxg957Ir5yGH3qqr7r euNKcduR7C56Yo=; b=S0g7Zi6wD9J705neF2ChXjVAyslBJnVqvH8CdsaGU6kEm CLmejgCMmQ4X3QpMuCko34Hi2U7SP77aW4/InlwwSgiWmQQofgBOJmui3mnfB+6A pbnG0J2ud3g19h2/mWF8DFTnR3hNS3Cucg2AKOhZMTXM0V0VXCsAz+HdKB+uqQ1G KWYYpsM3eTcG4pGD+qo3SAjTHi+/lRO3x8a0igm0o7hwinjmznNUXFPzFhQ/5rdx aREGx7jYd+Il4npQrk6Bei14sBgMvn0iYb12X9E+6we814qTxhLzNjWIi2t0N953 4yYrRqOQguAS8wiCqabbqsaiQJjfBRYw4NsNnvkzg== X-ME-Sender: Received: from localhost (228.92-221-162.customer.lyse.net [92.221.162.228]) by mail.messagingengine.com (Postfix) with ESMTPA id 4FA9710256; Tue, 24 Apr 2018 14:08:53 -0400 (EDT) From: Marius Bakke To: Christopher Lemmer Webber Subject: Chromium 66 + status update In-Reply-To: <87po2own4s.fsf@dustycloud.org> References: <87y3qvb15k.fsf@fastmail.com> <87po32c47b.fsf@fastmail.com> <87po2own4s.fsf@dustycloud.org> User-Agent: Notmuch/0.26.1 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Tue, 24 Apr 2018 20:08:51 +0200 Message-ID: <87woww8ojw.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain Christopher Lemmer Webber writes: > Hello! I'd like to speak up in favor of getting Chromium merged into > Guix master. As a web developer, sometimes I have to test things > against multiple browsers. Having Chromium in GuixSD would help me out > a lot. > > It looks like a mountain of hard work has been put into this. Could we > get it merged rather than have that work languish? Hello! I use this browser a lot, so it's hardly languishing. There was a recent discussion[0] about the Pale Moon browser, where it was pointed out that the FSDG[1] requires that any third-party repositories must be committed to only free software. [0] https://lists.gnu.org/archive/html/guix-devel/2018-03/msg00319.html [1] https://www.gnu.org/distros/free-system-distribution-guidelines.html#license-rules Unfortunately there are UI links to the Chrome "Web Store" still. It's not possible to install from it without setting the CHROMIUM_ENABLE_WEB_STORE variable, but I'm not sure if that is sufficient. It's unfortunate if an unsuspecting user stumbles into the Web Store and tries to install something (free or not) and only then finds out that it does not work. The other remaining issue is that some data is sent to Google whenever you start the browser for the first time. I don't think that's a blocker, but it's certainly something we should aim to fix. Attached are updates for 66. The first is an interdiff from the previous 65 patch; the other is the full "squashed" patch for convenience. New in this version: * The snippet will now error if a preserved directory is not present. * Chromium again requires a git revision of libvpx. * The "safe browsing" feature requires the nonfree "unrar" program(!!), as such it has been compiled out. Luckily "Inox" already had a patch to make the thing actually build with that flag disabled. * Cosmetic rearrangement of patches to follow Debian and Inox patch order. --=-=-= Content-Type: text/x-patch Content-Disposition: inline; filename=0001-Chromium-66-update.patch Content-Transfer-Encoding: quoted-printable From=20a6ce5ebc121f129c3097f1f105b6a4de925b43e9 Mon Sep 17 00:00:00 2001 From: Marius Bakke Date: Tue, 17 Apr 2018 03:54:56 +0200 Subject: [PATCH] Chromium 66 update. =2D-- gnu/local.mk | 1 - gnu/packages/chromium.scm | 173 ++++++++++++------ .../patches/chromium-glibc-compat.patch | 38 ---- 3 files changed, 115 insertions(+), 97 deletions(-) delete mode 100644 gnu/packages/patches/chromium-glibc-compat.patch diff --git a/gnu/local.mk b/gnu/local.mk index fdb15a074..0bc3220f8 100644 =2D-- a/gnu/local.mk +++ b/gnu/local.mk @@ -592,7 +592,6 @@ dist_patch_DATA =3D \ %D%/packages/patches/ceph-skip-collect-sys-info-test.patch \ %D%/packages/patches/ceph-skip-unittest_blockdev.patch \ %D%/packages/patches/chmlib-inttypes.patch \ =2D %D%/packages/patches/chromium-glibc-compat.patch \ %D%/packages/patches/chromium-remove-default-history.patch \ %D%/packages/patches/clang-3.5-libc-search-path.patch \ %D%/packages/patches/clang-3.8-libc-search-path.patch \ diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm index cecbab7a1..a6f9fec0f 100644 =2D-- a/gnu/packages/chromium.scm +++ b/gnu/packages/chromium.scm @@ -122,63 +122,89 @@ (sha256 (base32 hash)) (file-name (chromium-patch-file-name pathspec)))) =20 =2D;; Fix an assignment bug when using Clang and libstdc++. =2D(define %chromium-clang-assignment.patch =2D (gentoo-patch "chromium-clang-r3.patch" =2D "804a0d7244a06736d01c353b45c20daf324f0722" =2D "1d10il3mjzyzwgqi8iifw3aw9jnbqfrzz8v1x7cmvqpwjkykwk2a")) =2D =2D;; Add missing stdint include. =2D(define %chromium-add-missing-stdint.patch =2D (gentoo-patch "chromium-stdint.patch" =2D "804a0d7244a06736d01c353b45c20daf324f0722" =2D "03r16zqi0hm3i00b9bwq2bdn2sp731rllizcxfl3i2q7y432a3f0")) +(define %debian-revision "debian/66.0.3359.26-1") +(define %gentoo-revision "599be358f257098e7ba29196f6fce498b0a8d208") +(define %inox-revision "365a106e298e04b4a7063559b7a0ee16888b928f") =20 +;; Use system NSPR. (define %chromium-system-nspr.patch (debian-patch "system/nspr.patch" =2D "debian/65.0.3325.146-4" =2D "1ggdrlz94d75ni21rx6ivvajjwhx7zwnl3s5aapysqn9kls4qsr2")) + %debian-revision + "0x54c8zhwjldlnx4754aaq0xyb24spqia3fgn94kcf686wp61srz")) =20 +;; And system libevent. (define %chromium-system-libevent.patch (debian-patch "system/event.patch" =2D "debian/65.0.3325.146-4" =2D "1k3zc59vpwc8rzbknxryjzzy99jk666whdablzcvxnyzaqk38kfx")) + %debian-revision + "18ka0zmfd6g5yxhknh6x94bfm643v1kgczzag5sfndizsaaxrlpc")) =20 =2D(define %chromium-system-icu.patch =2D (debian-patch "system/icu.patch" =2D "debian/65.0.3325.146-4" =2D "19wclidx1kyjbi3b3hnmkjs0h34d67p4dp6a48vbjbx9rxmfdk3b")) +;; Avoid dependency on Chromiums embedded libc++ library for GN. +(define %chromium-gn-libcxx.patch + (debian-patch "gn/libcxx.patch" + %debian-revision + "14rx16abxv0pz4qyp194cy999z3390hxi80rdbjs3v2lwscx36cl")) =20 ;; Don't show a warning about missing API keys. (define %chromium-disable-api-keys-warning.patch (debian-patch "disable/google-api-warning.patch" =2D "debian/65.0.3325.146-4" =2D "1g5yk51bl7svrqx8wjxsgpz545mnymnpi3bsa62kwdm4qd8bx10x")) + %debian-revision + "1qf2y7jmaya43k9rbsxjjpkp5manzmbkhjj5hvfyqcdylhy30swj")) =20 =2D;; Add DuckDuckGo and set it as the default search engine. =2D(define %chromium-duckduckgo.patch =2D (inox-patch "0011-add-duckduckgo-search-engine.patch" =2D "0c55cc9a81634244ad13fbbd6b5c5098b9132162" =2D "0mvw1ax0gw3d252c9b1pwbk0j7ny8z9nsfywcmhj56wm6yksgpkg")) +;; Some files were missing in the Chromium 66 release tarball. +;; See . +(define %chromium-add-blink-tools.patch + (origin + (method url-fetch) + (uri (string-append "https://bazaar.launchpad.net/~chromium-team" + "/chromium-browser/bionic-stable/download/head:" + "/addmissingblinktools-20180416203514-02f50sz15c2m= n6ei-1" + "/add-missing-blink-tools.patch")) + (sha256 + (base32 + "1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s")))) =20 =2D;; Don't start a "Login Wizard" at first launch. =2D(define %chromium-first-run.patch =2D (inox-patch "0018-disable-first-run-behaviour.patch" =2D "0c55cc9a81634244ad13fbbd6b5c5098b9132162" =2D "1y4zsqqf2125jkb1phwy9g5hcbd9xhyv5lr4xcaly66rpdzx2ayb")) +;; Fix an assignment bug when using Clang and libstdc++. +(define %chromium-clang-assignment.patch + (gentoo-patch "chromium-clang-r4.patch" + %gentoo-revision + "0ip3pzk9is6n7icpml33ryysiq4cfrx8jlr0jkjgdg6mvl8pli3i")) + +;; Fix error detecting system ffmpeg. +(define %chromium-ffmpeg.patch + (gentoo-patch "chromium-ffmpeg-r1.patch" + %gentoo-revision + "1pivcdmana4qx8sngcdpr858l0qh6bygv7azj66vg021phq5725a")) + +;; Fix build failure when built with "safe_browsing_mode=3D0". +(define %chromium-build-without-safebrowsing.patch + (inox-patch "0001-fix-building-without-safebrowsing.patch" + %inox-revision + "0r1as6vmc6bbc7i54cxbmbm6rrwj33a12hfz6rzj0yxyqnnps00f")) =20 ;; Use privacy-preserving defaults. (define %chromium-default-preferences.patch (inox-patch "0006-modify-default-prefs.patch" =2D "0c55cc9a81634244ad13fbbd6b5c5098b9132162" =2D "0zyshpl1hjssqrfhdfbgxdib4smdszjgf0ac98l978hrn9gwwk03")) + %inox-revision + "1ncjij9sib7fliafpv37j1zf8zz5hvyxqad669vvadg7vvwr9rza")) =20 ;; Recent versions of Chromium may load a remote search engine on the ;; New Tab Page, causing unnecessary and involuntary network traffic. (define %chromium-restore-classic-ntp.patch (inox-patch "0008-restore-classic-ntp.patch" =2D "0c55cc9a81634244ad13fbbd6b5c5098b9132162" =2D "1h698cbp97g8lgmndfy6kswgwfvss7c3k609xgvyxbfldkzy7pd5")) + %inox-revision + "1jl978qas2ry9lnq6x42xl4qa6arxxj9a37k9j2wclz2pin8cmzn")) + +;; Add DuckDuckGo and set it as the default search engine. +(define %chromium-duckduckgo.patch + (inox-patch "0011-add-duckduckgo-search-engine.patch" + %inox-revision + "0mvw1ax0gw3d252c9b1pwbk0j7ny8z9nsfywcmhj56wm6yksgpkg")) + +;; Don't start a "Login Wizard" at first launch. +(define %chromium-first-run.patch + (inox-patch "0018-disable-first-run-behaviour.patch" + %inox-revision + "1y4zsqqf2125jkb1phwy9g5hcbd9xhyv5lr4xcaly66rpdzx2ayb")) =20 (define opus+custom (package (inherit opus) @@ -194,6 +220,17 @@ =20 (define libvpx+experimental (package (inherit libvpx) + ;; XXX: Chromium 66 relies on unreleased libvpx features. + ;; The commit below is the tip of the "m66-3359" branch + ;; as of 2018-04-19. + (source (origin + (method git-fetch) + (uri (git-reference + (url "https://chromium.googlesource.com/webm/li= bvpx") + (commit "e9fff8a9dbcd03fbf3e5b7caaa9dc2631a7988= 2a"))) + (sha256 + (base32 + "1b1d89dlbr8ydakvp82cg6xnlnkz5hj7679f4pgxwlgd6x46f4= g2")))) (name "libvpx+experimental") (arguments (substitute-keyword-arguments (package-arguments libvpx) @@ -305,7 +342,7 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libra= ry, and Binutils.") (define-public chromium (package (name "chromium") =2D (version "65.0.3325.181") + (version "66.0.3359.117") (synopsis "Graphical web browser") (source (origin (method url-fetch) @@ -314,19 +351,22 @@ includes Clang, the Guix ld wrapper, glibc, a C++ lib= rary, and Binutils.") version ".tar.xz")) (sha256 (base32 =2D "11w6wg862ixbgm7dpqag2lmbjknv83zlr9imd8zchvmrqr468rlk")) =2D (patches (list %chromium-duckduckgo.patch =2D %chromium-default-preferences.patch =2D %chromium-first-run.patch =2D %chromium-restore-classic-ntp.patch =2D =2D %chromium-clang-assignment.patch =2D %chromium-add-missing-stdint.patch =2D %chromium-system-icu.patch + "1mlfavs0m0lf60s42krqxqiyx73hdfd4r1mkjwv31p2gchsa7ibp")) + (patches (list %chromium-gn-libcxx.patch + %chromium-disable-api-keys-warning.patch %chromium-system-nspr.patch %chromium-system-libevent.patch =2D %chromium-disable-api-keys-warning.patch =2D (search-patch "chromium-glibc-compat.patch") + + %chromium-add-blink-tools.patch + + %chromium-clang-assignment.patch + %chromium-ffmpeg.patch + + %chromium-build-without-safebrowsing.patch + %chromium-default-preferences.patch + %chromium-restore-classic-ntp.patch + %chromium-duckduckgo.patch + %chromium-first-run.patch (search-patch "chromium-remove-default-histor= y.patch"))) (modules '((srfi srfi-1) (srfi srfi-26) @@ -351,7 +391,6 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libra= ry, and Binutils.") "base/third_party/symbolize" ;glog "base/third_party/xdg_mime" "base/third_party/xdg_user_dirs" =2D "buildtools/third_party/libc++" "chrome/third_party/mozilla_security_manager" "courgette/third_party" "net/third_party/mozilla_security_manager" @@ -367,6 +406,10 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libr= ary, and Binutils.") "third_party/angle/src/third_party/compiler" "third_party/angle/src/third_party/libXNVCtrl" "third_party/angle/src/third_party/trace_event" + "third_party/angle/third_party/glslang" + "third_party/angle/third_party/spirv-headers" + "third_party/angle/third_party/spirv-tools" + "third_party/angle/third_party/vulkan-validatio= n-layers" "third_party/blink" "third_party/boringssl" "third_party/boringssl/src/third_party/fiat" @@ -406,6 +449,8 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libra= ry, and Binutils.") "third_party/leveldatabase" "third_party/libXNVCtrl" "third_party/libaddressinput" + "third_party/libaom" + "third_party/libaom/source/libaom/third_party/x= 86inc/x86inc.asm" "third_party/libjingle_xmpp" "third_party/libphonenumber" "third_party/libsecret" ;FIXME: needs pkg-confi= g support. @@ -420,7 +465,6 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libra= ry, and Binutils.") "third_party/mesa" "third_party/metrics_proto" "third_party/modp_b64" =2D "third_party/mt19937ar" "third_party/node" (string-append "third_party/node/node_modules/" "polymer-bundler/lib/third_party= /UglifyJS2") @@ -430,7 +474,7 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libra= ry, and Binutils.") "third_party/pdfium" "third_party/pdfium/third_party" (string-append "third_party/pdfium/third_party/= freetype" =2D "/include/psnames/pstables.h") + "/include/pstables.h") "third_party/ply" "third_party/polymer" "third_party/protobuf" @@ -442,16 +486,12 @@ includes Clang, the Guix ld wrapper, glibc, a C++ lib= rary, and Binutils.") "third_party/skia/third_party/gif" "third_party/smhasher" "third_party/speech-dispatcher" =2D "third_party/spirv-headers" =2D "third_party/spirv-tools-angle" "third_party/sqlite" "third_party/swiftshader" "third_party/swiftshader/third_party" "third_party/s2cellid" "third_party/usb_ids" "third_party/usrsctp" =2D "third_party/vulkan" =2D "third_party/vulkan-validation-layers" "third_party/WebKit" "third_party/web-animations-js" "third_party/webrtc" @@ -475,6 +515,10 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libr= ary, and Binutils.") #t #f)) =20 + (define (useless? file) + (any (cute string-suffix? <> file) + '(".tar.gz" ".zip" ".exe" ".jar"))) + (define (parents child) "Return a list of paths up to and including the clos= est third_party" (let ((lst (reverse (string-split child #\/)))) @@ -492,11 +536,12 @@ includes Clang, the Guix ld wrapper, glibc, a C++ lib= rary, and Binutils.") (let ((protected (make-regexp "\\.(gn|gyp)i?$"))) (match flag ((or 'regular 'symlink 'stale-symlink) =2D (when (third_party? child) + (when (or (third_party? child) (useless? child)) (unless (or (member child preserved-club) (any (cute member <> preserved-cl= ub) (parents child)) (regexp-exec protected child)) + (format (current-error-port) "deleting ~s~%= " child) (delete-file child))) #t) ('directory-processed @@ -507,9 +552,11 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libr= ary, and Binutils.") =20 (nftw "." delete-unwanted 'depth 'physical) =20 =2D ;; Do a second pass to get rid of various binary arc= hives. =2D (for-each delete-file =2D (find-files "." "\\.(zip|jar|tar.gz|exe)$"= )) + ;; Assert that each listed item is present to catch re= movals. + (for-each (lambda (third-party) + (unless (file-exists? third-party) + (error (format #f "~s does not exist!" t= hird-party)))) + preserved-club) =20 ;; Replace "GN" files from third_party with shims for ;; building against system libraries. Keep this list = in @@ -635,7 +682,12 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libr= ary, and Binutils.") "override_build_date=3D\"01 01 2000 05:00:00\"" "use_unofficial_version_number=3Dfalse" =20 + ;; Disable "safe browsing", which pulls in a depende= ncy + ;; on the nonfree "unrar" program. + "safe_browsing_mode=3D0" + ;; GCC is poorly supported, so we use Clang for now. + ;;"is_clang=3Dfalse" (string-append "clang_base_path=3D\"" clang-toolchai= n "\"") "clang_use_chrome_plugins=3Dfalse" =20 @@ -716,6 +768,11 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libr= ary, and Binutils.") (string-append (getenv "CPLUS_INCLUDE_PATH") ":" clang-toolchain "/include/x86_64-unknown-linux-gnu")) + ;; XXX: For some reason this is needed also for C code (lib= aom). + (setenv "C_INCLUDE_PATH" + (string-append (getenv "C_INCLUDE_PATH") + ":" clang-toolchain + "/include/x86_64-unknown-linux-gnu")) =20 ;; TODO: pre-compile instead. Avoids a race condition. (setenv "PYTHONDONTWRITEBYTECODE" "1") diff --git a/gnu/packages/patches/chromium-glibc-compat.patch b/gnu/package= s/patches/chromium-glibc-compat.patch deleted file mode 100644 index 720adbeef..000000000 =2D-- a/gnu/packages/patches/chromium-glibc-compat.patch +++ /dev/null @@ -1,38 +0,0 @@ =2DUpstream-Status: Backport =2D =2DSigned-off-by: Raphael Kubo da Costa =2D--- =2DFrom 9f63f94a11abc34d40ede8b8712fa15b5844a8c0 Mon Sep 17 00:00:00 2001 =2DFrom: Tom Anderson =2DDate: Sat, 27 Jan 2018 20:03:37 +0000 =2DSubject: [PATCH] Fix build with glibc 2.27 =2D =2DBUG=3D806340 =2DTBR=3Dhamelphi@chromium.org =2D =2DChange-Id: Ib4e5091212d874d9ad88f3e9a1fdfee3ed7e0d5e =2DReviewed-on: https://chromium-review.googlesource.com/890059 =2DReviewed-by: Thomas Anderson =2DReviewed-by: Philippe Hamel =2DCommit-Queue: Thomas Anderson =2DCr-Commit-Position: refs/heads/master@{#532249} =2D--- =2D components/assist_ranker/ranker_example_util.cc | 2 ++ =2D 1 file changed, 2 insertions(+) =2D =2Ddiff --git a/components/assist_ranker/ranker_example_util.cc b/component= s/assist_ranker/ranker_example_util.cc =2Dindex 54d4dbd58f7d..ceedd8f9b18d 100644 =2D--- a/components/assist_ranker/ranker_example_util.cc =2D+++ b/components/assist_ranker/ranker_example_util.cc =2D@@ -2,6 +2,8 @@ =2D // Use of this source code is governed by a BSD-style license that can = be =2D // found in the LICENSE file. =2D=20 =2D+#include =2D+ =2D #include "components/assist_ranker/ranker_example_util.h" =2D #include "base/bit_cast.h" =2D #include "base/format_macros.h" =2D--=20 =2D2.14.3 =2D =2D-=20 2.17.0 --=-=-= Content-Type: text/plain ...and the full thing: --=-=-= Content-Type: text/x-patch; charset=utf-8 Content-Disposition: attachment; filename=0001-gnu-Add-chromium.patch Content-Transfer-Encoding: quoted-printable From=200b08dd695ee9f3d8e64173dea5f9d0470ed92718 Mon Sep 17 00:00:00 2001 From: Marius Bakke Date: Wed, 12 Oct 2016 17:25:05 +0100 Subject: [PATCH] gnu: Add chromium. * gnu/packages/chromium.scm: New file. * gnu/packages/patches/chromium-glibc-compat.patch, gnu/packages/patches/chromium-remove-default-history.patch: New files. * gnu/local.mk: Record it. =2D-- gnu/local.mk | 2 + gnu/packages/chromium.scm | 951 ++++++++++++++++++ .../chromium-remove-default-history.patch | 13 + 3 files changed, 966 insertions(+) create mode 100644 gnu/packages/chromium.scm create mode 100644 gnu/packages/patches/chromium-remove-default-history.pa= tch diff --git a/gnu/local.mk b/gnu/local.mk index 056a46cb7..0bc3220f8 100644 =2D-- a/gnu/local.mk +++ b/gnu/local.mk @@ -94,6 +94,7 @@ GNU_SYSTEM_MODULES =3D \ %D%/packages/check.scm \ %D%/packages/chemistry.scm \ %D%/packages/chez.scm \ + %D%/packages/chromium.scm \ %D%/packages/ci.scm \ %D%/packages/cinnamon.scm \ %D%/packages/cmake.scm \ @@ -591,6 +592,7 @@ dist_patch_DATA =3D \ %D%/packages/patches/ceph-skip-collect-sys-info-test.patch \ %D%/packages/patches/ceph-skip-unittest_blockdev.patch \ %D%/packages/patches/chmlib-inttypes.patch \ + %D%/packages/patches/chromium-remove-default-history.patch \ %D%/packages/patches/clang-3.5-libc-search-path.patch \ %D%/packages/patches/clang-3.8-libc-search-path.patch \ %D%/packages/patches/clang-6.0-libc-search-path.patch \ diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm new file mode 100644 index 000000000..a6f9fec0f =2D-- /dev/null +++ b/gnu/packages/chromium.scm @@ -0,0 +1,951 @@ +;;; GNU Guix --- Functional package management for GNU +;;; Copyright =C2=A9 2016, 2017, 2018 Marius Bakke +;;; +;;; This file is part of GNU Guix. +;;; +;;; GNU Guix is free software; you can redistribute it and/or modify it +;;; under the terms of the GNU General Public License as published by +;;; the Free Software Foundation; either version 3 of the License, or (at +;;; your option) any later version. +;;; +;;; GNU Guix is distributed in the hope that it will be useful, but +;;; WITHOUT ANY WARRANTY; without even the implied warranty of +;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +;;; GNU General Public License for more details. +;;; +;;; You should have received a copy of the GNU General Public License +;;; along with GNU Guix. If not, see . + +(define-module (gnu packages chromium) + #:use-module ((guix licenses) #:prefix license:) + #:use-module (guix packages) + #:use-module (guix download) + #:use-module (guix git-download) + #:use-module (guix utils) + #:use-module (guix build-system gnu) + #:use-module (guix build-system trivial) + #:use-module (gnu packages) + #:use-module (gnu packages assembly) + #:use-module (gnu packages base) + #:use-module (gnu packages bison) + #:use-module (gnu packages compression) + #:use-module (gnu packages cups) + #:use-module (gnu packages curl) + #:use-module (gnu packages databases) + #:use-module (gnu packages fontutils) + #:use-module (gnu packages gcc) + #:use-module (gnu packages ghostscript) + #:use-module (gnu packages gl) + #:use-module (gnu packages glib) + #:use-module (gnu packages gnome) + #:use-module (gnu packages gnuzilla) + #:use-module (gnu packages gperf) + #:use-module (gnu packages gtk) + #:use-module (gnu packages icu4c) + #:use-module (gnu packages image) + #:use-module (gnu packages libevent) + #:use-module (gnu packages libffi) + #:use-module (gnu packages libusb) + #:use-module (gnu packages linux) + #:use-module (gnu packages llvm) + #:use-module (gnu packages kerberos) + #:use-module (gnu packages ninja) + #:use-module (gnu packages node) + #:use-module (gnu packages pciutils) + #:use-module (gnu packages photo) + #:use-module (gnu packages pkg-config) + #:use-module (gnu packages protobuf) + #:use-module (gnu packages pulseaudio) + #:use-module (gnu packages python) + #:use-module (gnu packages python-web) + #:use-module (gnu packages regex) + #:use-module (gnu packages serialization) + #:use-module (gnu packages speech) + #:use-module (gnu packages tls) + #:use-module (gnu packages valgrind) + #:use-module (gnu packages version-control) + #:use-module (gnu packages video) + #:use-module (gnu packages xiph) + #:use-module (gnu packages xml) + #:use-module (gnu packages xdisorg) + #:use-module (gnu packages xorg)) + +(define (strip-directory-prefix pathspec) + "Return everything after the last '/' in PATHSPEC." + (let ((index (string-rindex pathspec #\/))) + (if index + (string-drop pathspec (+ 1 index)) + pathspec))) + +(define (chromium-patch-file-name pathspec) + (let ((patch-name (strip-directory-prefix pathspec))) + (if (string-prefix? "chromium-" patch-name) + patch-name + (string-append "chromium-" patch-name)))) + +;; https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git/tree/debi= an/patches +(define (debian-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append + "https://anonscm.debian.org/cgit/pkg-chromium/pkg-chromium.git" + "/plain/debian/patches/" pathspec "?id=3D" revision)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://gitweb.gentoo.org/repo/gentoo.git/tree/www-client/chromium/files +(define (gentoo-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-client" + "/chromium/files/" pathspec "?id=3D" revision)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://github.com/gcarq/inox-patchset +(define (inox-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append "https://raw.githubusercontent.com/gcarq/inox-patc= hset/" + revision "/" pathspec)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://github.com/NixOS/nixpkgs/tree/master/pkgs/applications/networki= ng/browsers/chromium +(define (nixos-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append "https://raw.githubusercontent.com/NixOS/nixpkgs/" + revision "/pkgs/applications/networking/browsers" + "/chromium/patches/" pathspec)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +(define %debian-revision "debian/66.0.3359.26-1") +(define %gentoo-revision "599be358f257098e7ba29196f6fce498b0a8d208") +(define %inox-revision "365a106e298e04b4a7063559b7a0ee16888b928f") + +;; Use system NSPR. +(define %chromium-system-nspr.patch + (debian-patch "system/nspr.patch" + %debian-revision + "0x54c8zhwjldlnx4754aaq0xyb24spqia3fgn94kcf686wp61srz")) + +;; And system libevent. +(define %chromium-system-libevent.patch + (debian-patch "system/event.patch" + %debian-revision + "18ka0zmfd6g5yxhknh6x94bfm643v1kgczzag5sfndizsaaxrlpc")) + +;; Avoid dependency on Chromiums embedded libc++ library for GN. +(define %chromium-gn-libcxx.patch + (debian-patch "gn/libcxx.patch" + %debian-revision + "14rx16abxv0pz4qyp194cy999z3390hxi80rdbjs3v2lwscx36cl")) + +;; Don't show a warning about missing API keys. +(define %chromium-disable-api-keys-warning.patch + (debian-patch "disable/google-api-warning.patch" + %debian-revision + "1qf2y7jmaya43k9rbsxjjpkp5manzmbkhjj5hvfyqcdylhy30swj")) + +;; Some files were missing in the Chromium 66 release tarball. +;; See . +(define %chromium-add-blink-tools.patch + (origin + (method url-fetch) + (uri (string-append "https://bazaar.launchpad.net/~chromium-team" + "/chromium-browser/bionic-stable/download/head:" + "/addmissingblinktools-20180416203514-02f50sz15c2m= n6ei-1" + "/add-missing-blink-tools.patch")) + (sha256 + (base32 + "1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s")))) + +;; Fix an assignment bug when using Clang and libstdc++. +(define %chromium-clang-assignment.patch + (gentoo-patch "chromium-clang-r4.patch" + %gentoo-revision + "0ip3pzk9is6n7icpml33ryysiq4cfrx8jlr0jkjgdg6mvl8pli3i")) + +;; Fix error detecting system ffmpeg. +(define %chromium-ffmpeg.patch + (gentoo-patch "chromium-ffmpeg-r1.patch" + %gentoo-revision + "1pivcdmana4qx8sngcdpr858l0qh6bygv7azj66vg021phq5725a")) + +;; Fix build failure when built with "safe_browsing_mode=3D0". +(define %chromium-build-without-safebrowsing.patch + (inox-patch "0001-fix-building-without-safebrowsing.patch" + %inox-revision + "0r1as6vmc6bbc7i54cxbmbm6rrwj33a12hfz6rzj0yxyqnnps00f")) + +;; Use privacy-preserving defaults. +(define %chromium-default-preferences.patch + (inox-patch "0006-modify-default-prefs.patch" + %inox-revision + "1ncjij9sib7fliafpv37j1zf8zz5hvyxqad669vvadg7vvwr9rza")) + +;; Recent versions of Chromium may load a remote search engine on the +;; New Tab Page, causing unnecessary and involuntary network traffic. +(define %chromium-restore-classic-ntp.patch + (inox-patch "0008-restore-classic-ntp.patch" + %inox-revision + "1jl978qas2ry9lnq6x42xl4qa6arxxj9a37k9j2wclz2pin8cmzn")) + +;; Add DuckDuckGo and set it as the default search engine. +(define %chromium-duckduckgo.patch + (inox-patch "0011-add-duckduckgo-search-engine.patch" + %inox-revision + "0mvw1ax0gw3d252c9b1pwbk0j7ny8z9nsfywcmhj56wm6yksgpkg")) + +;; Don't start a "Login Wizard" at first launch. +(define %chromium-first-run.patch + (inox-patch "0018-disable-first-run-behaviour.patch" + %inox-revision + "1y4zsqqf2125jkb1phwy9g5hcbd9xhyv5lr4xcaly66rpdzx2ayb")) + +(define opus+custom + (package (inherit opus) + (name "opus+custom") + (arguments + (substitute-keyword-arguments (package-arguments opus) + ((#:configure-flags flags ''()) + ;; Opus Custom is an optional extension of the Opus + ;; specification that allows for unsupported frame + ;; sizes. Chromium requires that this is enabled. + `(cons "--enable-custom-modes" + ,flags)))))) + +(define libvpx+experimental + (package (inherit libvpx) + ;; XXX: Chromium 66 relies on unreleased libvpx features. + ;; The commit below is the tip of the "m66-3359" branch + ;; as of 2018-04-19. + (source (origin + (method git-fetch) + (uri (git-reference + (url "https://chromium.googlesource.com/webm/li= bvpx") + (commit "e9fff8a9dbcd03fbf3e5b7caaa9dc2631a7988= 2a"))) + (sha256 + (base32 + "1b1d89dlbr8ydakvp82cg6xnlnkz5hj7679f4pgxwlgd6x46f4= g2")))) + (name "libvpx+experimental") + (arguments + (substitute-keyword-arguments (package-arguments libvpx) + ((#:configure-flags flags) + ;; Spatial SVC is an experimental VP9 encoder required + ;; by Chromium. + `(cons* "--enable-experimental" "--enable-spatial-svc" + ,flags)))))) + +;; XXX: This ugly libstdc++ variant stems from the fact that building +;; libstdc++ standalone is not officially supported by GCC upstream, and +;; the "make-libstdc++" procedure consequently builds a library without +;; threading support, since the configure script fails to detect gthreads. +;; +;; Fixing it properly would require building libgcc (which creates +;; gthr-default.h) before building libstdc++. This authors attempts +;; at doing so were unsuccessful, hence this hack. +;; +;; This behaviour changed upstream in this commit: +;; https://gcc.gnu.org/git/?p=3Dgcc.git;a=3Dcommit;h=3D630d52ca0a88d173f89= 634a5d7dd8aee07d04d80 +;; ...or around GCC 4.6. The libstdc++ docs are very explicit about it +;; not being designed to used standalone (even though it worked just fine +;; before 4.6, according to multiple mailing list threads around that time= ), +;; so upstream is not interested in improving the situation. +;; +;; In fact, there used to be an "INSTALL" document with libstdc++, which +;; is conspicuously missing in later releases. +;; +;; An alternative would be to change the GCC package to install C++ headers +;; in "include" rather than "include/c++". I tried that too; but it caused +;; a bootstrapping failure. The situation is further complicated by the +;; fact that GCC installs C++ headers in the default output, but libstdc++= .so +;; ends up in "lib". +;; +;; To be continued... + +(define (libstdc++-from-gcc gcc) + "Return a libstdc++ library extracted from gcc. The primary use case +is when using compilers other than GCC." + (package + (inherit gcc) + (source #f) + (name "libstdc++") + (build-system trivial-build-system) + (arguments + `(#:modules ((guix build utils)) + #:builder (begin + (use-modules (guix build utils)) + (let* ((out (assoc-ref %outputs "out")) + (lib (string-append out "/lib")) + (include (string-append out "/include")) + (gcc (assoc-ref %build-inputs "gcc")) + (gcc-lib (assoc-ref %build-inputs "gcc:lib"))) + (mkdir-p out) + (copy-recursively (string-append gcc "/include/c++") + include) + (for-each (lambda (file) + (install-file file lib)) + (find-files (string-append gcc-lib "/lib") + "^libstdc\\+\\+\\.so.*")) + #t)))) + (outputs '("out")) + (inputs `(("gcc" ,gcc) + ("gcc:lib" ,gcc "lib"))) + (native-inputs '()) + (propagated-inputs '()) + (synopsis "GNU C++ standard library"))) + +(define (make-clang-toolchain clang libcxx) + "Return a complete toolchain for Clang." + (package + (name "clang-toolchain") + (version (package-version clang)) + (source #f) + (build-system trivial-build-system) + (arguments + '(#:modules ((guix build union)) + #:builder (begin + (use-modules (ice-9 match) + (srfi srfi-26) + (guix build union)) + + (let ((out (assoc-ref %outputs "out"))) + + (match %build-inputs + (((names . directories) ...) + (union-build out directories))) + #t)))) + (native-search-paths (package-native-search-paths clang)) + (search-paths (package-search-paths clang)) + (license (package-license clang)) + (synopsis "Complete Clang tool chain for C/C++ development") + (description + "This package provides a complete Clang tool chain for C/C++. This +includes Clang, the Guix ld wrapper, glibc, a C++ library, and Binutils.") + (home-page "https://clang.llvm.org") + (outputs '("out")) + (inputs `(("clang" ,clang) + ("libcxx" ,libcxx) + ("ld-wrapper" ,(car (assoc-ref (%final-inputs) "ld-wrapper")= )) + ("binutils" ,binutils) + ("libc" ,glibc))))) + +;; When using Clang, Chromium expects to find "ar" and friends next +;; to the clang executable. For simplicity just create this union. +(define chromium-clang-toolchain + (make-clang-toolchain clang (libstdc++-from-gcc gcc-6))) + +(define-public chromium + (package + (name "chromium") + (version "66.0.3359.117") + (synopsis "Graphical web browser") + (source (origin + (method url-fetch) + (uri (string-append "https://commondatastorage.googleapis.co= m/" + "chromium-browser-official/chromium-" + version ".tar.xz")) + (sha256 + (base32 + "1mlfavs0m0lf60s42krqxqiyx73hdfd4r1mkjwv31p2gchsa7ibp")) + (patches (list %chromium-gn-libcxx.patch + %chromium-disable-api-keys-warning.patch + %chromium-system-nspr.patch + %chromium-system-libevent.patch + + %chromium-add-blink-tools.patch + + %chromium-clang-assignment.patch + %chromium-ffmpeg.patch + + %chromium-build-without-safebrowsing.patch + %chromium-default-preferences.patch + %chromium-restore-classic-ntp.patch + %chromium-duckduckgo.patch + %chromium-first-run.patch + (search-patch "chromium-remove-default-histor= y.patch"))) + (modules '((srfi srfi-1) + (srfi srfi-26) + (ice-9 ftw) + (ice-9 match) + (ice-9 regex) + (guix build utils))) + (snippet + '(begin + (let ((preserved-club + (map + (lambda (path) + ;; Prepend paths with "./" for comparison with= ftw. + (string-append "./" path)) + (list + "base/third_party/dmg_fp" + "base/third_party/dynamic_annotations" + "base/third_party/icu" + "base/third_party/libevent" + "base/third_party/nspr" + "base/third_party/superfasthash" + "base/third_party/symbolize" ;glog + "base/third_party/xdg_mime" + "base/third_party/xdg_user_dirs" + "chrome/third_party/mozilla_security_manager" + "courgette/third_party" + "net/third_party/mozilla_security_manager" + "net/third_party/nss" + "third_party/adobe/flash/flapper_version.h" + ;; FIXME: This is used in: + ;; * ui/webui/resources/js/analytics.js + ;; * ui/file_manager/ + "third_party/analytics" + "third_party/angle" + "third_party/angle/src/common/third_party/base" + "third_party/angle/src/common/third_party/smhas= her" + "third_party/angle/src/third_party/compiler" + "third_party/angle/src/third_party/libXNVCtrl" + "third_party/angle/src/third_party/trace_event" + "third_party/angle/third_party/glslang" + "third_party/angle/third_party/spirv-headers" + "third_party/angle/third_party/spirv-tools" + "third_party/angle/third_party/vulkan-validatio= n-layers" + "third_party/blink" + "third_party/boringssl" + "third_party/boringssl/src/third_party/fiat" + "third_party/breakpad" + "third_party/brotli" + "third_party/cacheinvalidation" + "third_party/catapult" + "third_party/catapult/common/py_vulcanize/third= _party/rcssmin" + "third_party/catapult/common/py_vulcanize/third= _party/rjsmin" + "third_party/catapult/third_party/polymer" + "third_party/catapult/tracing/third_party/d3" + "third_party/catapult/tracing/third_party/gl-ma= trix" + "third_party/catapult/tracing/third_party/jszip" + "third_party/catapult/tracing/third_party/mannw= hitneyu" + "third_party/catapult/tracing/third_party/oboe" + "third_party/catapult/tracing/third_party/pako" + "third_party/ced" + "third_party/cld_3" + "third_party/crc32c" + "third_party/cros_system_api" + "third_party/dom_distiller_js" + "third_party/fips181" + "third_party/flatbuffers" + "third_party/glslang-angle" + "third_party/google_input_tools" + "third_party/google_input_tools/third_party/clo= sure_library" + (string-append "third_party/google_input_tools/= third_party" + "/closure_library/third_party/cl= osure") + "third_party/googletest" + "third_party/harfbuzz-ng" + "third_party/hunspell" + "third_party/iccjpeg" + "third_party/inspector_protocol" + "third_party/jinja2" + "third_party/jstemplate" + "third_party/khronos" + "third_party/leveldatabase" + "third_party/libXNVCtrl" + "third_party/libaddressinput" + "third_party/libaom" + "third_party/libaom/source/libaom/third_party/x= 86inc/x86inc.asm" + "third_party/libjingle_xmpp" + "third_party/libphonenumber" + "third_party/libsecret" ;FIXME: needs pkg-confi= g support. + "third_party/libsrtp" ;TODO: Requires libsrtp= @2. + "third_party/libudev" + "third_party/libwebm" + "third_party/libxml" + "third_party/libyuv" + "third_party/lss" + "third_party/lzma_sdk" + "third_party/markupsafe" + "third_party/mesa" + "third_party/metrics_proto" + "third_party/modp_b64" + "third_party/node" + (string-append "third_party/node/node_modules/" + "polymer-bundler/lib/third_party= /UglifyJS2") + "third_party/openmax_dl" + "third_party/ots" + ;; TODO: Build as extension. + "third_party/pdfium" + "third_party/pdfium/third_party" + (string-append "third_party/pdfium/third_party/= freetype" + "/include/pstables.h") + "third_party/ply" + "third_party/polymer" + "third_party/protobuf" + "third_party/protobuf/third_party/six" + "third_party/qcms" + "third_party/sfntly" + "third_party/skia" + "third_party/skia/third_party/vulkan" + "third_party/skia/third_party/gif" + "third_party/smhasher" + "third_party/speech-dispatcher" + "third_party/sqlite" + "third_party/swiftshader" + "third_party/swiftshader/third_party" + "third_party/s2cellid" + "third_party/usb_ids" + "third_party/usrsctp" + "third_party/WebKit" + "third_party/web-animations-js" + "third_party/webrtc" + "third_party/webrtc_overrides" + "third_party/widevine/cdm/widevine_cdm_version.= h" + "third_party/widevine/cdm/widevine_cdm_common.h" + "third_party/woff2" + "third_party/xdg-utils" + "third_party/yasm/run_yasm.py" + "third_party/zlib/google" + "url/third_party/mozilla" + "v8/src/third_party/utf8-decoder" + "v8/src/third_party/valgrind" + "v8/third_party/inspector_protocol")))) + + (define (empty? dir) + (equal? (scandir dir) '("." ".."))) + + (define (third_party? file) + (if (string-contains file "third_party/") + #t + #f)) + + (define (useless? file) + (any (cute string-suffix? <> file) + '(".tar.gz" ".zip" ".exe" ".jar"))) + + (define (parents child) + "Return a list of paths up to and including the clos= est third_party" + (let ((lst (reverse (string-split child #\/)))) + (let loop ((hierarchy lst) + (result '())) + (if (or (null? hierarchy) + (and (not (null? result)) + (string-suffix? "third_party" (car = result)))) + result + (loop (cdr hierarchy) + (cons (string-join (reverse hierarchy)= "/") + result)))))) + + (define (delete-unwanted child stat flag base level) + (let ((protected (make-regexp "\\.(gn|gyp)i?$"))) + (match flag + ((or 'regular 'symlink 'stale-symlink) + (when (or (third_party? child) (useless? child)) + (unless (or (member child preserved-club) + (any (cute member <> preserved-cl= ub) + (parents child)) + (regexp-exec protected child)) + (format (current-error-port) "deleting ~s~%= " child) + (delete-file child))) + #t) + ('directory-processed + (when (empty? child) + (rmdir child)) + #t) + (_ #t)))) + + (nftw "." delete-unwanted 'depth 'physical) + + ;; Assert that each listed item is present to catch re= movals. + (for-each (lambda (third-party) + (unless (file-exists? third-party) + (error (format #f "~s does not exist!" t= hird-party)))) + preserved-club) + + ;; Replace "GN" files from third_party with shims for + ;; building against system libraries. Keep this list = in + ;; sync with "build/linux/unbundle/replace_gn_files.py= ". + (for-each (lambda (pair) + (let ((source (string-append + "build/linux/unbundle/" (ca= r pair))) + (dest (cdr pair))) + (copy-file source dest))) + (list + '("ffmpeg.gn" . "third_party/ffmpeg/BUILD.g= n") + '("flac.gn" . "third_party/flac/BUILD.gn") + '("fontconfig.gn" . "third_party/fontconfig= /BUILD.gn") + '("freetype.gn" . "build/config/freetype/fr= eetype.gni") + '("harfbuzz-ng.gn" . + "third_party/harfbuzz-ng/harfbuzz.gni") + '("icu.gn" . "third_party/icu/BUILD.gn") + '("libdrm.gn" . "third_party/libdrm/BUILD.g= n") + '("libevent.gn" . "base/third_party/libeven= t/BUILD.gn") + '("libjpeg.gn" . + "build/secondary/third_party/libjpeg_turb= o/BUILD.gn") + '("libpng.gn" . "third_party/libpng/BUILD.g= n") + '("libvpx.gn" . "third_party/libvpx/BUILD.g= n") + '("libwebp.gn" . "third_party/libwebp/BUILD= .gn") + '("libxml.gn" . "third_party/libxml/BUILD.g= n") + '("libxslt.gn" . "third_party/libxslt/BUILD= .gn") + '("openh264.gn" . "third_party/openh264/BUI= LD.gn") + '("opus.gn" . "third_party/opus/BUILD.gn") + '("re2.gn" . "third_party/re2/BUILD.gn") + '("snappy.gn" . "third_party/snappy/BUILD.g= n") + '("yasm.gn" . "third_party/yasm/yasm_assemb= le.gni") + '("zlib.gn" . "third_party/zlib/BUILD.gn"))) + #t))))) + (build-system gnu-build-system) + (arguments + `(#:tests? #f + ;; FIXME: There is a "gn" option specifically for setting -rpath, b= ut + ;; it overrides the RUNPATH set by the linker. + #:validate-runpath? #f + #:modules ((srfi srfi-26) + (ice-9 ftw) + (ice-9 regex) + (guix build gnu-build-system) + (guix build utils)) + #:phases + (modify-phases %standard-phases + (add-after 'unpack 'patch-stuff + (lambda* (#:key inputs #:allow-other-keys) + (substitute* "printing/cups_config_helper.py" + (("cups_config =3D.*") + (string-append "cups_config =3D '" (assoc-ref inputs "cups= ") + "/bin/cups-config'\n"))) + + (substitute* + '("base/process/launch_posix.cc" + "base/third_party/dynamic_annotations/dynamic_annotatio= ns.c" + "sandbox/linux/seccomp-bpf/sandbox_bpf.cc" + "sandbox/linux/services/credentials.cc" + "sandbox/linux/services/namespace_utils.cc" + "sandbox/linux/services/syscall_wrappers.cc" + "sandbox/linux/syscall_broker/broker_host.cc") + (("include \"base/third_party/valgrind/") "include \"valgri= nd/")) + + (for-each (lambda (file) + (substitute* file + ;; Fix opus include path. + ;; Do not substitute opus_private.h. + (("#include \"opus\\.h\"") + "#include \"opus/opus.h\"") + (("#include \"opus_custom\\.h\"") + "#include \"opus/opus_custom.h\"") + (("#include \"opus_defines\\.h\"") + "#include \"opus/opus_defines.h\"") + (("#include \"opus_multistream\\.h\"") + "#include \"opus/opus_multistream.h\"") + (("#include \"opus_types\\.h\"") + "#include \"opus/opus_types.h\""))) + (find-files (string-append "third_party/webrtc/modu= les" + "/audio_coding/codecs/op= us"))) + + (substitute* "chrome/common/chrome_paths.cc" + (("/usr/share/chromium/extensions") + ;; TODO: Add ~/.guix-profile. + "/run/current-system/profile/share/chromium/extensions")) + + (substitute* + "third_party/breakpad/breakpad/src/common/linux/libcurl_w= rapper.h" + (("include \"third_party/curl") "include \"curl")) + (substitute* "media/base/decode_capabilities.cc" + (("third_party/libvpx/source/libvpx/") "")) + + ;; We don't cross compile most packages, so get rid of the + ;; unnecessary ARCH-linux-gnu* prefix. + (substitute* "build/toolchain/linux/BUILD.gn" + (("aarch64-linux-gnu-") "") + (("arm-linux-gnueabihf-") "")) + #t)) + (replace 'configure + (lambda* (#:key inputs outputs #:allow-other-keys) + (let* ((out (assoc-ref outputs "out")) + (clang-toolchain (assoc-ref inputs "clang-toolchain")) + (gtk+ (assoc-ref inputs "gtk+")) + (mesa (assoc-ref inputs "mesa")) + (nss (assoc-ref inputs "nss")) + (udev (assoc-ref inputs "udev")) + (gn-flags + (list + ;; See tools/gn/docs/cookbook.md and + ;; https://www.chromium.org/developers/gn-build-conf= iguration + ;; for usage. Run "./gn args . --list" in the Relea= se + ;; directory for an exhaustive list of supported fla= gs. + "is_debug=3Dfalse" + "use_gold=3Dfalse" + "use_lld=3Dfalse" + "linux_use_bundled_binutils=3Dfalse" + "use_custom_libcxx=3Dfalse" + "use_sysroot=3Dfalse" + "enable_precompiled_headers=3Dfalse" + "goma_dir=3D\"\"" + "enable_nacl=3Dfalse" + "enable_nacl_nonsfi=3Dfalse" + "use_allocator=3D\"none\"" ;don't use tcmalloc + "override_build_date=3D\"01 01 2000 05:00:00\"" + "use_unofficial_version_number=3Dfalse" + + ;; Disable "safe browsing", which pulls in a depende= ncy + ;; on the nonfree "unrar" program. + "safe_browsing_mode=3D0" + + ;; GCC is poorly supported, so we use Clang for now. + ;;"is_clang=3Dfalse" + (string-append "clang_base_path=3D\"" clang-toolchai= n "\"") + "clang_use_chrome_plugins=3Dfalse" + + ;; Optimize for building everything at once, as oppo= sed + ;; to incrementally for development. See "docs/jumb= o.md". + "use_jumbo_build=3Dtrue" + ;; Disable debugging features to save space. + "symbol_level=3D1" + "remove_webcore_debug_symbols=3Dtrue" + "enable_iterator_debugging=3Dfalse" + ;; Some of the unbundled libraries throws deprecation + ;; warnings, etc. Ignore it. + "treat_warnings_as_errors=3Dfalse" + ;; Don't add any API keys. End users can set them i= n the + ;; environment if desired. See + ;; . + "use_official_google_api_keys=3Dfalse" + ;; Disable "field trials". + "fieldtrial_testing_like_official_build=3Dtrue" + ;; Disable Chrome Remote Desktop (aka Chromoting). + "enable_remoting=3Dfalse" + + "use_system_freetype=3Dtrue" + "use_system_lcms2=3Dtrue" + "use_system_libjpeg=3Dtrue" + "use_system_libpng=3Dtrue" + "use_system_zlib=3Dtrue" + ;; This is currently not supported on GNU/Linux: + ;; https://bugs.chromium.org/p/chromium/issues/detai= l?id=3D22208 + ;;"use_system_sqlite=3Dtrue" + + "use_gnome_keyring=3Dfalse" ;deprecated by libsecret + "use_gtk3=3Dtrue" + "use_openh264=3Dtrue" + "use_xkbcommon=3Dtrue" + "use_pulseaudio=3Dtrue" + "link_pulseaudio=3Dtrue" + + ;; Don't arbitrarily restrict formats supported by s= ystem ffmpeg. + "proprietary_codecs=3Dtrue" + "ffmpeg_branding=3D\"Chrome\"" + + ;; WebRTC stuff. + "rtc_use_h264=3Dtrue" + ;; Don't use bundled sources. + "rtc_build_json=3Dfalse" + "rtc_build_libevent=3Dfalse" + "rtc_build_libvpx=3Dfalse" + "rtc_build_opus=3Dfalse" + "rtc_build_ssl=3Dfalse" + ;; TODO: Package these. + "rtc_build_libsrtp=3Dtrue" ;2.0 + "rtc_build_openmax_dl=3Dtrue" + "rtc_build_usrsctp=3Dtrue" + (string-append "rtc_jsoncpp_root=3D\"" + (assoc-ref inputs "jsoncpp") + "/include/jsoncpp/json\"") + (string-append "rtc_ssl_root=3D\"" + (assoc-ref inputs "openssl") + "/include/openssl\"")))) + + ;; XXX: How portable is this. + (mkdir-p "third_party/node/linux/node-linux-x64") + (symlink (string-append (assoc-ref inputs "node") "/bin") + "third_party/node/linux/node-linux-x64/bin") + + (setenv "CC" "clang") + (setenv "CXX" "clang++") + + ;; FIXME: This nasty hack works around a problem where + ;; Clang does not add the arch triplet to the libtsdc++ + ;; search path. Fixing it seems tricky, since it only + ;; searches "include/" when it detects libstdc++ + ;; in GCC which is not the case in Guix; the only reason + ;; libstdc++ works here is because it's already on the + ;; include path... + (setenv "CPLUS_INCLUDE_PATH" + (string-append (getenv "CPLUS_INCLUDE_PATH") + ":" clang-toolchain + "/include/x86_64-unknown-linux-gnu")) + ;; XXX: For some reason this is needed also for C code (lib= aom). + (setenv "C_INCLUDE_PATH" + (string-append (getenv "C_INCLUDE_PATH") + ":" clang-toolchain + "/include/x86_64-unknown-linux-gnu")) + + ;; TODO: pre-compile instead. Avoids a race condition. + (setenv "PYTHONDONTWRITEBYTECODE" "1") + (and + ;; Build the "gn" tool. + (invoke "python" + "tools/gn/bootstrap/bootstrap.py" "-s" "-v") + ;; Generate ninja build files. + (invoke "./out/Release/gn" "gen" "out/Release" + (string-append "--args=3D" + (string-join gn-flags " "))))))) + (replace 'build + (lambda* (#:key outputs #:allow-other-keys) + (invoke "ninja" "-C" "out/Release" + "-j" (number->string (parallel-job-count)) + "chrome"))) + (replace 'install + (lambda* (#:key inputs outputs #:allow-other-keys) + (let* ((out (assoc-ref outputs "out")) + (bin (string-append out "/bin")) + (exe (string-append bin "/chromium")) + (lib (string-append out "/lib")) + (man (string-append out "/share/man/man1")) + (applications (string-append out "/share/application= s")) + (install-regexp (make-regexp "\\.(bin|pak)$")) + (locales (string-append lib "/locales")) + (resources (string-append lib "/resources")) + (gtk+ (assoc-ref inputs "gtk+")) + (mesa (assoc-ref inputs "mesa")) + (nss (assoc-ref inputs "nss")) + (udev (assoc-ref inputs "udev")) + (sh (which "sh"))) + + (substitute* '("chrome/app/resources/manpage.1.in" + "chrome/installer/linux/common/desktop.templ= ate") + (("@@MENUNAME@@") "Chromium") + (("@@PACKAGE@@") "chromium") + (("/usr/bin/@@USR_BIN_SYMLINK_NAME@@") exe)) + (mkdir-p man) + (copy-file "chrome/app/resources/manpage.1.in" + (string-append man "/chromium.1")) + (mkdir-p applications) + (copy-file "chrome/installer/linux/common/desktop.template" + (string-append applications "/chromium.desktop")) + + (with-directory-excursion "out/Release" + (for-each (lambda (file) + (install-file file lib)) + (scandir "." (cut regexp-exec install-regexp <>= ))) + (copy-file "chrome" (string-append lib "/chromium")) + + ;; TODO: Install icons from "../../chrome/app/themes" into + ;; "out/share/icons/hicolor/$size". + (install-file + "product_logo_48.png" + (string-append out "/share/icons/48x48/chromium.png")) + + (copy-recursively "locales" locales) + (copy-recursively "resources" resources) + + (mkdir-p bin) + ;; Add a thin wrapper to prevent the user from inadverten= tly + ;; installing non-free software through the Web Store. + ;; TODO: Discover extensions from the profile and pass + ;; something like "--disable-extensions-except=3D...". + (call-with-output-file exe + (lambda (port) + (format port + "#!~a~@ + if [ -z \"$CHROMIUM_ENABLE_WEB_STORE\" ]~@ + then~@ + CHROMIUM_FLAGS=3D\" \\~@ + --disable-background-networking \\~@ + --disable-extensions \\~@ + \"~@ + fi~@ + exec ~a $CHROMIUM_FLAGS \"$@\"~%" + sh (string-append lib "/chromium")))) + (chmod exe #o755) + + (wrap-program exe + ;; TODO: Get these in RUNPATH. + `("LD_LIBRARY_PATH" ":" prefix + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib:" + mesa "/lib:" udev "/lib"))) + ;; Avoid file manager crash. See . + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/sh= are")))) + #t))))))) + (native-inputs + `(("bison" ,bison) + ("clang-toolchain" ,chromium-clang-toolchain) + ("git" ,git) ;last_commit_position.py + ("gperf" ,gperf) + ("ninja" ,ninja) + ("node" ,node) + ("pkg-config" ,pkg-config) + ("which" ,which) + ("yasm" ,yasm) + + ("python-beautifulsoup4" ,python2-beautifulsoup4) + ("python-html5lib" ,python2-html5lib) + ("python" ,python-2))) + (inputs + `(("alsa-lib" ,alsa-lib) + ("atk" ,atk) + ("cups" ,cups) + ("curl" ,curl) + ("dbus" ,dbus) + ("dbus-glib" ,dbus-glib) + ("expat" ,expat) + ("flac" ,flac) + ("ffmpeg" ,ffmpeg) + ("fontconfig" ,fontconfig) + ("freetype" ,freetype) + ("gdk-pixbuf" ,gdk-pixbuf) + ("glib" ,glib) + ("gtk+-2" ,gtk+-2) + ("gtk+" ,gtk+) + ("harfbuzz" ,harfbuzz) + ("icu4c" ,icu4c) + ("jsoncpp" ,jsoncpp) + ("lcms" ,lcms) + ("libevent" ,libevent) + ("libffi" ,libffi) + ("libjpeg-turbo" ,libjpeg-turbo) + ("libpng" ,libpng) + ("libusb" ,libusb) + ("libvpx" ,libvpx+experimental) + ("libwebp" ,libwebp) + ("libx11" ,libx11) + ("libxcb" ,libxcb) + ("libxcomposite" ,libxcomposite) + ("libxcursor" ,libxcursor) + ("libxdamage" ,libxdamage) + ("libxext" ,libxext) + ("libxfixes" ,libxfixes) + ("libxi" ,libxi) + ("libxkbcommon" ,libxkbcommon) + ("libxml2" ,libxml2) + ("libxrandr" ,libxrandr) + ("libxrender" ,libxrender) + ("libxscrnsaver" ,libxscrnsaver) + ("libxslt" ,libxslt) + ("libxtst" ,libxtst) + ("mesa" ,mesa) + ("minizip" ,minizip) + ("mit-krb5" ,mit-krb5) + ("nss" ,nss) + ("openh264" ,openh264) + ("openssl" ,openssl) + ("opus" ,opus+custom) + ("pango" ,pango) + ("pciutils" ,pciutils) + ("protobuf" ,protobuf) + ("pulseaudio" ,pulseaudio) + ("re2" ,re2) + ("snappy" ,snappy) + ("speech-dispatcher" ,speech-dispatcher) + ("sqlite" ,sqlite) + ("udev" ,eudev) + ("valgrind" ,valgrind))) + (home-page "https://www.chromium.org/") + (description + "Chromium is a web browser designed for speed and security. This +version incorporates patches from +@url{https://github.com/gcarq/inox-patchset,Inox} and +@url{https://www.debian.org/,Debian} in order to protect the users privacy= .") + ;; Chromium is developed as BSD-3, but bundles a large number of third= -party + ;; components with other licenses. For full information, see chrome:/= /credits. + (license (list license:bsd-3 + license:bsd-2 + license:expat + license:asl2.0 + license:mpl2.0 + license:public-domain + license:lgpl2.1+)))) diff --git a/gnu/packages/patches/chromium-remove-default-history.patch b/g= nu/packages/patches/chromium-remove-default-history.patch new file mode 100644 index 000000000..38be10820 =2D-- /dev/null +++ b/gnu/packages/patches/chromium-remove-default-history.patch @@ -0,0 +1,13 @@ +Don't pre-populate the New Tab Page for new profiles. + +--- a/chrome/browser/history/top_sites_factory.cc ++++ b/chrome/browser/history/top_sites_factory.cc +@@ -74,7 +74,7 @@ +=20 + void InitializePrepopulatedPageList( + history::PrepopulatedPageList* prepopulated_pages) { +-#if !defined(OS_ANDROID) ++#if false + DCHECK(prepopulated_pages); + prepopulated_pages->reserve(arraysize(kRawPrepopulatedPages)); + for (size_t i =3D 0; i < arraysize(kRawPrepopulatedPages); ++i) { =2D-=20 2.17.0 --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlrfcrMACgkQoqBt8qM6 VPrr3Qf/ZCU6KzY71fuLDXrskeAJ1ghoIVETr6aQcPkG0cca5JQqSaRhyZOXa/KY LfI2PA9ZngwkdnL123ynVg/CEjvTpPdFsnMiuHoyLZkzgifx4bsfdCouyMqlgHbG 9frDYAzmkYR8vF+6sh8CEOJLtTsZZxDlnd33LFwY8ijVFYlCBQ/vXAWObEc+ufLd KcrSWBpxDdNgFOO6veGJYYYF4owsZiHBBHkleI/GGb46bOxaJ9LyK4pHW73ibskc 5CxyFTB/7RdXsLiSJuiBHkNlXwpcPUYpyq5ff1VNWpmdzDM5kTj5qxJDCbqkaJjE JXs+xFiLL5jX5fK8FgRoHGcNFFjqhQ== =YBRz -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Tue Apr 24 14:45:16 2018 Received: (at 28004) by debbugs.gnu.org; 24 Apr 2018 18:45:16 +0000 Received: from localhost ([127.0.0.1]:38438 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fB2wG-0007Wy-69 for submit@debbugs.gnu.org; Tue, 24 Apr 2018 14:45:16 -0400 Received: from tobias.gr ([51.15.135.5]:41808) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fB2wE-0007Wp-S5 for 28004@debbugs.gnu.org; Tue, 24 Apr 2018 14:45:15 -0400 Received: by tobias.gr (OpenSMTPD) with ESMTP id 037f869b; Tue, 24 Apr 2018 18:45:12 +0000 (UTC) Received: by submission.tobias.gr (OpenSMTPD) with ESMTPSA id c8fef8c3 (TLSv1.2:ECDHE-RSA-CHACHA20-POLY1305:256:NO); Tue, 24 Apr 2018 18:45:09 +0000 (UTC) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII; format=flowed Content-Transfer-Encoding: 7bit Date: Tue, 24 Apr 2018 20:45:06 +0200 From: Christopher Lemmer Webber To: Marius Bakke Subject: Re: [bug#28004] Chromium 66 + status update In-Reply-To: <87woww8ojw.fsf@fastmail.com> References: <87y3qvb15k.fsf@fastmail.com> <87po32c47b.fsf@fastmail.com> <87po2own4s.fsf@dustycloud.org> <87woww8ojw.fsf@fastmail.com> Message-ID: <068e3226d5004773fa3cb007050bd463@dustycloud.org> X-Sender: cwebber@dustycloud.org User-Agent: telnet X-Spam-Score: -1.3 (-) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -2.3 (--) Marius! On 2018-04-24 20:08, Marius Bakke wrote: > The other remaining issue is that some data is sent to Google whenever > you start the browser for the first time. Sounds great! What data, exactly? > I don't think that's a blocker I hope it is. Kind regards, T G-R Sent from a Web browser. Excuse or enjoy my brevity. From debbugs-submit-bounces@debbugs.gnu.org Tue Apr 24 14:46:30 2018 Received: (at 28004) by debbugs.gnu.org; 24 Apr 2018 18:46:30 +0000 Received: from localhost ([127.0.0.1]:38442 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fB2xS-0007Yz-IG for submit@debbugs.gnu.org; Tue, 24 Apr 2018 14:46:30 -0400 Received: from tobias.gr ([51.15.135.5]:41906) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fB2xR-0007Yq-3T for 28004@debbugs.gnu.org; Tue, 24 Apr 2018 14:46:29 -0400 Received: by tobias.gr (OpenSMTPD) with ESMTP id 7a86ed85; Tue, 24 Apr 2018 18:46:27 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=tobias.gr; h= mime-version:content-type:content-transfer-encoding:date:from:to :cc:subject:in-reply-to:references:message-id; s=2018; i= me@tobias.gr; bh=KjCsEQCo1HTS8uJdIPpKIXp51hrGgonfuji4WNhiEp8=; b= V3eI1qse2E7XAtDEZk2uoFxe/1LQCL4jkY5YmrZOq6RLglc9lG33hN7pX1kPjqIR MlQPosY1e0CERW45exE5mN5FZRAfVPRfUUESqIp0BUM3v4sJhcUiJVbwyCDVqLKO bdRZ0nu4RP0+BIZ3NexAjGYR2NwuiSipjii2hgPBsBdB+Ze1vZNdZloRjqn8J//f muMf36UO+Mjt5pb1biB0FISkYXuoi2+6sPfo0WX3/NL9pD1O/0HWNHIdYH4rWe0r O6ORSreniQNXv1NvhAn1FOEdPZVLcQAZwkarfC80i4Syu+gAkAVi3xCKsJQotRmn Eg1v4vRS9UtC8oAJPKiYLA== Received: by submission.tobias.gr (OpenSMTPD) with ESMTPSA id 981882a8 (TLSv1.2:ECDHE-RSA-CHACHA20-POLY1305:256:NO); Tue, 24 Apr 2018 18:46:25 +0000 (UTC) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII; format=flowed Content-Transfer-Encoding: 7bit Date: Tue, 24 Apr 2018 20:46:22 +0200 From: Tobias Geerinckx-Rice To: Marius Bakke Subject: Re: [bug#28004] Chromium 66 + status update Organization: tobias.gr In-Reply-To: <87woww8ojw.fsf@fastmail.com> References: <87y3qvb15k.fsf@fastmail.com> <87po32c47b.fsf@fastmail.com> <87po2own4s.fsf@dustycloud.org> <87woww8ojw.fsf@fastmail.com> Message-ID: X-Sender: me@tobias.gr User-Agent: telnet X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Marius! On 2018-04-24 20:08, Marius Bakke wrote: > The other remaining issue is that some data is sent to Google whenever > you start the browser for the first time. Sounds great! What data, exactly? > I don't think that's a blocker I hope it is. Kind regards, T G-R Sent from a Web browser. Excuse or enjoy my brevity. From debbugs-submit-bounces@debbugs.gnu.org Tue Apr 24 14:48:47 2018 Received: (at 28004) by debbugs.gnu.org; 24 Apr 2018 18:48:47 +0000 Received: from localhost ([127.0.0.1]:38446 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fB2ze-0007c8-U9 for submit@debbugs.gnu.org; Tue, 24 Apr 2018 14:48:47 -0400 Received: from tobias.gr ([51.15.135.5]:42006) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fB2zd-0007bz-L6 for 28004@debbugs.gnu.org; Tue, 24 Apr 2018 14:48:46 -0400 Received: by tobias.gr (OpenSMTPD) with ESMTP id 60a3c05c; Tue, 24 Apr 2018 18:48:44 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=tobias.gr; h= mime-version:content-type:content-transfer-encoding:date:from:to :cc:subject:in-reply-to:references:message-id; s=2018; i= me@tobias.gr; bh=v9Di44tQXb26TKgPGmmn6vFBPL6BUiOZ1lNuvG0cZt8=; b= RYKuBlKJMUY3rfDnXOYnp7itneK9XBpkE9PMCTauTQsIZoznOYct7gBDahqX9/mF XnxKyBrlQovySgDKVIx9OvR84eH+sL10IPq84UtLE7oU2T0owdQESGBhxOc9sTKx a2HqAYni3l5cBnbrQJpKpNbq+AFaz9bUyQYXZu6/+d43uvjWtPH8vZhEmrNN+TqX vQ5NXrS6WoAzQM8qxt+pIzGTrgDrg426M7T7h5lHIi5TPWPA14AHfReKzkAYH/9h GXviBC7u73Tjb+iswKr6S53fBoJc/hKWZX2SahaO/AkRY6Rcks9n3+Xt06c9J7/D leBDmALkNmP3PVLx0NR0eQ== Received: by submission.tobias.gr (OpenSMTPD) with ESMTPSA id 3e6b1516 (TLSv1.2:ECDHE-RSA-CHACHA20-POLY1305:256:NO); Tue, 24 Apr 2018 18:48:42 +0000 (UTC) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII; format=flowed Content-Transfer-Encoding: 7bit Date: Tue, 24 Apr 2018 20:48:38 +0200 From: Tobias Geerinckx-Rice To: Christopher Lemmer Webber Subject: Re: [bug#28004] Chromium 66 + status update Organization: tobias.gr In-Reply-To: <068e3226d5004773fa3cb007050bd463@dustycloud.org> References: <87y3qvb15k.fsf@fastmail.com> <87po32c47b.fsf@fastmail.com> <87po2own4s.fsf@dustycloud.org> <87woww8ojw.fsf@fastmail.com> <068e3226d5004773fa3cb007050bd463@dustycloud.org> Message-ID: X-Sender: me@tobias.gr User-Agent: telnet X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Marius Bakke X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Erm On 2018-04-24 20:45, Christopher Lemmer Webber wrote: > some nonsense My apologies: of course Chris did no such thing. I really need to get rid of Roundcube, that's what. Kind regards, T G-R Sent from a Web browser. Excuse or enjoy my brevity. From debbugs-submit-bounces@debbugs.gnu.org Tue Apr 24 15:30:28 2018 Received: (at 28004) by debbugs.gnu.org; 24 Apr 2018 19:30:28 +0000 Received: from localhost ([127.0.0.1]:38457 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fB3e0-0000A8-86 for submit@debbugs.gnu.org; Tue, 24 Apr 2018 15:30:28 -0400 Received: from out3-smtp.messagingengine.com ([66.111.4.27]:37805) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fB3dy-00009z-5o for 28004@debbugs.gnu.org; Tue, 24 Apr 2018 15:30:27 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id B0CBC21AC4; Tue, 24 Apr 2018 15:30:25 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Tue, 24 Apr 2018 15:30:25 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; bh=/P7ozEdnr4uxuZ0+m3D39/z9y9S4cBdA6fRdEvIF74o=; b=kuKsZ41o npcdZHYU+39JrZjvXEQUVKATOUrdcap/caekkd+z59cZSvRPlUJmCgsGSWCcU+8v lNFe/hbvxPav324vljiubn9PrenjyjesFQr5/QcNnML42U7D/heAJC3AeNh8LaSF Ypz3TJZ8nAKaixnpltbHjEQ/z7y7huKob3rBorEAQkQ9SxwFG2Dj+kRvYGg2pxDq GN/1XzAJtLqQb9pcod5hf5W1rVIlixmpNp2MDgZNnj0SmSiGD+dsNnZqANIJnBOG 3JgyiJRkdLvyoWTsyCK2ho3T1tpP+mYuvr3wdSYRE4rFsgqR1ukIHWoYjEyMcaEz lVl2gdmGXFD4DQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm2; bh=/P7ozEdnr4uxuZ0+m3D39/z9y9S4c BdA6fRdEvIF74o=; b=VHhQGgwu8z9CHF6F4aHm+QjCNnPnF3M8jdfGR3BjJfso7 smIm6BSE/Ju1tmanQxm1u+Bl23I5XPFzh5BM1++dgK+KUmjAv3KwFb2dply2k+qq 1tvXtpW7pvTR8T+loHfpa42SvpVeDKUbUOIvS6sGI6zu8U207Bdgt7/XRrk39FE3 XnuP9Tiu/2FECOnwKgSqyjqL1c2+ZvfjzswcV/YkmJ/bt0EtK7XZc5pTYPpXt5Ae I6iI+gpiBO0nZFw+fpwJfLnOE5m0ezmHQ4Zv7HLoXnEtEJpnsWgcH8j6YabeAau3 80tfBgwC0+zR0VAUhiovfr5+eZV2uNcC5+rI9Deqg== X-ME-Sender: Received: from localhost (228.92-221-162.customer.lyse.net [92.221.162.228]) by mail.messagingengine.com (Postfix) with ESMTPA id 4B2751025D; Tue, 24 Apr 2018 15:30:25 -0400 (EDT) From: Marius Bakke To: Tobias Geerinckx-Rice Subject: Re: [bug#28004] Chromium 66 + status update In-Reply-To: References: <87y3qvb15k.fsf@fastmail.com> <87po32c47b.fsf@fastmail.com> <87po2own4s.fsf@dustycloud.org> <87woww8ojw.fsf@fastmail.com> User-Agent: Notmuch/0.26.1 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Tue, 24 Apr 2018 21:30:23 +0200 Message-ID: <87tvs08ks0.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain Tobias Geerinckx-Rice writes: > Marius! > > On 2018-04-24 20:08, Marius Bakke wrote: >> The other remaining issue is that some data is sent to Google whenever >> you start the browser for the first time. > > Sounds great! What data, exactly? I haven't MITM'd it to check, unfortunately. Help wanted! The reason I don't think it's a blocking issue, is because Chromium is a massive project and I cannot guarantee that it will never "call home". So while I am intent on fixing the issue, especially since it's easy to test (chromium --user-data-dir=/tmp/foo), it's just one of many "call home" scenarios/antifeatures. And if you enable extensions or log in all bets are off. Even Inox, which goes great lengths to de-google it, admits that they can't guarantee privacy. Other scenarios include checking for IPv6 availability, testing for captive portal, etc. And I think it even falls back to Google DNS if the system resolver is unresponsive. :-( --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlrfhc8ACgkQoqBt8qM6 VPr+MAf/Tc66pviRlefmT3NKksVCNDpM0xZBkg8FWj4vy22+o2Y+PDo9wRdI0OOp EJQfXhnFiC12grqFDA9pExxqjyocdlEHeZKhtlLW8RZAse+3yxdeVJa8+n6ooa9+ mF3duTVmGWZG/TWOmzML4SjIbCXYF5PUAv3PJRk7+PjsNIaxpnzZFoo9SSUrcNQu o2rmz6CcRPjJpI0ZvG0NBGf7719M0nFzKtKllHfM5rFKjbssjXGNVqhl1VAF+8TN ug995Q7SBD+ywCQE7PxslC8tNk/FFlG7zL8dOzHDupS6rIoexStFDTT1//Vk+6Em yVtZafAq7MtxzYkGXTtNyBp0uo6DvQ== =PclY -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Wed Apr 25 13:00:11 2018 Received: (at 28004) by debbugs.gnu.org; 25 Apr 2018 17:00:11 +0000 Received: from localhost ([127.0.0.1]:39508 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fBNm7-0002j9-6x for submit@debbugs.gnu.org; Wed, 25 Apr 2018 13:00:11 -0400 Received: from out2-smtp.messagingengine.com ([66.111.4.26]:47717) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fBNm4-0002j1-JD for 28004@debbugs.gnu.org; Wed, 25 Apr 2018 13:00:09 -0400 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id 154C421BA8; Wed, 25 Apr 2018 13:00:08 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute4.internal (MEProxy); Wed, 25 Apr 2018 13:00:08 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=famulari.name; h=cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= mesmtp; bh=9neuMUAHiqrbtM0ekBCZb1z4iO9teAiDBRjluFT7guw=; b=uekQ4 7ncoXEjdNu8rJlC3PS6WBNSwoWuaTPf8BsjiBDgwUQuw0Tbp4gSMSGIF7Hm9QRGZ rvULUJo8cONFjuUj7ajQY+TYuBeHWbP4488C8JV0J0ouAkrdzpx5px6ynwjuyeT5 1rmHNZMUlWFM92fjoMRULKF+PDTANhfc5BBbkI= DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm2; bh=9neuMUAHiqrbtM0ekBCZb1z4iO9te AiDBRjluFT7guw=; b=hyfFyIcPt1IAVlmJHhCKL97QstoHZCZsWRA0WX+RG2uNT zw+C1w6jO1gKnwC+WIxlvqF0SGdA7HLogInj7VAeyF7rH8iuqzoCwgUxfPkjWZ0w BpSH6/z837LbXQgti2G6y+n9wpF9h+oBgVWrqnDun0pwCoG/9rcoULrxHRaHEXXl LnWDYI2EUG7SM3jGWUl+UHXM9EeW79cwJoAI3ue00gDSbiT9zvOD7ccmo2DJhxCk 4HMJn6391aaxArdkBKuase5Ohv7/9HOFGi42UE5mH3NqDPF2r29lxXLgs7RP3Kwf 7+fCL/n+hmeYVwwue9bVy0U9FaGN1YGUvEpu5X/ag== X-ME-Sender: Received: from localhost (pool-71-105-112-198.nycmny.fios.verizon.net [71.105.112.198]) by mail.messagingengine.com (Postfix) with ESMTPA id 9321510255; Wed, 25 Apr 2018 13:00:07 -0400 (EDT) Date: Wed, 25 Apr 2018 13:00:06 -0400 From: Leo Famulari To: Marius Bakke Subject: Re: [bug#28004] Chromium 66 + status update Message-ID: <20180425170006.GA23453@jasmine.lan> References: <87y3qvb15k.fsf@fastmail.com> <87po32c47b.fsf@fastmail.com> <87po2own4s.fsf@dustycloud.org> <87woww8ojw.fsf@fastmail.com> <87tvs08ks0.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="W/nzBZO5zC0uMSeA" Content-Disposition: inline In-Reply-To: <87tvs08ks0.fsf@fastmail.com> User-Agent: Mutt/1.9.5 (2018-04-13) X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Tobias Geerinckx-Rice X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --W/nzBZO5zC0uMSeA Content-Type: text/plain; charset=us-ascii Content-Disposition: inline On Tue, Apr 24, 2018 at 09:30:23PM +0200, Marius Bakke wrote: > The reason I don't think it's a blocking issue, is because Chromium is > a massive project and I cannot guarantee that it will never "call > home". So while I am intent on fixing the issue, especially since it's > easy to test (chromium --user-data-dir=/tmp/foo), it's just one of many > "call home" scenarios/antifeatures. And if you enable extensions or log > in all bets are off. Even Inox, which goes great lengths to de-google > it, admits that they can't guarantee privacy. I agree with Marius here. > Other scenarios include checking for IPv6 availability, testing for > captive portal, etc. And I think it even falls back to Google DNS if > the system resolver is unresponsive. :-( I think that handling captive portals and falling back to Google DNS (or any fallback DNS) are *great* features that address common problems that most internet users can not work around on their own. I don't believe these features are forbidden by the FSDG: https://www.gnu.org/distros/free-system-distribution-guidelines.en.html Finally, there are several packages that automatically send data out, even in Guix. This is not a reason to exclude the software from Guix, in my opinion. --W/nzBZO5zC0uMSeA Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEEsFFZSPHn08G5gDigJkb6MLrKfwgFAlrgtBIACgkQJkb6MLrK fwhz/xAAqBPjiWcv+I4QOxBK4jrcpSpz6iCdRZMZIMNYz+allgPivGafUV9VQGzT PDOfLEDlkbr3eujp7qfqev2FTG2nzwFrqdWqKwnkBqC+cR5nx00pJjnnwelMifHU LXFIh7Vai3jb2+AEqPZ3m5LvKwvKuKSkeBDyJd/45faQ/NQyUM30SEa6YLajYWCA BHNnl6bckKB/msmmOBT9vZS9zKcMLYfsBhnpimY06fBNe4FZ/Vh+7NSyNG9+oVg1 WwPgDNWCt9CkQbu6LKy2z8685iPrbl5dqWDXq24wmPpm7UkP173Nz8MjziMNHPIZ D+2Asir+x9lxdptFTBf2fvjm4L5Ry3hTA5fPV7zp5XaIb2cdzolu25HioQCXGUo0 ID1vitZdc15HHau3Mj9CN+WdQSck8/w8iN8x5vdqh1DanhanVHXZAQ8+aPmjkLvP 5TBuGwcUmsnFqdsIdcWiuTvw+w9C0wpRpp7Dvrk33MUPyziU82n3vUeMfJBsuo/L 80sCXDQms7A9FE37DbXFMVSYUEUqUzRdxphDPQ0bacsfx4ry5l4e52gFhdxzAkfR l1m/YDTywu4a56CKRf/AiszG7ptuTB6dAePu7oFDHQhlsEMl3YneAzgfrC5i4zSW IE6s37QR6oe6PolymjP7GMfACQW2Fs6poBHhkWy++0gZjMGV9B8= =nx9V -----END PGP SIGNATURE----- --W/nzBZO5zC0uMSeA-- From debbugs-submit-bounces@debbugs.gnu.org Wed Apr 25 13:02:32 2018 Received: (at 28004) by debbugs.gnu.org; 25 Apr 2018 17:02:32 +0000 Received: from localhost ([127.0.0.1]:39513 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fBNoN-0002ma-N2 for submit@debbugs.gnu.org; Wed, 25 Apr 2018 13:02:31 -0400 Received: from out2-smtp.messagingengine.com ([66.111.4.26]:33885) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fBNoM-0002mT-R2 for 28004@debbugs.gnu.org; Wed, 25 Apr 2018 13:02:31 -0400 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id B3ACC211BB; Wed, 25 Apr 2018 13:02:30 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute4.internal (MEProxy); Wed, 25 Apr 2018 13:02:30 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=famulari.name; h=cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= mesmtp; bh=n+cTWhRn6WUM3R96F7QB51UJDbLOB+ioNNDylQlghm8=; b=ICsG5 lMr4/DI8x2+87Vmc51RRaMAuPBayJBngJ6Z4pxplLBCLsJTlQUs+9dTfcH/+EdXg Cux7qbOCQq1wlaCdhV1iKF0Ie7mYs0E/6I1Q3nAGUCZTsR/IRseIuJHuFUQUQxyZ oddI6DLXH1X4nUGtrgZyEVBEqY4NzpXdakMmt0= DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm2; bh=n+cTWhRn6WUM3R96F7QB51UJDbLOB +ioNNDylQlghm8=; b=FSpDyAAJvF8MYV3dPAhTkoG3r19OZ2h1egt87tlzqJWjk 3zbT/0W8ftp3jqdLpQQ/y1glC3ncnRrd4Jgs4Ilqwwascjd/32uvXbFvFp3Nkfnl 1T2CQPU/1wyar/Dxer9XOIicKq4o/F9zTobIy34j5G+gGz12I/mAbVejy6fB2ceU j+vCRbHc87s1iNgE4eYKiX6yO6p0IQxwEVe/Zy4YPSYlBzzccY3QGdW/cgi5TbLv ZHhwiySfgh2m4jL2UVcsKu3lr4TCjBi1ffdV9vA5vO6hYMNFncokJC1ylF9KROH+ ckngZK6gRt8MCdfAHfaePMZ7HLnovsKtsYgpx/mdA== X-ME-Sender: Received: from localhost (pool-71-105-112-198.nycmny.fios.verizon.net [71.105.112.198]) by mail.messagingengine.com (Postfix) with ESMTPA id 64F5910255; Wed, 25 Apr 2018 13:02:30 -0400 (EDT) Date: Wed, 25 Apr 2018 13:02:29 -0400 From: Leo Famulari To: Marius Bakke Subject: Re: [bug#28004] Chromium 66 + status update Message-ID: <20180425170229.GB23453@jasmine.lan> References: <87y3qvb15k.fsf@fastmail.com> <87po32c47b.fsf@fastmail.com> <87po2own4s.fsf@dustycloud.org> <87woww8ojw.fsf@fastmail.com> <87tvs08ks0.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="MfFXiAuoTsnnDAfZ" Content-Disposition: inline In-Reply-To: <87tvs08ks0.fsf@fastmail.com> User-Agent: Mutt/1.9.5 (2018-04-13) X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Tobias Geerinckx-Rice X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --MfFXiAuoTsnnDAfZ Content-Type: text/plain; charset=us-ascii Content-Disposition: inline On Tue, Apr 24, 2018 at 09:30:23PM +0200, Marius Bakke wrote: > The reason I don't think it's a blocking issue, is because Chromium is > a massive project and I cannot guarantee that it will never "call > home". So while I am intent on fixing the issue, especially since it's > easy to test (chromium --user-data-dir=/tmp/foo), it's just one of many > "call home" scenarios/antifeatures. And if you enable extensions or log > in all bets are off. Even Inox, which goes great lengths to de-google > it, admits that they can't guarantee privacy. I'd also like to point out that we cannot and should not try to guarantee privacy. Privacy from whom? For whom? Of course we want to offer a system that is reasonably private, but if we use words like "guarantee", we are setting an impossible and undefined goal for ourselves. --MfFXiAuoTsnnDAfZ Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEEsFFZSPHn08G5gDigJkb6MLrKfwgFAlrgtKUACgkQJkb6MLrK fwgWwQ//aVWUsdRGoCZQR2PWunOEPeb7CbMUQrBOyS/AKhjGFOZ93cetcusPR57S EOVmOci26oxIy48ZCrfSw/7nCtML2HSlfAdlR7l7TyFyubswT/IIf0PO1vkZoKvS aS2BiKZm+DAGPFoFvCL/EvGYfrOfY9/KLmBmhHP17OqunfGUJNHt0F1BPFAzDKRA PTdsbsA3NN2VxRpbshfooU1kFUzZpL+MIFXmNG1rQb8BiOFjPKof9YhhGm7Z5otV VBLeYehnjbWRi19VrDg3IQD+eJHzwU1m8C6s42VHRuMmgW6jVfFn+UuXB6ZuFiAQ 2i02jxXATrXus2xBvYZhmkhU3+6qCB5Z9+pL6IQw2Fax6+8u4/k91I7qb+AqDevr jaRf4PVRTGq6Zh+PPwbCTtvNIc3mRODPKDZuKRNL2f087XrwO+nYwnvUigTgvh4f 0SVluYCmejn6LII0x5v8TZcDez/aqas3kEPvh3qpl9kKL2mxf3f6ZPkp81+Smk4w B2IM5qi4sfzlQSDyUxfxO8ANfOEP3RP5a3EovmWJ+iEaq4CVafO5vsadzHjEEFaH mFRKAy8bzMNZx0dbW42yRT0XmzzeyiJV7lxdCM3LpvH8cTcp+7LFYMc0Z7sESBOe oc6Cly9b5BEFshuQGJM072Q2SDy5B0Nl5Q+WTAvFVUre6SRUdhI= =BrDC -----END PGP SIGNATURE----- --MfFXiAuoTsnnDAfZ-- From debbugs-submit-bounces@debbugs.gnu.org Thu May 03 13:48:44 2018 Received: (at 28004) by debbugs.gnu.org; 3 May 2018 17:48:44 +0000 Received: from localhost ([127.0.0.1]:48467 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fEILO-0008Nd-Iy for submit@debbugs.gnu.org; Thu, 03 May 2018 13:48:44 -0400 Received: from static.195.114.201.195.clients.your-server.de ([195.201.114.195]:44280 helo=conspiracy.of.n0.is) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fEILM-0008NU-4A for 28004@debbugs.gnu.org; Thu, 03 May 2018 13:48:37 -0400 Received: by conspiracy.of.n0.is (OpenSMTPD) with ESMTPSA id ab3cfb94 (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256:NO); Thu, 3 May 2018 17:48:33 +0000 (UTC) Date: Thu, 3 May 2018 17:49:03 +0000 From: Nils Gillmann To: Marius Bakke Subject: Re: [bug#28004] Chromium 66 + status update Message-ID: <20180503174903.asxoaobk6jy2dgk7@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <87po32c47b.fsf@fastmail.com> <87po2own4s.fsf@dustycloud.org> <87woww8ojw.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable In-Reply-To: <87woww8ojw.fsf@fastmail.com> X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: Christopher Lemmer Webber , 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Marius Bakke transcribed 69K bytes: > Christopher Lemmer Webber writes: >=20 > > Hello! I'd like to speak up in favor of getting Chromium merged into > > Guix master. As a web developer, sometimes I have to test things > > against multiple browsers. Having Chromium in GuixSD would help me out > > a lot. > > > > It looks like a mountain of hard work has been put into this. Could we > > get it merged rather than have that work languish? >=20 > Hello! >=20 > I use this browser a lot, so it's hardly languishing. >=20 > There was a recent discussion[0] about the Pale Moon browser, where it > was pointed out that the FSDG[1] requires that any third-party > repositories must be committed to only free software. >=20 > [0] https://lists.gnu.org/archive/html/guix-devel/2018-03/msg00319.html > [1] https://www.gnu.org/distros/free-system-distribution-guidelines.html#= license-rules >=20 > Unfortunately there are UI links to the Chrome "Web Store" still. It's > not possible to install from it without setting the > CHROMIUM_ENABLE_WEB_STORE variable, but I'm not sure if that is > sufficient. It's unfortunate if an unsuspecting user stumbles into the > Web Store and tries to install something (free or not) and only then > finds out that it does not work. >=20 > The other remaining issue is that some data is sent to Google whenever > you start the browser for the first time. I don't think that's a > blocker, but it's certainly something we should aim to fix. >=20 > Attached are updates for 66. The first is an interdiff from the > previous 65 patch; the other is the full "squashed" patch for > convenience. >=20 > New in this version: >=20 > * The snippet will now error if a preserved directory is not present. > * Chromium again requires a git revision of libvpx. > * The "safe browsing" feature requires the nonfree "unrar" program(!!), > as such it has been compiled out. Luckily "Inox" already had a patch > to make the thing actually build with that flag disabled. > * Cosmetic rearrangement of patches to follow Debian and Inox patch order. >=20 > From a6ce5ebc121f129c3097f1f105b6a4de925b43e9 Mon Sep 17 00:00:00 2001 > From: Marius Bakke > Date: Tue, 17 Apr 2018 03:54:56 +0200 > Subject: [PATCH] Chromium 66 update. >=20 Good progress :) However, I'm a friend of bundling patches. Patches you have in a known loca= tion don't run away, like "addmissingblinktools": Starting download of /gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-missin= g-blink-tools.patch =46rom https://bazaar.launchpad.net/~chromium-team/chromium-browser/bionic-= stable/download/head:/addmissingblinktools-20180416203514-02f50sz15c2mn6ei-= 1/add-missing-blink-tools.patch... download failed "https://bazaar.launchpad.net/~chromium-team/chromium-brows= er/bionic-stable/download/head:/addmissingblinktools-20180416203514-02f50sz= 15c2mn6ei-1/add-missing-blink-tools.patch" 404 "Not Found" Starting download of /gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-missin= g-blink-tools.patch =46rom http://mirror.hydra.gnu.org/file/add-missing-blink-tools.patch/sha25= 6/1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s... download failed "http://mirror.hydra.gnu.org/file/add-missing-blink-tools.p= atch/sha256/1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s" 404 "Not = Found" Starting download of /gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-missin= g-blink-tools.patch =46rom http://tarballs.nixos.org/sha256/1im2l1g6g9mangpfphbkg6zxyglbfwbkm5j= xv122yxqgm6vxzz6s... download failed "http://tarballs.nixos.org/sha256/1im2l1g6g9mangpfphbkg6zxy= glbfwbkm5jxv122yxqgm6vxzz6s" 404 "Not Found" failed to download "/gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-missing= -blink-tools.patch" from "https://bazaar.launchpad.net/~chromium-team/chrom= ium-browser/bionic-stable/download/head:/addmissingblinktools-2018041620351= 4-02f50sz15c2mn6ei-1/add-missing-blink-tools.patch" builder for `/gnu/store/5hbv5vgnla974qiw6kakc28a4k35h96n-add-missing-blink-= tools.patch.drv' failed to produce output path `/gnu/store/1djisy58jqjajbfc= rd32vf7hrg9qvzwa-add-missing-blink-tools.patch' cannot build derivation `/gnu/store/2z8i7b4l4l0p5b3pj4swdl2pvbdj5q24-chromi= um-66.0.3359.117.tar.xz.drv': 1 dependencies couldn't be built cannot build derivation `/gnu/store/4fxkp0aa1vr2b9fbl9kw8l8ijw0zrd25-chromi= um-66.0.3359.117.drv': 1 dependencies couldn't be built guix package: error: build failed: build of `/gnu/store/4fxkp0aa1vr2b9fbl9k= w8l8ijw0zrd25-chromium-66.0.3359.117.drv' failed From debbugs-submit-bounces@debbugs.gnu.org Thu May 03 13:58:25 2018 Received: (at 28004) by debbugs.gnu.org; 3 May 2018 17:58:25 +0000 Received: from localhost ([127.0.0.1]:48483 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fEIUl-0000AI-S5 for submit@debbugs.gnu.org; Thu, 03 May 2018 13:58:25 -0400 Received: from static.195.114.201.195.clients.your-server.de ([195.201.114.195]:44334 helo=conspiracy.of.n0.is) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fEIUj-0000A7-7g for 28004@debbugs.gnu.org; Thu, 03 May 2018 13:58:17 -0400 Received: by conspiracy.of.n0.is (OpenSMTPD) with ESMTPSA id b544dd9a (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256:NO); Thu, 3 May 2018 17:58:15 +0000 (UTC) Date: Thu, 3 May 2018 17:58:45 +0000 From: Nils Gillmann To: Marius Bakke Subject: Re: [bug#28004] Chromium 66 + status update Message-ID: <20180503175845.xxz47o4gzj36udp3@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <87po32c47b.fsf@fastmail.com> <87po2own4s.fsf@dustycloud.org> <87woww8ojw.fsf@fastmail.com> <20180503174903.asxoaobk6jy2dgk7@abyayala> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline In-Reply-To: <20180503174903.asxoaobk6jy2dgk7@abyayala> X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Nils Gillmann transcribed 4.4K bytes: > Marius Bakke transcribed 69K bytes: > > Christopher Lemmer Webber writes: > > > > > Hello! I'd like to speak up in favor of getting Chromium merged into > > > Guix master. As a web developer, sometimes I have to test things > > > against multiple browsers. Having Chromium in GuixSD would help me out > > > a lot. > > > > > > It looks like a mountain of hard work has been put into this. Could we > > > get it merged rather than have that work languish? > > > > Hello! > > > > I use this browser a lot, so it's hardly languishing. > > > > There was a recent discussion[0] about the Pale Moon browser, where it > > was pointed out that the FSDG[1] requires that any third-party > > repositories must be committed to only free software. > > > > [0] https://lists.gnu.org/archive/html/guix-devel/2018-03/msg00319.html > > [1] https://www.gnu.org/distros/free-system-distribution-guidelines.html#license-rules > > > > Unfortunately there are UI links to the Chrome "Web Store" still. It's > > not possible to install from it without setting the > > CHROMIUM_ENABLE_WEB_STORE variable, but I'm not sure if that is > > sufficient. It's unfortunate if an unsuspecting user stumbles into the > > Web Store and tries to install something (free or not) and only then > > finds out that it does not work. > > > > The other remaining issue is that some data is sent to Google whenever > > you start the browser for the first time. I don't think that's a > > blocker, but it's certainly something we should aim to fix. > > > > Attached are updates for 66. The first is an interdiff from the > > previous 65 patch; the other is the full "squashed" patch for > > convenience. > > > > New in this version: > > > > * The snippet will now error if a preserved directory is not present. > > * Chromium again requires a git revision of libvpx. > > * The "safe browsing" feature requires the nonfree "unrar" program(!!), > > as such it has been compiled out. Luckily "Inox" already had a patch > > to make the thing actually build with that flag disabled. > > * Cosmetic rearrangement of patches to follow Debian and Inox patch order. > > > > > From a6ce5ebc121f129c3097f1f105b6a4de925b43e9 Mon Sep 17 00:00:00 2001 > > From: Marius Bakke > > Date: Tue, 17 Apr 2018 03:54:56 +0200 > > Subject: [PATCH] Chromium 66 update. > > > > Good progress :) > > However, I'm a friend of bundling patches. Patches you have in a known location > don't run away, like "addmissingblinktools": > > Starting download of /gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-missing-blink-tools.patch > From https://bazaar.launchpad.net/~chromium-team/chromium-browser/bionic-stable/download/head:/addmissingblinktools-20180416203514-02f50sz15c2mn6ei-1/add-missing-blink-tools.patch... > download failed "https://bazaar.launchpad.net/~chromium-team/chromium-browser/bionic-stable/download/head:/addmissingblinktools-20180416203514-02f50sz15c2mn6ei-1/add-missing-blink-tools.patch" 404 "Not Found" > > Starting download of /gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-missing-blink-tools.patch > From http://mirror.hydra.gnu.org/file/add-missing-blink-tools.patch/sha256/1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s... > download failed "http://mirror.hydra.gnu.org/file/add-missing-blink-tools.patch/sha256/1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s" 404 "Not Found" > > Starting download of /gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-missing-blink-tools.patch > From http://tarballs.nixos.org/sha256/1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s... > download failed "http://tarballs.nixos.org/sha256/1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s" 404 "Not Found" > failed to download "/gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-missing-blink-tools.patch" from "https://bazaar.launchpad.net/~chromium-team/chromium-browser/bionic-stable/download/head:/addmissingblinktools-20180416203514-02f50sz15c2mn6ei-1/add-missing-blink-tools.patch" > builder for `/gnu/store/5hbv5vgnla974qiw6kakc28a4k35h96n-add-missing-blink-tools.patch.drv' failed to produce output path `/gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-missing-blink-tools.patch' > cannot build derivation `/gnu/store/2z8i7b4l4l0p5b3pj4swdl2pvbdj5q24-chromium-66.0.3359.117.tar.xz.drv': 1 dependencies couldn't be built > cannot build derivation `/gnu/store/4fxkp0aa1vr2b9fbl9kw8l8ijw0zrd25-chromium-66.0.3359.117.drv': 1 dependencies couldn't be built > guix package: error: build failed: build of `/gnu/store/4fxkp0aa1vr2b9fbl9kw8l8ijw0zrd25-chromium-66.0.3359.117.drv' failed > > > Is this the patch you included? https://bazaar.launchpad.net/~chromium-team/chromium-browser/artful-beta/view/head:/debian/patches/add-missing-blink-tools.patch guix hash is 1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s and matches the one the package definition expected. From debbugs-submit-bounces@debbugs.gnu.org Fri May 04 08:10:49 2018 Received: (at 28004) by debbugs.gnu.org; 4 May 2018 12:10:49 +0000 Received: from localhost ([127.0.0.1]:48973 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fEZXt-0001q6-7Z for submit@debbugs.gnu.org; Fri, 04 May 2018 08:10:49 -0400 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:55647) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fEZXq-0001pw-Ca for 28004@debbugs.gnu.org; Fri, 04 May 2018 08:10:39 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 2B2F021B12; Fri, 4 May 2018 08:10:38 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Fri, 04 May 2018 08:10:38 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; bh=e7f919U3LesWRZBxF/8p4Rz6ZVXnYC2+4s4/oPdDFjU=; b=QS0WjJUx 5xm1plmT6aGRIMDy158rBCGOsHnx1NOSsACsbW0QsgM6ncZCxwS0JideiVNJ+mk4 z0V8yAs6RVWWpptf/lE7/VPA5PlljApKoh1JbhQc/5+jqm/j6+dHIvcu/VYFd9iq +xpo65i6DMPUFYR2/l33krt0TlS0mq6RjmihJxiJY2ZOA3BTk+S10t8fJ8yaT9bz QpOSTGU9vAF31c/4wqh/Nd3925tf59Nmt9j9SnbgdvW/ZjVn6psWGAU5uNUQF6Hx 9qwp9APtAIuRyjHSr42Tlw1yn4UzvsYXQOHchFxG2vhEy/W+ggNj5LChlT16oVh9 Xxlm+B+yUdnI/w== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm2; bh=e7f919U3LesWRZBxF/8p4Rz6ZVXnY C2+4s4/oPdDFjU=; b=OIuuUiInjRQiIO5oPDM1+chvPQHEIzT++arGDs0KAV7Pt WQp3wafiw+aWmQjtBeVoe6k756mQP1gpz+73thZMHBIbwfvAd7pIozQSDP+CM5Nb K+JLbfPpIOngpPO7FBdDe6ySrPEkndDOOo/724YPYxp3Cr96q41e9V8JJAwLhrAg WrCtdKVMSZcU569OGkO0IfQLlXQUyB6pIGTzxSzJ25pTkbkPc1GhFT+UxOXeslYC 9idjysxTXYrVTy0l2yPBPuql15UD135o6/6T6u2wkPCRQY2YN5giiP6dUx6DCmi3 3pQxAazsVocaUkMZYbQpP2CCtuJDUBR2C+ONSgqug== X-ME-Sender: Received: from localhost (95.92-221-151.customer.lyse.net [92.221.151.95]) by mail.messagingengine.com (Postfix) with ESMTPA id AA9F510339; Fri, 4 May 2018 08:10:37 -0400 (EDT) From: Marius Bakke To: Nils Gillmann Subject: Re: [bug#28004] Chromium 66 + status update In-Reply-To: <20180503174903.asxoaobk6jy2dgk7@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <87po32c47b.fsf@fastmail.com> <87po2own4s.fsf@dustycloud.org> <87woww8ojw.fsf@fastmail.com> <20180503174903.asxoaobk6jy2dgk7@abyayala> User-Agent: Notmuch/0.26.1 (https://notmuchmail.org) Emacs/25.3.1 (x86_64-pc-linux-gnu) Date: Fri, 04 May 2018 14:10:35 +0200 Message-ID: <87d0ybhb9g.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: Christopher Lemmer Webber , 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable Nils Gillmann writes: > Marius Bakke transcribed 69K bytes: >> Christopher Lemmer Webber writes: >>=20 >> > Hello! I'd like to speak up in favor of getting Chromium merged into >> > Guix master. As a web developer, sometimes I have to test things >> > against multiple browsers. Having Chromium in GuixSD would help me out >> > a lot. >> > >> > It looks like a mountain of hard work has been put into this. Could we >> > get it merged rather than have that work languish? >>=20 >> Hello! >>=20 >> I use this browser a lot, so it's hardly languishing. >>=20 >> There was a recent discussion[0] about the Pale Moon browser, where it >> was pointed out that the FSDG[1] requires that any third-party >> repositories must be committed to only free software. >>=20 >> [0] https://lists.gnu.org/archive/html/guix-devel/2018-03/msg00319.html >> [1] https://www.gnu.org/distros/free-system-distribution-guidelines.html= #license-rules >>=20 >> Unfortunately there are UI links to the Chrome "Web Store" still. It's >> not possible to install from it without setting the >> CHROMIUM_ENABLE_WEB_STORE variable, but I'm not sure if that is >> sufficient. It's unfortunate if an unsuspecting user stumbles into the >> Web Store and tries to install something (free or not) and only then >> finds out that it does not work. >>=20 >> The other remaining issue is that some data is sent to Google whenever >> you start the browser for the first time. I don't think that's a >> blocker, but it's certainly something we should aim to fix. >>=20 >> Attached are updates for 66. The first is an interdiff from the >> previous 65 patch; the other is the full "squashed" patch for >> convenience. >>=20 >> New in this version: >>=20 >> * The snippet will now error if a preserved directory is not present. >> * Chromium again requires a git revision of libvpx. >> * The "safe browsing" feature requires the nonfree "unrar" program(!!), >> as such it has been compiled out. Luckily "Inox" already had a patch >> to make the thing actually build with that flag disabled. >> * Cosmetic rearrangement of patches to follow Debian and Inox patch orde= r. >>=20 > >> From a6ce5ebc121f129c3097f1f105b6a4de925b43e9 Mon Sep 17 00:00:00 2001 >> From: Marius Bakke >> Date: Tue, 17 Apr 2018 03:54:56 +0200 >> Subject: [PATCH] Chromium 66 update. > >=20 > > Good progress :) > > However, I'm a friend of bundling patches. Patches you have in a known lo= cation > don't run away, like "addmissingblinktools": > > Starting download of /gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-miss= ing-blink-tools.patch > From https://bazaar.launchpad.net/~chromium-team/chromium-browser/bionic-= stable/download/head:/addmissingblinktools-20180416203514-02f50sz15c2mn6ei-= 1/add-missing-blink-tools.patch... > download failed "https://bazaar.launchpad.net/~chromium-team/chromium-bro= wser/bionic-stable/download/head:/addmissingblinktools-20180416203514-02f50= sz15c2mn6ei-1/add-missing-blink-tools.patch" 404 "Not Found" > > Starting download of /gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-miss= ing-blink-tools.patch > From http://mirror.hydra.gnu.org/file/add-missing-blink-tools.patch/sha25= 6/1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s... > download failed "http://mirror.hydra.gnu.org/file/add-missing-blink-tools= .patch/sha256/1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s" 404 "No= t Found" > > Starting download of /gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-miss= ing-blink-tools.patch > From http://tarballs.nixos.org/sha256/1im2l1g6g9mangpfphbkg6zxyglbfwbkm5j= xv122yxqgm6vxzz6s... > download failed "http://tarballs.nixos.org/sha256/1im2l1g6g9mangpfphbkg6z= xyglbfwbkm5jxv122yxqgm6vxzz6s" 404 "Not Found" > failed to download "/gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-missi= ng-blink-tools.patch" from "https://bazaar.launchpad.net/~chromium-team/chr= omium-browser/bionic-stable/download/head:/addmissingblinktools-20180416203= 514-02f50sz15c2mn6ei-1/add-missing-blink-tools.patch" > builder for `/gnu/store/5hbv5vgnla974qiw6kakc28a4k35h96n-add-missing-blin= k-tools.patch.drv' failed to produce output path `/gnu/store/1djisy58jqjajb= fcrd32vf7hrg9qvzwa-add-missing-blink-tools.patch' > cannot build derivation `/gnu/store/2z8i7b4l4l0p5b3pj4swdl2pvbdj5q24-chro= mium-66.0.3359.117.tar.xz.drv': 1 dependencies couldn't be built > cannot build derivation `/gnu/store/4fxkp0aa1vr2b9fbl9kw8l8ijw0zrd25-chro= mium-66.0.3359.117.drv': 1 dependencies couldn't be built > guix package: error: build failed: build of `/gnu/store/4fxkp0aa1vr2b9fbl= 9kw8l8ijw0zrd25-chromium-66.0.3359.117.drv' failed Whoops. I'm not used to constructing stable Bazaar URLs. However this patch is not needed for the latest tarball. Here's a diff to the 66 patch updating to the latest Chromium. I also removed some inputs and third party directories that were not needed. --=-=-= Content-Type: text/x-patch Content-Disposition: attachment; filename=chromium.diff Content-Transfer-Encoding: quoted-printable diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm index a6f9fec0f..59c90f869 100644 =2D-- a/gnu/packages/chromium.scm +++ b/gnu/packages/chromium.scm @@ -31,7 +31,6 @@ #:use-module (gnu packages compression) #:use-module (gnu packages cups) #:use-module (gnu packages curl) =2D #:use-module (gnu packages databases) #:use-module (gnu packages fontutils) #:use-module (gnu packages gcc) #:use-module (gnu packages ghostscript) @@ -52,7 +51,6 @@ #:use-module (gnu packages ninja) #:use-module (gnu packages node) #:use-module (gnu packages pciutils) =2D #:use-module (gnu packages photo) #:use-module (gnu packages pkg-config) #:use-module (gnu packages protobuf) #:use-module (gnu packages pulseaudio) @@ -63,7 +61,6 @@ #:use-module (gnu packages speech) #:use-module (gnu packages tls) #:use-module (gnu packages valgrind) =2D #:use-module (gnu packages version-control) #:use-module (gnu packages video) #:use-module (gnu packages xiph) #:use-module (gnu packages xml) @@ -150,19 +147,6 @@ %debian-revision "1qf2y7jmaya43k9rbsxjjpkp5manzmbkhjj5hvfyqcdylhy30swj")) =20 =2D;; Some files were missing in the Chromium 66 release tarball. =2D;; See . =2D(define %chromium-add-blink-tools.patch =2D (origin =2D (method url-fetch) =2D (uri (string-append "https://bazaar.launchpad.net/~chromium-team" =2D "/chromium-browser/bionic-stable/download/head:" =2D "/addmissingblinktools-20180416203514-02f50sz15c= 2mn6ei-1" =2D "/add-missing-blink-tools.patch")) =2D (sha256 =2D (base32 =2D "1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s")))) =2D ;; Fix an assignment bug when using Clang and libstdc++. (define %chromium-clang-assignment.patch (gentoo-patch "chromium-clang-r4.patch" @@ -342,7 +326,7 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libra= ry, and Binutils.") (define-public chromium (package (name "chromium") =2D (version "66.0.3359.117") + (version "66.0.3359.139") (synopsis "Graphical web browser") (source (origin (method url-fetch) @@ -351,14 +335,12 @@ includes Clang, the Guix ld wrapper, glibc, a C++ lib= rary, and Binutils.") version ".tar.xz")) (sha256 (base32 =2D "1mlfavs0m0lf60s42krqxqiyx73hdfd4r1mkjwv31p2gchsa7ibp")) + "1ck4wbi28702p1lfs4sz894ysbgm7fj79wrqj8srsy65z2ssaxdy")) (patches (list %chromium-gn-libcxx.patch %chromium-disable-api-keys-warning.patch %chromium-system-nspr.patch %chromium-system-libevent.patch =20 =2D %chromium-add-blink-tools.patch =2D %chromium-clang-assignment.patch %chromium-ffmpeg.patch =20 @@ -385,14 +367,13 @@ includes Clang, the Guix ld wrapper, glibc, a C++ lib= rary, and Binutils.") "base/third_party/dmg_fp" "base/third_party/dynamic_annotations" "base/third_party/icu" =2D "base/third_party/libevent" =2D "base/third_party/nspr" "base/third_party/superfasthash" =2D "base/third_party/symbolize" ;glog + "base/third_party/symbolize" "base/third_party/xdg_mime" "base/third_party/xdg_user_dirs" "chrome/third_party/mozilla_security_manager" =2D "courgette/third_party" + "courgette/third_party/bsdiff" + "courgette/third_party/divsufsort" "net/third_party/mozilla_security_manager" "net/third_party/nss" "third_party/adobe/flash/flapper_version.h" @@ -439,7 +420,6 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libra= ry, and Binutils.") (string-append "third_party/google_input_tools/= third_party" "/closure_library/third_party/cl= osure") "third_party/googletest" =2D "third_party/harfbuzz-ng" "third_party/hunspell" "third_party/iccjpeg" "third_party/inspector_protocol" @@ -472,7 +452,11 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libr= ary, and Binutils.") "third_party/ots" ;; TODO: Build as extension. "third_party/pdfium" =2D "third_party/pdfium/third_party" + "third_party/pdfium/third_party/agg23" + "third_party/pdfium/third_party/base" + "third_party/pdfium/third_party/bigint" + "third_party/pdfium/third_party/libopenjpeg20" + "third_party/pdfium/third_party/skia_shared" (string-append "third_party/pdfium/third_party/= freetype" "/include/pstables.h") "third_party/ply" @@ -488,7 +472,8 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libra= ry, and Binutils.") "third_party/speech-dispatcher" "third_party/sqlite" "third_party/swiftshader" =2D "third_party/swiftshader/third_party" + "third_party/swiftshader/third_party/llvm-subze= ro" + "third_party/swiftshader/third_party/subzero" "third_party/s2cellid" "third_party/usb_ids" "third_party/usrsctp" @@ -864,7 +849,6 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libra= ry, and Binutils.") (native-inputs `(("bison" ,bison) ("clang-toolchain" ,chromium-clang-toolchain) =2D ("git" ,git) ;last_commit_position.py ("gperf" ,gperf) ("ninja" ,ninja) ("node" ,node) @@ -889,7 +873,6 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libra= ry, and Binutils.") ("freetype" ,freetype) ("gdk-pixbuf" ,gdk-pixbuf) ("glib" ,glib) =2D ("gtk+-2" ,gtk+-2) ("gtk+" ,gtk+) ("harfbuzz" ,harfbuzz) ("icu4c" ,icu4c) @@ -899,6 +882,7 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libra= ry, and Binutils.") ("libffi" ,libffi) ("libjpeg-turbo" ,libjpeg-turbo) ("libpng" ,libpng) + ;;("libsecret" ,libsecret) ("libusb" ,libusb) ("libvpx" ,libvpx+experimental) ("libwebp" ,libwebp) @@ -931,7 +915,7 @@ includes Clang, the Guix ld wrapper, glibc, a C++ libra= ry, and Binutils.") ("re2" ,re2) ("snappy" ,snappy) ("speech-dispatcher" ,speech-dispatcher) =2D ("sqlite" ,sqlite) + ;;("sqlite" ,sqlite) ("udev" ,eudev) ("valgrind" ,valgrind))) (home-page "https://www.chromium.org/") --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlrsTbwACgkQoqBt8qM6 VPp17gf9Eh/QpxnVWwjbuHcXZKml1XUqqUZ5eMJeNu/vqQFAeOiGHYUwW0BPAvm3 rrMcTvpLS9c08cuLytyGVfy/I4HhHoEaBtFj9ZM/QXIsYdcXnUVhTX3cuGcDNDmh dAQPJVI5foz76DMK0NAbHbR5RCgo5uCNPMX6e2m1xEBNnK5CGNK2tCqgMMmLfZEl SMyUXMlpYTkTE7Tf+xB+EJygAOBTS/GMcrfidzqrKJJyUFiG4/J7xWmMxqaxJAOD YJ0W5uhC23ul7NMdlJi0K5tFXXd7fSVoQ678fcvl9+xSimh8ZLT3RGGkl67Znn1F X4e97zu/muJZBYuwr2OQrZm0GcK39g== =w652 -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Fri May 04 09:02:06 2018 Received: (at 28004) by debbugs.gnu.org; 4 May 2018 13:02:06 +0000 Received: from localhost ([127.0.0.1]:49014 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fEaLT-000331-Ol for submit@debbugs.gnu.org; Fri, 04 May 2018 09:02:03 -0400 Received: from static.195.114.201.195.clients.your-server.de ([195.201.114.195]:49046 helo=conspiracy.of.n0.is) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fEaLR-00032s-Al for 28004@debbugs.gnu.org; Fri, 04 May 2018 09:01:54 -0400 Received: by conspiracy.of.n0.is (OpenSMTPD) with ESMTPSA id 80e5d3b5 (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256:NO); Fri, 4 May 2018 13:01:51 +0000 (UTC) Date: Fri, 4 May 2018 13:02:20 +0000 From: Nils Gillmann To: Marius Bakke Subject: Re: [bug#28004] Chromium 66 + status update Message-ID: <20180504130220.xmw7vu5uchumrfn6@abyayala> References: <87y3qvb15k.fsf@fastmail.com> <87po32c47b.fsf@fastmail.com> <87po2own4s.fsf@dustycloud.org> <87woww8ojw.fsf@fastmail.com> <20180503174903.asxoaobk6jy2dgk7@abyayala> <87d0ybhb9g.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="yrml2megun3mjypr" Content-Disposition: inline In-Reply-To: <87d0ybhb9g.fsf@fastmail.com> X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: Christopher Lemmer Webber , 28004@debbugs.gnu.org, Nils Gillmann X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --yrml2megun3mjypr Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 13K bytes: > Nils Gillmann writes: >=20 > > Marius Bakke transcribed 69K bytes: > >> Christopher Lemmer Webber writes: > >>=20 > >> > Hello! I'd like to speak up in favor of getting Chromium merged into > >> > Guix master. As a web developer, sometimes I have to test things > >> > against multiple browsers. Having Chromium in GuixSD would help me = out > >> > a lot. > >> > > >> > It looks like a mountain of hard work has been put into this. Could= we > >> > get it merged rather than have that work languish? > >>=20 > >> Hello! > >>=20 > >> I use this browser a lot, so it's hardly languishing. > >>=20 > >> There was a recent discussion[0] about the Pale Moon browser, where it > >> was pointed out that the FSDG[1] requires that any third-party > >> repositories must be committed to only free software. > >>=20 > >> [0] https://lists.gnu.org/archive/html/guix-devel/2018-03/msg00319.html > >> [1] https://www.gnu.org/distros/free-system-distribution-guidelines.ht= ml#license-rules > >>=20 > >> Unfortunately there are UI links to the Chrome "Web Store" still. It's > >> not possible to install from it without setting the > >> CHROMIUM_ENABLE_WEB_STORE variable, but I'm not sure if that is > >> sufficient. It's unfortunate if an unsuspecting user stumbles into the > >> Web Store and tries to install something (free or not) and only then > >> finds out that it does not work. > >>=20 > >> The other remaining issue is that some data is sent to Google whenever > >> you start the browser for the first time. I don't think that's a > >> blocker, but it's certainly something we should aim to fix. > >>=20 > >> Attached are updates for 66. The first is an interdiff from the > >> previous 65 patch; the other is the full "squashed" patch for > >> convenience. > >>=20 > >> New in this version: > >>=20 > >> * The snippet will now error if a preserved directory is not present. > >> * Chromium again requires a git revision of libvpx. > >> * The "safe browsing" feature requires the nonfree "unrar" program(!!), > >> as such it has been compiled out. Luckily "Inox" already had a patch > >> to make the thing actually build with that flag disabled. > >> * Cosmetic rearrangement of patches to follow Debian and Inox patch or= der. > >>=20 > > > >> From a6ce5ebc121f129c3097f1f105b6a4de925b43e9 Mon Sep 17 00:00:00 2001 > >> From: Marius Bakke > >> Date: Tue, 17 Apr 2018 03:54:56 +0200 > >> Subject: [PATCH] Chromium 66 update. > > >=20 > > > > Good progress :) > > > > However, I'm a friend of bundling patches. Patches you have in a known = location > > don't run away, like "addmissingblinktools": > > > > Starting download of /gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-mi= ssing-blink-tools.patch > > From https://bazaar.launchpad.net/~chromium-team/chromium-browser/bioni= c-stable/download/head:/addmissingblinktools-20180416203514-02f50sz15c2mn6e= i-1/add-missing-blink-tools.patch... > > download failed "https://bazaar.launchpad.net/~chromium-team/chromium-b= rowser/bionic-stable/download/head:/addmissingblinktools-20180416203514-02f= 50sz15c2mn6ei-1/add-missing-blink-tools.patch" 404 "Not Found" > > > > Starting download of /gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-mi= ssing-blink-tools.patch > > From http://mirror.hydra.gnu.org/file/add-missing-blink-tools.patch/sha= 256/1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s... > > download failed "http://mirror.hydra.gnu.org/file/add-missing-blink-too= ls.patch/sha256/1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s" 404 "= Not Found" > > > > Starting download of /gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-mi= ssing-blink-tools.patch > > From http://tarballs.nixos.org/sha256/1im2l1g6g9mangpfphbkg6zxyglbfwbkm= 5jxv122yxqgm6vxzz6s... > > download failed "http://tarballs.nixos.org/sha256/1im2l1g6g9mangpfphbkg= 6zxyglbfwbkm5jxv122yxqgm6vxzz6s" 404 "Not Found" > > failed to download "/gnu/store/1djisy58jqjajbfcrd32vf7hrg9qvzwa-add-mis= sing-blink-tools.patch" from "https://bazaar.launchpad.net/~chromium-team/c= hromium-browser/bionic-stable/download/head:/addmissingblinktools-201804162= 03514-02f50sz15c2mn6ei-1/add-missing-blink-tools.patch" > > builder for `/gnu/store/5hbv5vgnla974qiw6kakc28a4k35h96n-add-missing-bl= ink-tools.patch.drv' failed to produce output path `/gnu/store/1djisy58jqja= jbfcrd32vf7hrg9qvzwa-add-missing-blink-tools.patch' > > cannot build derivation `/gnu/store/2z8i7b4l4l0p5b3pj4swdl2pvbdj5q24-ch= romium-66.0.3359.117.tar.xz.drv': 1 dependencies couldn't be built > > cannot build derivation `/gnu/store/4fxkp0aa1vr2b9fbl9kw8l8ijw0zrd25-ch= romium-66.0.3359.117.drv': 1 dependencies couldn't be built > > guix package: error: build failed: build of `/gnu/store/4fxkp0aa1vr2b9f= bl9kw8l8ijw0zrd25-chromium-66.0.3359.117.drv' failed >=20 > Whoops. I'm not used to constructing stable Bazaar URLs. >=20 > However this patch is not needed for the latest tarball. >=20 > Here's a diff to the 66 patch updating to the latest Chromium. I also > removed some inputs and third party directories that were not needed. Nice, thanks. > diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm > index a6f9fec0f..59c90f869 100644 > --- a/gnu/packages/chromium.scm > +++ b/gnu/packages/chromium.scm > @@ -31,7 +31,6 @@ > #:use-module (gnu packages compression) > #:use-module (gnu packages cups) > #:use-module (gnu packages curl) > - #:use-module (gnu packages databases) > #:use-module (gnu packages fontutils) > #:use-module (gnu packages gcc) > #:use-module (gnu packages ghostscript) > @@ -52,7 +51,6 @@ > #:use-module (gnu packages ninja) > #:use-module (gnu packages node) > #:use-module (gnu packages pciutils) > - #:use-module (gnu packages photo) > #:use-module (gnu packages pkg-config) > #:use-module (gnu packages protobuf) > #:use-module (gnu packages pulseaudio) > @@ -63,7 +61,6 @@ > #:use-module (gnu packages speech) > #:use-module (gnu packages tls) > #:use-module (gnu packages valgrind) > - #:use-module (gnu packages version-control) > #:use-module (gnu packages video) > #:use-module (gnu packages xiph) > #:use-module (gnu packages xml) > @@ -150,19 +147,6 @@ > %debian-revision > "1qf2y7jmaya43k9rbsxjjpkp5manzmbkhjj5hvfyqcdylhy30swj")) > =20 > -;; Some files were missing in the Chromium 66 release tarball. > -;; See . > -(define %chromium-add-blink-tools.patch > - (origin > - (method url-fetch) > - (uri (string-append "https://bazaar.launchpad.net/~chromium-team" > - "/chromium-browser/bionic-stable/download/head:" > - "/addmissingblinktools-20180416203514-02f50sz15c= 2mn6ei-1" > - "/add-missing-blink-tools.patch")) > - (sha256 > - (base32 > - "1im2l1g6g9mangpfphbkg6zxyglbfwbkm5jxv122yxqgm6vxzz6s")))) > - > ;; Fix an assignment bug when using Clang and libstdc++. > (define %chromium-clang-assignment.patch > (gentoo-patch "chromium-clang-r4.patch" > @@ -342,7 +326,7 @@ includes Clang, the Guix ld wrapper, glibc, a C++ lib= rary, and Binutils.") > (define-public chromium > (package > (name "chromium") > - (version "66.0.3359.117") > + (version "66.0.3359.139") > (synopsis "Graphical web browser") > (source (origin > (method url-fetch) > @@ -351,14 +335,12 @@ includes Clang, the Guix ld wrapper, glibc, a C++ l= ibrary, and Binutils.") > version ".tar.xz")) > (sha256 > (base32 > - "1mlfavs0m0lf60s42krqxqiyx73hdfd4r1mkjwv31p2gchsa7ibp")) > + "1ck4wbi28702p1lfs4sz894ysbgm7fj79wrqj8srsy65z2ssaxdy")) > (patches (list %chromium-gn-libcxx.patch > %chromium-disable-api-keys-warning.patch > %chromium-system-nspr.patch > %chromium-system-libevent.patch > =20 > - %chromium-add-blink-tools.patch > - > %chromium-clang-assignment.patch > %chromium-ffmpeg.patch > =20 > @@ -385,14 +367,13 @@ includes Clang, the Guix ld wrapper, glibc, a C++ l= ibrary, and Binutils.") > "base/third_party/dmg_fp" > "base/third_party/dynamic_annotations" > "base/third_party/icu" > - "base/third_party/libevent" > - "base/third_party/nspr" > "base/third_party/superfasthash" > - "base/third_party/symbolize" ;glog > + "base/third_party/symbolize" > "base/third_party/xdg_mime" > "base/third_party/xdg_user_dirs" > "chrome/third_party/mozilla_security_manager" > - "courgette/third_party" > + "courgette/third_party/bsdiff" > + "courgette/third_party/divsufsort" > "net/third_party/mozilla_security_manager" > "net/third_party/nss" > "third_party/adobe/flash/flapper_version.h" > @@ -439,7 +420,6 @@ includes Clang, the Guix ld wrapper, glibc, a C++ lib= rary, and Binutils.") > (string-append "third_party/google_input_tool= s/third_party" > "/closure_library/third_party/= closure") > "third_party/googletest" > - "third_party/harfbuzz-ng" > "third_party/hunspell" > "third_party/iccjpeg" > "third_party/inspector_protocol" > @@ -472,7 +452,11 @@ includes Clang, the Guix ld wrapper, glibc, a C++ li= brary, and Binutils.") > "third_party/ots" > ;; TODO: Build as extension. > "third_party/pdfium" > - "third_party/pdfium/third_party" > + "third_party/pdfium/third_party/agg23" > + "third_party/pdfium/third_party/base" > + "third_party/pdfium/third_party/bigint" > + "third_party/pdfium/third_party/libopenjpeg20" > + "third_party/pdfium/third_party/skia_shared" > (string-append "third_party/pdfium/third_part= y/freetype" > "/include/pstables.h") > "third_party/ply" > @@ -488,7 +472,8 @@ includes Clang, the Guix ld wrapper, glibc, a C++ lib= rary, and Binutils.") > "third_party/speech-dispatcher" > "third_party/sqlite" > "third_party/swiftshader" > - "third_party/swiftshader/third_party" > + "third_party/swiftshader/third_party/llvm-sub= zero" > + "third_party/swiftshader/third_party/subzero" > "third_party/s2cellid" > "third_party/usb_ids" > "third_party/usrsctp" > @@ -864,7 +849,6 @@ includes Clang, the Guix ld wrapper, glibc, a C++ lib= rary, and Binutils.") > (native-inputs > `(("bison" ,bison) > ("clang-toolchain" ,chromium-clang-toolchain) > - ("git" ,git) ;last_commit_position.py > ("gperf" ,gperf) > ("ninja" ,ninja) > ("node" ,node) > @@ -889,7 +873,6 @@ includes Clang, the Guix ld wrapper, glibc, a C++ lib= rary, and Binutils.") > ("freetype" ,freetype) > ("gdk-pixbuf" ,gdk-pixbuf) > ("glib" ,glib) > - ("gtk+-2" ,gtk+-2) > ("gtk+" ,gtk+) > ("harfbuzz" ,harfbuzz) > ("icu4c" ,icu4c) > @@ -899,6 +882,7 @@ includes Clang, the Guix ld wrapper, glibc, a C++ lib= rary, and Binutils.") > ("libffi" ,libffi) > ("libjpeg-turbo" ,libjpeg-turbo) > ("libpng" ,libpng) > + ;;("libsecret" ,libsecret) > ("libusb" ,libusb) > ("libvpx" ,libvpx+experimental) > ("libwebp" ,libwebp) > @@ -931,7 +915,7 @@ includes Clang, the Guix ld wrapper, glibc, a C++ lib= rary, and Binutils.") > ("re2" ,re2) > ("snappy" ,snappy) > ("speech-dispatcher" ,speech-dispatcher) > - ("sqlite" ,sqlite) > + ;;("sqlite" ,sqlite) > ("udev" ,eudev) > ("valgrind" ,valgrind))) > (home-page "https://www.chromium.org/") --yrml2megun3mjypr Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAlrsWdwACgkQ4i+bv+40 hYjY9Q//V1g5Ptsvu1ZH/18Q4Ve4GL0OZntB2PQdnLzkr3dAiZIPyQDSV67QkLLQ B5ReMsSV6zVnf6mssHMkoCP1h1m6l+5jvMBTgXhR08+UBWd5am6wgIqjPFR+V1EA kWsYw8l7oukzTttB+p9XSgq/g+20z1u4c51P6HrsuejtygmzsY+U8y7dxpDeer28 DKNvuLMZlkahzWkwPaxRmS8Cg9V5ZmCHakn2gkxQVOZ/SlZXfOH8yA1eGGCfFr5S h1V2rQscfTE/iuAoyP6Jdw5YARqr7L2s2kOXvMBR97zyVvV82379Tt3MGDCGrPSi dloortkYre/WIFJOs/2YD53U7qZnF508QfQCrEPy9WHad1eOLi+4IapJYED0n+r2 SY3JPRJCW5NoIyLrz7GusZqhJY6GygHh4+6MbawI11nhn9HP49YIc9MWjrk+DHuu s09D6lMXpYXDQ2FhgGwDezm8z7vdNaDNR9ec60N5Exzsg5jGWTcPPvTGp616Rem6 emXH/7Zzd/MoJA2UoQ+PycQ7YKcw1AqAOviSxMeHjnx11Si1PYWuGnQMrinddHOD rD7zkrhmvGp3teQRVjzTEpDG4+HHjfgIMGPF9puwBOgyJnaUMhgmHUJdE66fvcJG afYHMTIWIKB9tpvhlOFBfYRluAv1s9QWOjhHlowsat3mjV79oKI= =V+8/ -----END PGP SIGNATURE----- --yrml2megun3mjypr-- From debbugs-submit-bounces@debbugs.gnu.org Wed Jul 25 04:07:30 2018 Received: (at 28004) by debbugs.gnu.org; 25 Jul 2018 08:07:30 +0000 Received: from localhost ([127.0.0.1]:56087 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fiEpW-0003E6-3Y for submit@debbugs.gnu.org; Wed, 25 Jul 2018 04:07:30 -0400 Received: from aibo.runbox.com ([91.220.196.211]:35476) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fiEpU-0003Dy-G3 for 28004@debbugs.gnu.org; Wed, 25 Jul 2018 04:07:29 -0400 Received: from [10.9.9.210] (helo=mailfront10.runbox.com) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1fiEpS-000097-W8; Wed, 25 Jul 2018 10:07:27 +0200 Received: by mailfront10.runbox.com with esmtpsa (uid:892961 ) (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) id 1fiEpH-0002fh-7x; Wed, 25 Jul 2018 10:07:15 +0200 Date: Wed, 25 Jul 2018 08:08:00 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180725080800.stqijlny6om6powe@abyayala> References: <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> <20180316173044.dctlydfij7smndxd@abyayala> <87h8pfc3tr.fsf@fastmail.com> <20180316175225.7jf4k2qaciyxnepp@abyayala> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline In-Reply-To: <20180316175225.7jf4k2qaciyxnepp@abyayala> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) Hi Marius, any chance you had the time to update to a more recent version release of Chromium? --ng0 From debbugs-submit-bounces@debbugs.gnu.org Sun Aug 05 09:04:33 2018 Received: (at 28004) by debbugs.gnu.org; 5 Aug 2018 13:04:34 +0000 Received: from localhost ([127.0.0.1]:41339 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fmIhu-0000Ec-ID for submit@debbugs.gnu.org; Sun, 05 Aug 2018 09:04:33 -0400 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:50459) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fmIhq-0000EQ-Ue for 28004@debbugs.gnu.org; Sun, 05 Aug 2018 09:04:24 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 9B7AB21AEC; Sun, 5 Aug 2018 09:04:22 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Sun, 05 Aug 2018 09:04:22 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm3; bh=Lo7s0Vskbf8+HkIcRllHt9zyPq5PlGpG2C6kTHJnmls=; b=ZS0QAz5K UwlHPREL223Dfb3Jc6i15S1+WQB+OTZFMyaYoXlwA2gVOYVKsDWG3jZ1IOo6YE39 KzuH4GLHvhqg8M/q9uext6KsD7hxyABXVnUabCUVHU6i43UnwC6aXT2j4W72Wsiu yq1vnFC/MjApBARbyaQgjhy/OXJlyIujzcOa4gEHSgZaq+gyIYT7b7iSX4tKOmq3 9toOeSJ28lfiTesEpxweJ2/Ag6nqo28Nl9DcX8URjMPhNktmnaWIxZWCwF+zb7xz 5t/jflswzCzBDNynZPYnwwTe/mIalZR3r9miMjX0/UnmKD85AVF0gaoYi6YiZ6uU rtgc4yVFha88FA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm3; bh=Lo7s0Vskbf8+HkIcRllHt9zyPq5Pl GpG2C6kTHJnmls=; b=Jjc7z4AmcEeGPlmoAC5USeTuubSEWHvM7jZZAzRB3OkDi 0u1lHCw26tkgTAWLJFOAXZA/pDvhfeEBdHcxfkv0d/bmkGK3TsNwULMF8673MRIR buFAD1S4BNGuFy0/E56aB89soLW516fjJFnbzXiUiZCTE0O8K3GycDY8GX+0XSRz gGLbT3comdx/mA9nefJE8g1RhERRPRl7mEDvEoGsF8SPMkXgbuEdC54tgeFH9brJ Xdnf/GgGb+KTWSSqkeMPwpBDGg1yvPjEwU81nf4aBj2BPr4i7XnBttjd/Wuv0dUf aZHeUkvVYrZwcOefeasyDpfunoAhAVzcSEN6uwH/w== X-ME-Proxy: X-ME-Sender: Received: from localhost (95.92-221-151.customer.lyse.net [92.221.151.95]) by mail.messagingengine.com (Postfix) with ESMTPA id 5E07D1026B; Sun, 5 Aug 2018 09:04:21 -0400 (EDT) From: Marius Bakke To: ng0 Subject: Re: [bug#28004] Chromium In-Reply-To: <20180725080800.stqijlny6om6powe@abyayala> References: <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> <20180316173044.dctlydfij7smndxd@abyayala> <87h8pfc3tr.fsf@fastmail.com> <20180316175225.7jf4k2qaciyxnepp@abyayala> <20180725080800.stqijlny6om6powe@abyayala> User-Agent: Notmuch/0.27 (https://notmuchmail.org) Emacs/26.1 (x86_64-pc-linux-gnu) Date: Sun, 05 Aug 2018 15:04:19 +0200 Message-ID: <87tvo9c6cs.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="==-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --==-=-= Content-Type: multipart/mixed; boundary="=-=-=" --=-=-= Content-Type: text/plain ng0 writes: > Hi Marius, > > any chance you had the time to update to a more recent version release > of Chromium? Good news! Please find Chromium 68 attached. There are *a lot* of changes in this version. Some highlights: * It's using GCC 8 instead of Clang. * A bug in the source scrubber has been fixed, so .zip and .jar files are now purged even if the parent directory is preserved. Currently we're reducing the uncompressed size from 4.3 GiB to 2.1 GiB. * External patches are now in an easier to manage format. * Upstream have discontinued the libvpx "experiment"; but still require an unreleased version. * We're installing a "master_preferences" file, which allows us to easily add defaults for new profiles. * All the various knobs for the build system have been moved to #:configure-flags. This should make it easier to create custom Chromium variants based on this package (qtwebkit?). * The 'configure' phase will now print *all* supported flags for convenience (I usually did this manually every now and then). * I've started cherry-picking patches from Ungoogled-Chromium in the quest to reduce data transmission to Google. TODO: * There is still some data transmitted when starting the browser for the first time. It seems related to the "domain_reliability" component. * Remove remaining "Web Store" links. Currently I've only found it in settings, under "accessibility" and "fonts". * Opening settings transmits a bunch of data, the next version will include the 'disable-translation-lang-fetch' patch from Inox. * PDFium is built, but does not seem to work (the 'install' phase probably needs tweaking). Might just disable it instead. As always, feedback very welcome. Enjoy! --=-=-= Content-Type: text/x-patch; charset=utf-8 Content-Disposition: attachment; filename=0001-gnu-Add-chromium.patch Content-Transfer-Encoding: quoted-printable From=20a4e343c57d70344dd4cef51ccd37c2650c746b46 Mon Sep 17 00:00:00 2001 From: Marius Bakke Date: Wed, 12 Oct 2016 17:25:05 +0100 Subject: [PATCH] gnu: Add chromium. * gnu/packages/chromium.scm, gnu/packages/chromium-master-preferences.json, gnu/packages/patches/chromium-gcc-unique-ptr.patch, gnu/packages/patches/chromium-remove-default-history.patch: New files. * gnu/local.mk: Record it. =2D-- gnu/local.mk | 3 + gnu/packages/chromium-master-preferences.json | 26 + gnu/packages/chromium.scm | 829 ++++++++++++++++++ .../patches/chromium-gcc-unique-ptr.patch | 33 + .../chromium-remove-default-history.patch | 13 + 5 files changed, 904 insertions(+) create mode 100644 gnu/packages/chromium-master-preferences.json create mode 100644 gnu/packages/chromium.scm create mode 100644 gnu/packages/patches/chromium-gcc-unique-ptr.patch create mode 100644 gnu/packages/patches/chromium-remove-default-history.pa= tch diff --git a/gnu/local.mk b/gnu/local.mk index 4ed341df8..320f27c44 100644 =2D-- a/gnu/local.mk +++ b/gnu/local.mk @@ -95,6 +95,7 @@ GNU_SYSTEM_MODULES =3D \ %D%/packages/check.scm \ %D%/packages/chemistry.scm \ %D%/packages/chez.scm \ + %D%/packages/chromium.scm \ %D%/packages/ci.scm \ %D%/packages/cinnamon.scm \ %D%/packages/cluster.scm \ @@ -603,6 +604,8 @@ dist_patch_DATA =3D \ %D%/packages/patches/ceph-skip-collect-sys-info-test.patch \ %D%/packages/patches/ceph-skip-unittest_blockdev.patch \ %D%/packages/patches/chmlib-inttypes.patch \ + %D%/packages/patches/chromium-gcc-unique-ptr.patch \ + %D%/packages/patches/chromium-remove-default-history.patch \ %D%/packages/patches/clang-3.5-libc-search-path.patch \ %D%/packages/patches/clang-3.8-libc-search-path.patch \ %D%/packages/patches/clang-6.0-libc-search-path.patch \ diff --git a/gnu/packages/chromium-master-preferences.json b/gnu/packages/c= hromium-master-preferences.json new file mode 100644 index 000000000..0caa7cc4c =2D-- /dev/null +++ b/gnu/packages/chromium-master-preferences.json @@ -0,0 +1,26 @@ +{ + "distribution": { + "import_bookmarks": false, + "make_chrome_default": false, + "make_chrome_default_for_user": false, + "verbose_logging": true, + "skip_first_run_ui": true, + "suppress_first_run_default_browser_prompt": true + }, + "browser": { + "has_seen_welcome_page" : true, + "check_default_browser" : false + }, + "dns_prefetching": { + "enabled": false + }, + "alternate_error_pages": { + "enabled": false + }, + "hardware": { + "audio_capture_enabled": false + }, + "default_apps": "noinstall", + "hide_web_store_icon": true, + "homepage": "https://www.gnu.org/software/guix" +} diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm new file mode 100644 index 000000000..2fc40a0d2 =2D-- /dev/null +++ b/gnu/packages/chromium.scm @@ -0,0 +1,829 @@ +;;; GNU Guix --- Functional package management for GNU +;;; Copyright =C2=A9 2016, 2017, 2018 Marius Bakke +;;; +;;; This file is part of GNU Guix. +;;; +;;; GNU Guix is free software; you can redistribute it and/or modify it +;;; under the terms of the GNU General Public License as published by +;;; the Free Software Foundation; either version 3 of the License, or (at +;;; your option) any later version. +;;; +;;; GNU Guix is distributed in the hope that it will be useful, but +;;; WITHOUT ANY WARRANTY; without even the implied warranty of +;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +;;; GNU General Public License for more details. +;;; +;;; You should have received a copy of the GNU General Public License +;;; along with GNU Guix. If not, see . + +(define-module (gnu packages chromium) + #:use-module ((guix licenses) #:prefix license:) + #:use-module (guix packages) + #:use-module (guix gexp) + #:use-module (guix download) + #:use-module (guix git-download) + #:use-module (guix utils) + #:use-module (guix build-system gnu) + #:use-module (gnu packages) + #:use-module (gnu packages assembly) + #:use-module (gnu packages base) + #:use-module (gnu packages bison) + #:use-module (gnu packages compression) + #:use-module (gnu packages cups) + #:use-module (gnu packages curl) + #:use-module (gnu packages fontutils) + #:use-module (gnu packages gcc) + #:use-module (gnu packages ghostscript) + #:use-module (gnu packages gl) + #:use-module (gnu packages glib) + #:use-module (gnu packages gnome) + #:use-module (gnu packages gnuzilla) + #:use-module (gnu packages gperf) + #:use-module (gnu packages gtk) + #:use-module (gnu packages icu4c) + #:use-module (gnu packages image) + #:use-module (gnu packages libevent) + #:use-module (gnu packages libffi) + #:use-module (gnu packages linux) + #:use-module (gnu packages kerberos) + #:use-module (gnu packages ninja) + #:use-module (gnu packages node) + #:use-module (gnu packages pciutils) + #:use-module (gnu packages pkg-config) + #:use-module (gnu packages pulseaudio) + #:use-module (gnu packages python) + #:use-module (gnu packages python-web) + #:use-module (gnu packages regex) + #:use-module (gnu packages serialization) + #:use-module (gnu packages speech) + #:use-module (gnu packages tls) + #:use-module (gnu packages valgrind) + #:use-module (gnu packages video) + #:use-module (gnu packages xiph) + #:use-module (gnu packages xml) + #:use-module (gnu packages xdisorg) + #:use-module (gnu packages xorg)) + +(define (chromium-patch-file-name pathspec) + (let ((patch-name (basename pathspec))) + (if (string-prefix? "chromium-" patch-name) + patch-name + (string-append "chromium-" patch-name)))) + +;; https://salsa.debian.org/chromium-team/chromium/tree/master/debian/patc= hes +(define (debian-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append + "https://salsa.debian.org/chromium-team/chromium/raw/" + revision "/debian/patches/" pathspec)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://gitweb.gentoo.org/repo/gentoo.git/tree/www-client/chromium/files +(define (gentoo-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-client" + "/chromium/files/" pathspec "?id=3D" revision)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://github.com/gcarq/inox-patchset +(define (inox-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append "https://raw.githubusercontent.com/gcarq/inox-patc= hset/" + revision "/" pathspec)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; https://github.com/Eloston/ungoogled-chromium +(define (ungoogled-patch pathspec revision hash) + (origin + (method url-fetch) + (uri (string-append "https://raw.githubusercontent.com/Eloston" + "/ungoogled-chromium/" revision "/resources" + "/patches/ungoogled-chromium/" pathspec)) + (sha256 (base32 hash)) + (file-name (chromium-patch-file-name pathspec)))) + +;; XXX: It would be great to have (upstream-patch ...), but the API +;; at can only return +;; base64-encoded patches. + +(define %debian-revision "debian/68.0.3440.75-2") +(define %gentoo-revision "a79be956bb7bbeaca245564ecb4a350b1203ca98") +(define %inox-revision "8afa26a5ffb2e8ff52ac5b7bbdccc9f09290120e") +(define %ungoogled-revision "55d1a2442dcd9efc574f6c4fa99804d5b8658e4e") + +(define %debian-patches + (list + ;; Bootstrap "GN" using system NSPR. + (debian-patch "system/nspr.patch" %debian-revision + "0xywgsq14xdpfdf0wb5plv5jy2738zbwj7caj2i5g9s5zpdclhsv") + ;; Ditto for system libevent. + (debian-patch "system/event.patch" %debian-revision + "0cq5kz5yi737vb3k8v67hrr38czqm3mj6g3swh765pmfzvx5inj6") + ;; Make PDFium use system OpenJPEG. + (debian-patch "system/openjpeg.patch" %debian-revision + "0fxvbfvmimg0ykzhsk3l0kyvhz1fgbys51ldh950106yj6dszsmx") + ;; Make "Courgette" use system zlib instead of the bundled lzma. + (debian-patch "system/zlib.patch" %debian-revision + "1fmkiw7xrhwadvjxkzpv8j5iih2ws59l3llsdrpapw1vybfyq9nr") + ;; Avoid dependency on Chromiums embedded libc++ when bootstrapping. + (debian-patch "gn/libcxx.patch" %debian-revision + "02w94h9jd29jyvq09yxl9g31hk8j07qzr7rg23rhibhkn1rvg38x") + ;; Avoid dependency on Android tools. + (debian-patch "disable/android.patch" %debian-revision + "06kxx1fx9yi52h2fka71i9qqp6jh4r3w890k77nihv8arnabc0nq") + ;; Do not show a warning about missing API keys. + (debian-patch "disable/google-api-warning.patch" %debian-revision + "0vqi3n8i1vkp2cxmza7c60fl6d03195sax0ahrk1ksa04xjbkkqv") + ;; Don't override the home page set in master_preferences. + (debian-patch "disable/welcome-page.patch" %debian-revision + "15c6a296mkqnjdqqq90kmapn56rykb7saz4bs16han6by8q07lbx"))) + +(define %gentoo-patches + (list + ;; Fix error detecting system ffmpeg. + (gentoo-patch "chromium-ffmpeg-r1.patch" %gentoo-revision + "1pivcdmana4qx8sngcdpr858l0qh6bygv7azj66vg021phq5725a") + ;; Add missing #include. + (gentoo-patch "chromium-cors-string-r0.patch" %gentoo-revision + "075lgl6g8rih21adsr3hf2mm0qm16s4w2h4h1qjh652sl941w57l"))) + +(define %inox-patches + (list + ;; Fix build without the "safe browsing" feature. + (inox-patch "0001-fix-building-without-safebrowsing.patch" %inox-revisi= on + "0qchqc3i772drx0c8n44yhkx45fgdvd0h325w0qvaqrakzixbmr4") + ;; Use sane defaults. In particular, don't depend on any Google servic= es. + (inox-patch "0006-modify-default-prefs.patch" %inox-revision + "0sbvs6l80h8ar8na6065ihqnmcsr1b4zc21jcs2wzkrjlxsgspw6") + ;; Recent versions of Chromium may load a remote search engine on the "= New + ;; Tab Page", which causes unnecessary and involuntary network traffic. + (inox-patch "0008-restore-classic-ntp.patch" %inox-revision + "16z5accrri90s922n1r6nj8rqss3g7f579dwwzkk2hdxbkc9wzyr") + ;; Add DuckDuckGo and use it as the default search engine. + (inox-patch "0011-add-duckduckgo-search-engine.patch" %inox-revision + "0mvw1ax0gw3d252c9b1pwbk0j7ny8z9nsfywcmhj56wm6yksgpkg") + ;; Don't start a "Login Wizard" at first launch. + (inox-patch "0018-disable-first-run-behaviour.patch" %inox-revision + "1y4zsqqf2125jkb1phwy9g5hcbd9xhyv5lr4xcaly66rpdzx2ayb"))) + +(define %ungoogled-patches + (list + ;; Disable browser sign-in to prevent leaking data at launch. + (ungoogled-patch "disable-signin.patch" %ungoogled-revision + "0a6akb10bzk6z6nhqa211y8rbj0ibdhhg5n92482q9sikavd8hz0"= ))) + +(define opus+custom + (package (inherit opus) + (name "opus+custom") + (arguments + (substitute-keyword-arguments (package-arguments opus) + ((#:configure-flags flags ''()) + ;; Opus Custom is an optional extension of the Opus + ;; specification that allows for unsupported frame + ;; sizes. Chromium requires that this is enabled. + `(cons "--enable-custom-modes" + ,flags)))))) + +(define libvpx/chromium + ;; Chromium 66 and later requires an unreleased libvpx, so we take the + ;; commit from "third_party/libvpx/README.chromium" in the tarball. + ;; XXX: Might as well reuse Chromium source. + (let ((version (package-version libvpx)) + (commit "e27a331778c4c99ec37262ea786a3b4cc2a491ac") + (revision "0")) + (package + (inherit libvpx) + (name "libvpx-chromium") + (version (git-version version revision commit)) + (source (origin + (method git-fetch) + (uri (git-reference + (url "https://chromium.googlesource.com/webm/libvpx") + (commit commit))) + (file-name (git-file-name name version)) + (sha256 + (base32 + "03a0443dnfn6l2v19qpw7p7k29v98c5b5hl4br93czgq0wi29m1g"))= ))))) + +(define-public chromium + (package + (name "chromium") + (version "68.0.3440.84") + (synopsis "Graphical web browser") + (source (origin + (method url-fetch) + (uri (string-append "https://commondatastorage.googleapis.co= m" + "/chromium-browser-official/chromium-" + version ".tar.xz")) + (sha256 + (base32 + "1nf9xha7ncnh8g1g4c8hzk03f8ya7nd0xzwij9zs7n0qmrkx2c8h")) + (patches (append %debian-patches + %gentoo-patches + %inox-patches + %ungoogled-patches + (search-patches "chromium-gcc-unique-ptr.pa= tch" + "chromium-remove-default-hi= story.patch"))) + (modules '((srfi srfi-1) + (srfi srfi-26) + (ice-9 ftw) + (ice-9 match) + (ice-9 regex) + (guix build utils))) + (snippet + '(begin + (let ((preserved-club + (map + (lambda (path) + ;; Prepend paths with "./" for comparison with= ftw. + (string-append "./" path)) + (list + "base/third_party/dmg_fp" + "base/third_party/dynamic_annotations" + "base/third_party/icu" + "base/third_party/superfasthash" + "base/third_party/symbolize" + "base/third_party/xdg_mime" + "base/third_party/xdg_user_dirs" + "chrome/third_party/mozilla_security_manager" + "courgette/third_party/bsdiff" + "courgette/third_party/divsufsort" + "net/third_party/http2" + "net/third_party/mozilla_security_manager" + "net/third_party/nss" + "net/third_party/spdy" + "net/third_party/quic" + "third_party/adobe/flash/flapper_version.h" + ;; FIXME: This is used in: + ;; * ui/webui/resources/js/analytics.js + ;; * ui/file_manager/ + "third_party/analytics" + "third_party/angle" + "third_party/angle/src/common/third_party/base" + "third_party/angle/src/common/third_party/smhas= her" + "third_party/angle/src/third_party/compiler" + "third_party/angle/src/third_party/libXNVCtrl" + "third_party/angle/src/third_party/trace_event" + "third_party/angle/third_party/glslang" + "third_party/angle/third_party/spirv-headers" + "third_party/angle/third_party/spirv-tools" + "third_party/angle/third_party/vulkan-validatio= n-layers" + "third_party/apple_apsl" ;XXX add APSL2.0 licen= se + "third_party/blink" + "third_party/boringssl" + "third_party/boringssl/src/third_party/fiat" + "third_party/breakpad" + "third_party/brotli" + "third_party/cacheinvalidation" + "third_party/catapult" + "third_party/catapult/common/py_vulcanize/third= _party/rcssmin" + "third_party/catapult/common/py_vulcanize/third= _party/rjsmin" + "third_party/catapult/third_party/polymer" + "third_party/catapult/tracing/third_party/d3" + "third_party/catapult/tracing/third_party/gl-ma= trix" + "third_party/catapult/tracing/third_party/jszip" + "third_party/catapult/tracing/third_party/mannw= hitneyu" + "third_party/catapult/tracing/third_party/oboe" + "third_party/catapult/tracing/third_party/pako" + "third_party/ced" + "third_party/cld_3" + "third_party/crashpad" + (string-append "third_party/crashpad/crashpad/" + "third_party/zlib/zlib_crashpad.= h") + "third_party/crc32c" + "third_party/cros_system_api" + "third_party/dom_distiller_js" + "third_party/fips181" + "third_party/flatbuffers" + "third_party/glslang-angle" + "third_party/google_input_tools" + "third_party/google_input_tools/third_party/clo= sure_library" + (string-append "third_party/google_input_tools/= third_party" + "/closure_library/third_party/cl= osure") + "third_party/googletest" + "third_party/hunspell" + "third_party/iccjpeg" + "third_party/inspector_protocol" + "third_party/jinja2" + "third_party/jstemplate" + "third_party/khronos" + "third_party/leveldatabase" + "third_party/libXNVCtrl" + "third_party/libaddressinput" + "third_party/libaom" + "third_party/libjingle_xmpp" + "third_party/libphonenumber" + "third_party/libsecret" ;FIXME: needs pkg-confi= g support. + "third_party/libsrtp" + "third_party/libsync" ;TODO: package + "third_party/libudev" + "third_party/libwebm" + "third_party/libxml" + "third_party/libyuv" + "third_party/lss" + "third_party/markupsafe" + "third_party/mesa" + "third_party/metrics_proto" + "third_party/modp_b64" + "third_party/node" + (string-append "third_party/node/node_modules/" + "polymer-bundler/lib/third_party= /UglifyJS2") + "third_party/ots" + ;; TODO: Build as extension. + "third_party/pdfium" + "third_party/pdfium/third_party/agg23" + "third_party/pdfium/third_party/base" + "third_party/pdfium/third_party/bigint" + "third_party/pdfium/third_party/skia_shared" + (string-append "third_party/pdfium/third_party/= freetype" + "/include/pstables.h") + "third_party/perfetto" + "third_party/ply" + "third_party/polymer" + "third_party/protobuf" + "third_party/protobuf/third_party/six" + "third_party/pyjson5" + "third_party/qcms" + "third_party/rnnoise" + "third_party/sfntly" + "third_party/skia" + "third_party/skia/third_party/skcms" + "third_party/skia/third_party/vulkan" + "third_party/skia/third_party/gif" + "third_party/smhasher" + "third_party/speech-dispatcher" + "third_party/sqlite" + "third_party/swiftshader" + "third_party/swiftshader/third_party/llvm-subze= ro" + "third_party/swiftshader/third_party/subzero" + "third_party/s2cellid" + "third_party/usb_ids" + "third_party/usrsctp" + "third_party/WebKit" + "third_party/web-animations-js" + "third_party/webrtc" + "third_party/webrtc_overrides" + "third_party/widevine/cdm/widevine_cdm_version.= h" + "third_party/widevine/cdm/widevine_cdm_common.h" + "third_party/woff2" + "third_party/xdg-utils" + "third_party/yasm/run_yasm.py" + "third_party/zlib/google" + "url/third_party/mozilla" + "v8/src/third_party/utf8-decoder" + "v8/src/third_party/valgrind" + "v8/third_party/antlr4" + "v8/third_party/inspector_protocol")))) + + (define (empty? dir) + (equal? (scandir dir) '("." ".."))) + + (define (third_party? file) + (if (string-contains file "third_party/") + #t + #f)) + + (define (useless? file) + (any (cute string-suffix? <> file) + '(".tar.gz" ".zip" ".exe" ".jar"))) + + (define (parents child) + (let ((lst (reverse (string-split child #\/)))) + (let loop ((hierarchy lst) + (result '())) + (if (or (null? hierarchy) + (and (not (null? result)) + (string-suffix? "third_party" (car = result)))) + result + (loop (cdr hierarchy) + (cons (string-join (reverse hierarchy)= "/") + result)))))) + + (define (delete-unwanted-files child stat flag base le= vel) + (let ((protected (make-regexp "\\.(gn|gyp)i?$"))) + (match flag + ((or 'regular 'symlink 'stale-symlink) + (when (third_party? child) + (unless (or (member child preserved-club) + (any (cute member <> preserved-cl= ub) + (parents child)) + (regexp-exec protected child)) + (format (current-error-port) "deleting ~s~%= " child) + (delete-file child))) + (when (and (useless? child) (file-exists? child= )) + (delete-file child)) + #t) + ('directory-processed + (when (empty? child) + (rmdir child)) + #t) + (_ #t)))) + + (nftw "." delete-unwanted-files 'depth 'physical) + + ;; Assert that each listed item is present to catch re= movals. + (for-each (lambda (third-party) + (unless (file-exists? third-party) + (error (format #f "~s does not exist!" t= hird-party)))) + preserved-club) + + ;; Replace "GN" files from third_party with shims for + ;; building against system libraries. Keep this list = in + ;; sync with "build/linux/unbundle/replace_gn_files.py= ". + (for-each (lambda (pair) + (let ((source (string-append + "build/linux/unbundle/" (ca= r pair))) + (dest (cdr pair))) + (copy-file source dest))) + (list + '("ffmpeg.gn" . "third_party/ffmpeg/BUILD.g= n") + '("flac.gn" . "third_party/flac/BUILD.gn") + '("fontconfig.gn" . "third_party/fontconfig= /BUILD.gn") + '("freetype.gn" . "build/config/freetype/fr= eetype.gni") + '("harfbuzz-ng.gn" . + "third_party/harfbuzz-ng/harfbuzz.gni") + '("icu.gn" . "third_party/icu/BUILD.gn") + '("libdrm.gn" . "third_party/libdrm/BUILD.g= n") + '("libevent.gn" . "base/third_party/libeven= t/BUILD.gn") + '("libjpeg.gn" . "third_party/libjpeg.gni") + '("libpng.gn" . "third_party/libpng/BUILD.g= n") + '("libvpx.gn" . "third_party/libvpx/BUILD.g= n") + '("libwebp.gn" . "third_party/libwebp/BUILD= .gn") + '("libxml.gn" . "third_party/libxml/BUILD.g= n") + '("libxslt.gn" . "third_party/libxslt/BUILD= .gn") + '("openh264.gn" . "third_party/openh264/BUI= LD.gn") + '("opus.gn" . "third_party/opus/BUILD.gn") + '("re2.gn" . "third_party/re2/BUILD.gn") + '("snappy.gn" . "third_party/snappy/BUILD.g= n") + '("yasm.gn" . "third_party/yasm/yasm_assemb= le.gni") + '("zlib.gn" . "third_party/zlib/BUILD.gn"))) + #t))))) + (build-system gnu-build-system) + (arguments + `(#:tests? #f + ;; FIXME: There is a "gn" option specifically for setting -rpath, b= ut + ;; it overrides the RUNPATH set by the linker. + #:validate-runpath? #f + #:modules ((guix build gnu-build-system) + (guix build utils) + (ice-9 ftw) + (ice-9 regex) + (srfi srfi-26)) + #:configure-flags + ;; See tools/gn/docs/cookbook.md and + ;; https://www.chromium.org/developers/gn-build-configuration + ;; for usage. Run "./gn args . --list" in the Release + ;; directory for an exhaustive list of supported flags. + ;; (Note: The 'configure' phase will do that for you.) + (list "is_debug=3Dfalse" + "use_gold=3Dfalse" + "use_lld=3Dfalse" + "linux_use_bundled_binutils=3Dfalse" + "use_custom_libcxx=3Dfalse" + "use_sysroot=3Dfalse" + "enable_precompiled_headers=3Dfalse" + "goma_dir=3D\"\"" + "enable_nacl=3Dfalse" + "enable_nacl_nonsfi=3Dfalse" + "use_allocator=3D\"none\"" ;don't use tcmalloc + "override_build_date=3D\"01 01 2000 05:00:00\"" + "use_unofficial_version_number=3Dfalse" + + ;; Disable "safe browsing", which pulls in a dependency on + ;; the nonfree "unrar" program (as of m66). + "safe_browsing_mode=3D0" + + ;; Define a custom toolchain that simply looks up CC, AR and + ;; friends from the environment. + "custom_toolchain=3D\"//build/toolchain/linux/unbundle:defaul= t\"" + "host_toolchain=3D\"//build/toolchain/linux/unbundle:default\= "" + + ;; Don't assume it's clang. + "is_clang=3Dfalse" + + ;; Optimize for building everything at once, as opposed to + ;; incrementally for development. See "docs/jumbo.md". + "use_jumbo_build=3Dtrue" + + ;; Disable debugging features to save space. + "symbol_level=3D0" + "remove_webcore_debug_symbols=3Dtrue" + "enable_iterator_debugging=3Dfalse" + + ;; Some of the unbundled libraries throws deprecation + ;; warnings, etc. Ignore it. + "treat_warnings_as_errors=3Dfalse" + + ;; Don't add any API keys. End users can set them in the + ;; environment if desired. See + ;; . + "use_official_google_api_keys=3Dfalse" + + ;; Disable "field trials". + "fieldtrial_testing_like_official_build=3Dtrue" + + ;; Disable Chrome Remote Desktop (aka Chromoting). + "enable_remoting=3Dfalse" + + ;; Use system libraries where possible. + "use_system_freetype=3Dtrue" + "use_system_harfbuzz=3Dtrue" + "use_system_lcms2=3Dtrue" + "use_system_libjpeg=3Dtrue" + "use_system_libpng=3Dtrue" + "use_system_zlib=3Dtrue" + + "use_gnome_keyring=3Dfalse" ;deprecated by libsecret + "use_gtk3=3Dtrue" + "use_openh264=3Dtrue" + "use_xkbcommon=3Dtrue" + "use_pulseaudio=3Dtrue" + "link_pulseaudio=3Dtrue" + + ;; Don't arbitrarily restrict formats supported by system ffm= peg. + "proprietary_codecs=3Dtrue" + "ffmpeg_branding=3D\"Chrome\"" + + ;; WebRTC stuff. + "rtc_use_h264=3Dtrue" + ;; Don't use bundled sources. + "rtc_build_json=3Dfalse" + "rtc_build_libevent=3Dfalse" + "rtc_build_libvpx=3Dfalse" + "rtc_build_opus=3Dfalse" + "rtc_build_ssl=3Dfalse" + + "rtc_build_libsrtp=3Dtrue" ;FIXME: fails to find headers + "rtc_build_usrsctp=3Dtrue" ;TODO: package this + (string-append "rtc_jsoncpp_root=3D\"" + (assoc-ref %build-inputs "jsoncpp") + "/include/jsoncpp/json\"") + (string-append "rtc_ssl_root=3D\"" + (assoc-ref %build-inputs "openssl") + "/include/openssl\"")) + #:phases + (modify-phases %standard-phases + (add-after 'unpack 'patch-stuff + (lambda* (#:key inputs #:allow-other-keys) + (substitute* "printing/cups_config_helper.py" + (("cups_config =3D.*") + (string-append "cups_config =3D '" (assoc-ref inputs "cups= ") + "/bin/cups-config'\n"))) + + (substitute* + '("base/process/launch_posix.cc" + "base/third_party/dynamic_annotations/dynamic_annotatio= ns.c" + "sandbox/linux/seccomp-bpf/sandbox_bpf.cc" + "sandbox/linux/services/credentials.cc" + "sandbox/linux/services/namespace_utils.cc" + "sandbox/linux/services/syscall_wrappers.cc" + "sandbox/linux/syscall_broker/broker_host.cc") + (("include \"base/third_party/valgrind/") "include \"valgri= nd/")) + + (for-each (lambda (file) + (substitute* file + ;; Fix opus include path. + ;; Do not substitute opus_private.h. + (("#include \"opus\\.h\"") + "#include \"opus/opus.h\"") + (("#include \"opus_custom\\.h\"") + "#include \"opus/opus_custom.h\"") + (("#include \"opus_defines\\.h\"") + "#include \"opus/opus_defines.h\"") + (("#include \"opus_multistream\\.h\"") + "#include \"opus/opus_multistream.h\"") + (("#include \"opus_types\\.h\"") + "#include \"opus/opus_types.h\""))) + (find-files (string-append "third_party/webrtc/modu= les" + "/audio_coding/codecs/op= us"))) + + (substitute* "chrome/common/chrome_paths.cc" + (("/usr/share/chromium/extensions") + ;; TODO: Add ~/.guix-profile. + "/run/current-system/profile/share/chromium/extensions")) + + (substitute* + ;; XXX: Probably not needed for M69. + "third_party/blink/renderer/platform/image-encoders/image= _encoder.h" + (("#include \"third_party/libjpeg/") "#include \"") + (("#include \"third_party/libwebp/src/") "#include \"")) + + (substitute* + "third_party/breakpad/breakpad/src/common/linux/libcurl_w= rapper.h" + (("include \"third_party/curl") "include \"curl")) + (substitute* "media/base/decode_capabilities.cc" + (("third_party/libvpx/source/libvpx/") "")) + + #t)) + (add-before 'configure 'prepare-build-environment + (lambda* (#:key inputs #:allow-other-keys) + + ;; Make sure the right build tools are used. + (setenv "AR" "ar") (setenv "NM" "nm") + (setenv "CC" "gcc") (setenv "CXX" "g++") + + ;; Work around . + (unsetenv "C_INCLUDE_PATH") + (unsetenv "CPLUS_INCLUDE_PATH") + + ;; TODO: pre-compile instead. Avoids a race condition. + (setenv "PYTHONDONTWRITEBYTECODE" "1") + + ;; XXX: How portable is this. + (mkdir-p "third_party/node/linux/node-linux-x64") + (symlink (string-append (assoc-ref inputs "node") "/bin") + "third_party/node/linux/node-linux-x64/bin") + + #t)) + (add-after 'prepare-build-environment 'bootstrap-gn + (lambda _ + (invoke "python" "tools/gn/bootstrap/bootstrap.py" "-s" "-v")= )) + (replace 'configure + (lambda* (#:key configure-flags #:allow-other-keys) + (let ((args (string-join configure-flags " "))) + (with-directory-excursion "out/Release" + ;; Generate ninja build files. + (invoke "./gn" "gen" "." + (string-append "--args=3D" args)) + + ;; Print the full list of supported arguments as well as + ;; their current status for convenience. + (format #t "Dumping configure flags...\n") + (invoke "./gn" "args" "." "--list"))))) + (replace 'build + (lambda* (#:key outputs #:allow-other-keys) + (invoke "ninja" "-C" "out/Release" + "-j" (number->string (parallel-job-count)) + "chrome"))) + (replace 'install + (lambda* (#:key inputs outputs #:allow-other-keys) + (let* ((out (assoc-ref outputs "out")) + (bin (string-append out "/bin")) + (exe (string-append bin "/chromium")) + (lib (string-append out "/lib")) + (man (string-append out "/share/man/man1")) + (applications (string-append out "/share/application= s")) + (install-regexp (make-regexp "\\.(bin|pak)$")) + (locales (string-append lib "/locales")) + (resources (string-append lib "/resources")) + (preferences (assoc-ref inputs "master-preferences"= )) + (gtk+ (assoc-ref inputs "gtk+")) + (mesa (assoc-ref inputs "mesa")) + (nss (assoc-ref inputs "nss")) + (udev (assoc-ref inputs "udev")) + (sh (which "sh"))) + + (substitute* '("chrome/app/resources/manpage.1.in" + "chrome/installer/linux/common/desktop.templ= ate") + (("@@MENUNAME@@") "Chromium") + (("@@PACKAGE@@") "chromium") + (("/usr/bin/@@USR_BIN_SYMLINK_NAME@@") exe)) + + (mkdir-p man) + (copy-file "chrome/app/resources/manpage.1.in" + (string-append man "/chromium.1")) + + (mkdir-p applications) + (copy-file "chrome/installer/linux/common/desktop.template" + (string-append applications "/chromium.desktop")) + + (mkdir-p lib) + (copy-file preferences (string-append lib "/master_preferen= ces")) + + (with-directory-excursion "out/Release" + (for-each (lambda (file) + (install-file file lib)) + (scandir "." (cut regexp-exec install-regexp <>= ))) + (copy-file "chrome" (string-append lib "/chromium")) + + ;; TODO: Install icons from "../../chrome/app/themes" into + ;; "out/share/icons/hicolor/$size". + (install-file + "product_logo_48.png" + (string-append out "/share/icons/48x48/chromium.png")) + + (copy-recursively "locales" locales) + (copy-recursively "resources" resources) + + (mkdir-p bin) + ;; Add a thin wrapper to prevent the user from inadverten= tly + ;; installing non-free software through the Web Store. + ;; TODO: Discover extensions from the profile and pass + ;; something like "--disable-extensions-except=3D...". + (call-with-output-file exe + (lambda (port) + (format port + "#!~a~@ + if [ -z \"$CHROMIUM_ENABLE_WEB_STORE\" ]~@ + then~@ + CHROMIUM_FLAGS=3D\" \\~@ + --disable-background-networking \\~@ + --disable-extensions \\~@ + \"~@ + fi~@ + exec ~a $CHROMIUM_FLAGS \"$@\"~%" + sh (string-append lib "/chromium")))) + (chmod exe #o755) + + (wrap-program exe + ;; TODO: Get these in RUNPATH. + `("LD_LIBRARY_PATH" ":" prefix + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib:" + mesa "/lib:" udev "/lib"))) + ;; Avoid file manager crash. See . + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/sh= are")))) + #t))))))) + (native-inputs + `(("bison" ,bison) + ("gcc" ,gcc-8) ;a recent compiler is required + ("gperf" ,gperf) + ("ninja" ,ninja) + ("node" ,node) + ("pkg-config" ,pkg-config) + ("master-preferences" ,(local-file "chromium-master-preferences.jso= n")) + ("which" ,which) + ("yasm" ,yasm) + + ("python-beautifulsoup4" ,python2-beautifulsoup4) + ("python-html5lib" ,python2-html5lib) + ("python" ,python-2))) + (inputs + `(("alsa-lib" ,alsa-lib) + ("atk" ,atk) + ("cups" ,cups) + ("curl" ,curl) + ("dbus" ,dbus) + ("dbus-glib" ,dbus-glib) + ("expat" ,expat) + ("flac" ,flac) + ("ffmpeg" ,ffmpeg) + ("fontconfig" ,fontconfig) + ("freetype" ,freetype) + ("gdk-pixbuf" ,gdk-pixbuf) + ("glib" ,glib) + ("gtk+" ,gtk+) + ("harfbuzz" ,harfbuzz) + ("icu4c" ,icu4c) + ("jsoncpp" ,jsoncpp) + ("lcms" ,lcms) + ("libevent" ,libevent) + ("libffi" ,libffi) + ("libjpeg-turbo" ,libjpeg-turbo) + ("libpng" ,libpng) + ;;("libsrtp" ,libsrtp) + ("libvpx" ,libvpx/chromium) + ("libwebp" ,libwebp) + ("libx11" ,libx11) + ("libxcb" ,libxcb) + ("libxcomposite" ,libxcomposite) + ("libxcursor" ,libxcursor) + ("libxdamage" ,libxdamage) + ("libxext" ,libxext) + ("libxfixes" ,libxfixes) + ("libxi" ,libxi) + ("libxkbcommon" ,libxkbcommon) + ("libxml2" ,libxml2) + ("libxrandr" ,libxrandr) + ("libxrender" ,libxrender) + ("libxscrnsaver" ,libxscrnsaver) + ("libxslt" ,libxslt) + ("libxtst" ,libxtst) + ("mesa" ,mesa) + ("minizip" ,minizip) + ("mit-krb5" ,mit-krb5) + ("nss" ,nss) + ("openh264" ,openh264) + ("openjpeg" ,openjpeg) ;PDFium only + ("openssl" ,openssl) + ("opus" ,opus+custom) + ("pango" ,pango) + ("pciutils" ,pciutils) + ("pulseaudio" ,pulseaudio) + ("re2" ,re2) + ("snappy" ,snappy) + ("speech-dispatcher" ,speech-dispatcher) + ("udev" ,eudev) + ("valgrind" ,valgrind))) + (home-page "https://www.chromium.org/") + (description + "Chromium is a web browser designed for speed and security. This +version incorporates features from +@url{https://github.com/gcarq/inox-patchset,the Inox patchset} and +@url{https://github.com/Eloston/ungoogled-chromium,ungoogled-chromium} in +order to protect the users privacy.") + ;; Chromium is developed as BSD-3, but bundles a large number of third= -party + ;; components with other licenses. For full information, see chrome:/= /credits. + (license (list license:bsd-3 + license:bsd-2 + license:expat + license:asl2.0 + license:mpl2.0 + license:public-domain + license:lgpl2.1+)))) diff --git a/gnu/packages/patches/chromium-gcc-unique-ptr.patch b/gnu/packa= ges/patches/chromium-gcc-unique-ptr.patch new file mode 100644 index 000000000..9c9a9fc09 =2D-- /dev/null +++ b/gnu/packages/patches/chromium-gcc-unique-ptr.patch @@ -0,0 +1,33 @@ +Help GCC resolve . + +Taken from upstream: +https://chromium.googlesource.com/chromium/src/+/56cb5f7da1025f6db869e840e= d34d3b98b9ab899 + +diff --git a/components/bookmarks/browser/bookmark_storage.cc b/components= /bookmarks/browser/bookmark_storage.cc +index 1633ba1..3ae0c62 100644 +--- a/components/bookmarks/browser/bookmark_storage.cc ++++ b/components/bookmarks/browser/bookmark_storage.cc +@@ -158,6 +158,10 @@ + url_index_ =3D std::make_unique(std::move(root_node_)); + } +=20 ++std::unique_ptr BookmarkLoadDetails::owned_url_index() { ++ return std::move(url_index_); ++} ++ + BookmarkPermanentNode* BookmarkLoadDetails::CreatePermanentNode( + BookmarkClient* client, + BookmarkNode::Type type) { +diff --git a/components/bookmarks/browser/bookmark_storage.h b/components/= bookmarks/browser/bookmark_storage.h +index 08df5bb..0a1b1a1 100644 +--- a/components/bookmarks/browser/bookmark_storage.h ++++ b/components/bookmarks/browser/bookmark_storage.h +@@ -104,7 +104,7 @@ + bool ids_reassigned() const { return ids_reassigned_; } +=20 + void CreateUrlIndex(); +- std::unique_ptr owned_url_index() { return std::move(url_inde= x_); } ++ std::unique_ptr owned_url_index(); +=20 + private: + // Creates one of the possible permanent nodes (bookmark bar node, othe= r node diff --git a/gnu/packages/patches/chromium-remove-default-history.patch b/g= nu/packages/patches/chromium-remove-default-history.patch new file mode 100644 index 000000000..42363805b =2D-- /dev/null +++ b/gnu/packages/patches/chromium-remove-default-history.patch @@ -0,0 +1,13 @@ +Don't pre-populate the New Tab Page for new profiles. + +--- a/chrome/browser/history/top_sites_factory.cc ++++ b/chrome/browser/history/top_sites_factory.cc +@@ -74,7 +74,7 @@ +=20 + void InitializePrepopulatedPageList( + history::PrepopulatedPageList* prepopulated_pages) { +-#if !defined(OS_ANDROID) ++#if 0 + DCHECK(prepopulated_pages); + prepopulated_pages->reserve(arraysize(kRawPrepopulatedPages)); + for (size_t i =3D 0; i < arraysize(kRawPrepopulatedPages); ++i) { =2D-=20 2.18.0 --=-=-=-- --==-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAltm9dMACgkQoqBt8qM6 VPqK3AgAj9raw4PmBXnyC+2pmJf//9JtIA+7EDmpfs56Z/bXZ4HXVAZ1dZtm/IQA ybxiqBLAOmFnTWk/Msy5HcsSEp3hjl0WbF4JEzpYqgLQMk75REZjKwSLsJFbhl04 LgtXzfmK89YpHD3jQFbaopGniowA9n0EpjnLXBggbwm2LthkG7uk9G35dz2xJd6U NjO6w+3p4h2rcZHcMy9qie/kYZzidnL4bDoivZ7CJXE/2MXTKfcIiOUDBWLT2Hix FMDBCimSdoEHPaVG4f0JWWsPa072SL0rUfKPh0Afg2OtzhaRJgJ5nCnu5u0nqH9d 4FF4LLxJi89nSr4uimRCUaAdcg5AWw== =G8kc -----END PGP SIGNATURE----- --==-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sun Aug 05 12:17:30 2018 Received: (at 28004) by debbugs.gnu.org; 5 Aug 2018 16:17:30 +0000 Received: from localhost ([127.0.0.1]:42028 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fmLic-00072D-J2 for submit@debbugs.gnu.org; Sun, 05 Aug 2018 12:17:30 -0400 Received: from static.195.114.201.195.clients.your-server.de ([195.201.114.195]:47370 helo=conspiracy.of.n0.is) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fmLiZ-000723-7N for 28004@debbugs.gnu.org; Sun, 05 Aug 2018 12:17:21 -0400 Received: by conspiracy.of.n0.is (OpenSMTPD) with ESMTPSA id 82773ab2 (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256:NO); Sun, 5 Aug 2018 16:17:16 +0000 (UTC) Date: Sun, 5 Aug 2018 16:18:02 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180805161802.bif4ax5feqloxayz@abyayala> References: <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> <20180316173044.dctlydfij7smndxd@abyayala> <87h8pfc3tr.fsf@fastmail.com> <20180316175225.7jf4k2qaciyxnepp@abyayala> <20180725080800.stqijlny6om6powe@abyayala> <87tvo9c6cs.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="4ntk4dcfcdzb4lwe" Content-Disposition: inline In-Reply-To: <87tvo9c6cs.fsf@fastmail.com> X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --4ntk4dcfcdzb4lwe Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 47K bytes: > ng0 writes: >=20 > > Hi Marius, > > > > any chance you had the time to update to a more recent version release > > of Chromium? >=20 > Good news! Please find Chromium 68 attached. Cool :) I was halfway through updating chromium myself before you've sent this. > There are *a lot* of changes in this version. Some highlights: >=20 > * It's using GCC 8 instead of Clang. > * A bug in the source scrubber has been fixed, so .zip and .jar files > are now purged even if the parent directory is preserved. Currently > we're reducing the uncompressed size from 4.3 GiB to 2.1 GiB. > * External patches are now in an easier to manage format. > * Upstream have discontinued the libvpx "experiment"; but still > require an unreleased version. > * We're installing a "master_preferences" file, which allows us to > easily add defaults for new profiles. > * All the various knobs for the build system have been moved to > #:configure-flags. This should make it easier to create custom > Chromium variants based on this package (qtwebkit?). > * The 'configure' phase will now print *all* supported flags for > convenience (I usually did this manually every now and then). > * I've started cherry-picking patches from Ungoogled-Chromium in the > quest to reduce data transmission to Google. >=20 > TODO: >=20 > * There is still some data transmitted when starting the browser for the > first time. It seems related to the "domain_reliability" component. > * Remove remaining "Web Store" links. Currently I've only found it in > settings, under "accessibility" and "fonts". > * Opening settings transmits a bunch of data, the next version will > include the 'disable-translation-lang-fetch' patch from Inox. > * PDFium is built, but does not seem to work (the 'install' phase > probably needs tweaking). Might just disable it instead. NixOS' nixpkgs has a patch for making their chromium build to take packaged extensions and addons. This is not everything which is required to make it work, but given enough time to think it through it should be doable. > As always, feedback very welcome. Enjoy! >=20 > From a4e343c57d70344dd4cef51ccd37c2650c746b46 Mon Sep 17 00:00:00 2001 > From: Marius Bakke > Date: Wed, 12 Oct 2016 17:25:05 +0100 > Subject: [PATCH] gnu: Add chromium. >=20 > * gnu/packages/chromium.scm, gnu/packages/chromium-master-preferences.jso= n, > gnu/packages/patches/chromium-gcc-unique-ptr.patch, > gnu/packages/patches/chromium-remove-default-history.patch: New files. > * gnu/local.mk: Record it. > --- > gnu/local.mk | 3 + > gnu/packages/chromium-master-preferences.json | 26 + > gnu/packages/chromium.scm | 829 ++++++++++++++++++ > .../patches/chromium-gcc-unique-ptr.patch | 33 + > .../chromium-remove-default-history.patch | 13 + > 5 files changed, 904 insertions(+) > create mode 100644 gnu/packages/chromium-master-preferences.json > create mode 100644 gnu/packages/chromium.scm > create mode 100644 gnu/packages/patches/chromium-gcc-unique-ptr.patch > create mode 100644 gnu/packages/patches/chromium-remove-default-history.= patch >=20 > diff --git a/gnu/local.mk b/gnu/local.mk > index 4ed341df8..320f27c44 100644 > --- a/gnu/local.mk > +++ b/gnu/local.mk > @@ -95,6 +95,7 @@ GNU_SYSTEM_MODULES =3D \ > %D%/packages/check.scm \ > %D%/packages/chemistry.scm \ > %D%/packages/chez.scm \ > + %D%/packages/chromium.scm \ > %D%/packages/ci.scm \ > %D%/packages/cinnamon.scm \ > %D%/packages/cluster.scm \ > @@ -603,6 +604,8 @@ dist_patch_DATA =3D \ > %D%/packages/patches/ceph-skip-collect-sys-info-test.patch \ > %D%/packages/patches/ceph-skip-unittest_blockdev.patch \ > %D%/packages/patches/chmlib-inttypes.patch \ > + %D%/packages/patches/chromium-gcc-unique-ptr.patch \ > + %D%/packages/patches/chromium-remove-default-history.patch \ > %D%/packages/patches/clang-3.5-libc-search-path.patch \ > %D%/packages/patches/clang-3.8-libc-search-path.patch \ > %D%/packages/patches/clang-6.0-libc-search-path.patch \ > diff --git a/gnu/packages/chromium-master-preferences.json b/gnu/packages= /chromium-master-preferences.json > new file mode 100644 > index 000000000..0caa7cc4c > --- /dev/null > +++ b/gnu/packages/chromium-master-preferences.json > @@ -0,0 +1,26 @@ > +{ > + "distribution": { > + "import_bookmarks": false, > + "make_chrome_default": false, > + "make_chrome_default_for_user": false, > + "verbose_logging": true, > + "skip_first_run_ui": true, > + "suppress_first_run_default_browser_prompt": true > + }, > + "browser": { > + "has_seen_welcome_page" : true, > + "check_default_browser" : false > + }, > + "dns_prefetching": { > + "enabled": false > + }, > + "alternate_error_pages": { > + "enabled": false > + }, > + "hardware": { > + "audio_capture_enabled": false > + }, > + "default_apps": "noinstall", > + "hide_web_store_icon": true, > + "homepage": "https://www.gnu.org/software/guix" > +} > diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm > new file mode 100644 > index 000000000..2fc40a0d2 > --- /dev/null > +++ b/gnu/packages/chromium.scm > @@ -0,0 +1,829 @@ > +;;; GNU Guix --- Functional package management for GNU > +;;; Copyright =C2=A9 2016, 2017, 2018 Marius Bakke > +;;; > +;;; This file is part of GNU Guix. > +;;; > +;;; GNU Guix is free software; you can redistribute it and/or modify it > +;;; under the terms of the GNU General Public License as published by > +;;; the Free Software Foundation; either version 3 of the License, or (at > +;;; your option) any later version. > +;;; > +;;; GNU Guix is distributed in the hope that it will be useful, but > +;;; WITHOUT ANY WARRANTY; without even the implied warranty of > +;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the > +;;; GNU General Public License for more details. > +;;; > +;;; You should have received a copy of the GNU General Public License > +;;; along with GNU Guix. If not, see . > + > +(define-module (gnu packages chromium) > + #:use-module ((guix licenses) #:prefix license:) > + #:use-module (guix packages) > + #:use-module (guix gexp) > + #:use-module (guix download) > + #:use-module (guix git-download) > + #:use-module (guix utils) > + #:use-module (guix build-system gnu) > + #:use-module (gnu packages) > + #:use-module (gnu packages assembly) > + #:use-module (gnu packages base) > + #:use-module (gnu packages bison) > + #:use-module (gnu packages compression) > + #:use-module (gnu packages cups) > + #:use-module (gnu packages curl) > + #:use-module (gnu packages fontutils) > + #:use-module (gnu packages gcc) > + #:use-module (gnu packages ghostscript) > + #:use-module (gnu packages gl) > + #:use-module (gnu packages glib) > + #:use-module (gnu packages gnome) > + #:use-module (gnu packages gnuzilla) > + #:use-module (gnu packages gperf) > + #:use-module (gnu packages gtk) > + #:use-module (gnu packages icu4c) > + #:use-module (gnu packages image) > + #:use-module (gnu packages libevent) > + #:use-module (gnu packages libffi) > + #:use-module (gnu packages linux) > + #:use-module (gnu packages kerberos) > + #:use-module (gnu packages ninja) > + #:use-module (gnu packages node) > + #:use-module (gnu packages pciutils) > + #:use-module (gnu packages pkg-config) > + #:use-module (gnu packages pulseaudio) > + #:use-module (gnu packages python) > + #:use-module (gnu packages python-web) > + #:use-module (gnu packages regex) > + #:use-module (gnu packages serialization) > + #:use-module (gnu packages speech) > + #:use-module (gnu packages tls) > + #:use-module (gnu packages valgrind) > + #:use-module (gnu packages video) > + #:use-module (gnu packages xiph) > + #:use-module (gnu packages xml) > + #:use-module (gnu packages xdisorg) > + #:use-module (gnu packages xorg)) > + > +(define (chromium-patch-file-name pathspec) > + (let ((patch-name (basename pathspec))) > + (if (string-prefix? "chromium-" patch-name) > + patch-name > + (string-append "chromium-" patch-name)))) > + > +;; https://salsa.debian.org/chromium-team/chromium/tree/master/debian/pa= tches > +(define (debian-patch pathspec revision hash) > + (origin > + (method url-fetch) > + (uri (string-append > + "https://salsa.debian.org/chromium-team/chromium/raw/" > + revision "/debian/patches/" pathspec)) > + (sha256 (base32 hash)) > + (file-name (chromium-patch-file-name pathspec)))) > + > +;; https://gitweb.gentoo.org/repo/gentoo.git/tree/www-client/chromium/fi= les > +(define (gentoo-patch pathspec revision hash) > + (origin > + (method url-fetch) > + (uri (string-append > + "https://gitweb.gentoo.org/repo/gentoo.git/plain/www-client" > + "/chromium/files/" pathspec "?id=3D" revision)) > + (sha256 (base32 hash)) > + (file-name (chromium-patch-file-name pathspec)))) > + > +;; https://github.com/gcarq/inox-patchset > +(define (inox-patch pathspec revision hash) > + (origin > + (method url-fetch) > + (uri (string-append "https://raw.githubusercontent.com/gcarq/inox-pa= tchset/" > + revision "/" pathspec)) > + (sha256 (base32 hash)) > + (file-name (chromium-patch-file-name pathspec)))) > + > +;; https://github.com/Eloston/ungoogled-chromium > +(define (ungoogled-patch pathspec revision hash) > + (origin > + (method url-fetch) > + (uri (string-append "https://raw.githubusercontent.com/Eloston" > + "/ungoogled-chromium/" revision "/resources" > + "/patches/ungoogled-chromium/" pathspec)) > + (sha256 (base32 hash)) > + (file-name (chromium-patch-file-name pathspec)))) > + > +;; XXX: It would be great to have (upstream-patch ...), but the API > +;; at can only return > +;; base64-encoded patches. > + > +(define %debian-revision "debian/68.0.3440.75-2") > +(define %gentoo-revision "a79be956bb7bbeaca245564ecb4a350b1203ca98") > +(define %inox-revision "8afa26a5ffb2e8ff52ac5b7bbdccc9f09290120e") > +(define %ungoogled-revision "55d1a2442dcd9efc574f6c4fa99804d5b8658e4e") > + > +(define %debian-patches > + (list > + ;; Bootstrap "GN" using system NSPR. > + (debian-patch "system/nspr.patch" %debian-revision > + "0xywgsq14xdpfdf0wb5plv5jy2738zbwj7caj2i5g9s5zpdclhsv") > + ;; Ditto for system libevent. > + (debian-patch "system/event.patch" %debian-revision > + "0cq5kz5yi737vb3k8v67hrr38czqm3mj6g3swh765pmfzvx5inj6") > + ;; Make PDFium use system OpenJPEG. > + (debian-patch "system/openjpeg.patch" %debian-revision > + "0fxvbfvmimg0ykzhsk3l0kyvhz1fgbys51ldh950106yj6dszsmx") > + ;; Make "Courgette" use system zlib instead of the bundled lzma. > + (debian-patch "system/zlib.patch" %debian-revision > + "1fmkiw7xrhwadvjxkzpv8j5iih2ws59l3llsdrpapw1vybfyq9nr") > + ;; Avoid dependency on Chromiums embedded libc++ when bootstrapping. > + (debian-patch "gn/libcxx.patch" %debian-revision > + "02w94h9jd29jyvq09yxl9g31hk8j07qzr7rg23rhibhkn1rvg38x") > + ;; Avoid dependency on Android tools. > + (debian-patch "disable/android.patch" %debian-revision > + "06kxx1fx9yi52h2fka71i9qqp6jh4r3w890k77nihv8arnabc0nq") > + ;; Do not show a warning about missing API keys. > + (debian-patch "disable/google-api-warning.patch" %debian-revision > + "0vqi3n8i1vkp2cxmza7c60fl6d03195sax0ahrk1ksa04xjbkkqv") > + ;; Don't override the home page set in master_preferences. > + (debian-patch "disable/welcome-page.patch" %debian-revision > + "15c6a296mkqnjdqqq90kmapn56rykb7saz4bs16han6by8q07lbx")= )) > + > +(define %gentoo-patches > + (list > + ;; Fix error detecting system ffmpeg. > + (gentoo-patch "chromium-ffmpeg-r1.patch" %gentoo-revision > + "1pivcdmana4qx8sngcdpr858l0qh6bygv7azj66vg021phq5725a") > + ;; Add missing #include. > + (gentoo-patch "chromium-cors-string-r0.patch" %gentoo-revision > + "075lgl6g8rih21adsr3hf2mm0qm16s4w2h4h1qjh652sl941w57l")= )) > + > +(define %inox-patches > + (list > + ;; Fix build without the "safe browsing" feature. > + (inox-patch "0001-fix-building-without-safebrowsing.patch" %inox-revi= sion > + "0qchqc3i772drx0c8n44yhkx45fgdvd0h325w0qvaqrakzixbmr4") > + ;; Use sane defaults. In particular, don't depend on any Google serv= ices. > + (inox-patch "0006-modify-default-prefs.patch" %inox-revision > + "0sbvs6l80h8ar8na6065ihqnmcsr1b4zc21jcs2wzkrjlxsgspw6") > + ;; Recent versions of Chromium may load a remote search engine on the= "New > + ;; Tab Page", which causes unnecessary and involuntary network traffi= c. > + (inox-patch "0008-restore-classic-ntp.patch" %inox-revision > + "16z5accrri90s922n1r6nj8rqss3g7f579dwwzkk2hdxbkc9wzyr") > + ;; Add DuckDuckGo and use it as the default search engine. > + (inox-patch "0011-add-duckduckgo-search-engine.patch" %inox-revision > + "0mvw1ax0gw3d252c9b1pwbk0j7ny8z9nsfywcmhj56wm6yksgpkg") > + ;; Don't start a "Login Wizard" at first launch. > + (inox-patch "0018-disable-first-run-behaviour.patch" %inox-revision > + "1y4zsqqf2125jkb1phwy9g5hcbd9xhyv5lr4xcaly66rpdzx2ayb"))) > + > +(define %ungoogled-patches > + (list > + ;; Disable browser sign-in to prevent leaking data at launch. > + (ungoogled-patch "disable-signin.patch" %ungoogled-revision > + "0a6akb10bzk6z6nhqa211y8rbj0ibdhhg5n92482q9sikavd8hz= 0"))) > + > +(define opus+custom > + (package (inherit opus) > + (name "opus+custom") > + (arguments > + (substitute-keyword-arguments (package-arguments opus) > + ((#:configure-flags flags ''()) > + ;; Opus Custom is an optional extension of the Opus > + ;; specification that allows for unsupported frame > + ;; sizes. Chromium requires that this is enabled. > + `(cons "--enable-custom-modes" > + ,flags)))))) > + > +(define libvpx/chromium > + ;; Chromium 66 and later requires an unreleased libvpx, so we take the > + ;; commit from "third_party/libvpx/README.chromium" in the tarball. > + ;; XXX: Might as well reuse Chromium source. > + (let ((version (package-version libvpx)) > + (commit "e27a331778c4c99ec37262ea786a3b4cc2a491ac") > + (revision "0")) > + (package > + (inherit libvpx) > + (name "libvpx-chromium") > + (version (git-version version revision commit)) > + (source (origin > + (method git-fetch) > + (uri (git-reference > + (url "https://chromium.googlesource.com/webm/libvp= x") > + (commit commit))) > + (file-name (git-file-name name version)) > + (sha256 > + (base32 > + "03a0443dnfn6l2v19qpw7p7k29v98c5b5hl4br93czgq0wi29m1g"= ))))))) > + > +(define-public chromium > + (package > + (name "chromium") > + (version "68.0.3440.84") > + (synopsis "Graphical web browser") > + (source (origin > + (method url-fetch) > + (uri (string-append "https://commondatastorage.googleapis.= com" > + "/chromium-browser-official/chromium-" > + version ".tar.xz")) > + (sha256 > + (base32 > + "1nf9xha7ncnh8g1g4c8hzk03f8ya7nd0xzwij9zs7n0qmrkx2c8h")) > + (patches (append %debian-patches > + %gentoo-patches > + %inox-patches > + %ungoogled-patches > + (search-patches "chromium-gcc-unique-ptr.= patch" > + "chromium-remove-default-= history.patch"))) > + (modules '((srfi srfi-1) > + (srfi srfi-26) > + (ice-9 ftw) > + (ice-9 match) > + (ice-9 regex) > + (guix build utils))) > + (snippet > + '(begin > + (let ((preserved-club Once we merge this into master, can we document the update procedure? Or even better, write an update script if possible? For me it was 40% hit everything which doesn't move and take what's left over and 60% reading. I understand the code, but some people might want an explanation for how it's decided which folder gets to stay. > + (map > + (lambda (path) > + ;; Prepend paths with "./" for comparison wi= th ftw. > + (string-append "./" path)) > + (list > + "base/third_party/dmg_fp" > + "base/third_party/dynamic_annotations" > + "base/third_party/icu" > + "base/third_party/superfasthash" > + "base/third_party/symbolize" > + "base/third_party/xdg_mime" > + "base/third_party/xdg_user_dirs" > + "chrome/third_party/mozilla_security_manager" > + "courgette/third_party/bsdiff" > + "courgette/third_party/divsufsort" > + "net/third_party/http2" > + "net/third_party/mozilla_security_manager" > + "net/third_party/nss" > + "net/third_party/spdy" > + "net/third_party/quic" > + "third_party/adobe/flash/flapper_version.h" > + ;; FIXME: This is used in: > + ;; * ui/webui/resources/js/analytics.js > + ;; * ui/file_manager/ > + "third_party/analytics" > + "third_party/angle" > + "third_party/angle/src/common/third_party/bas= e" > + "third_party/angle/src/common/third_party/smh= asher" > + "third_party/angle/src/third_party/compiler" > + "third_party/angle/src/third_party/libXNVCtrl" > + "third_party/angle/src/third_party/trace_even= t" > + "third_party/angle/third_party/glslang" > + "third_party/angle/third_party/spirv-headers" > + "third_party/angle/third_party/spirv-tools" > + "third_party/angle/third_party/vulkan-validat= ion-layers" > + "third_party/apple_apsl" ;XXX add APSL2.0 lic= ense > + "third_party/blink" > + "third_party/boringssl" > + "third_party/boringssl/src/third_party/fiat" > + "third_party/breakpad" > + "third_party/brotli" > + "third_party/cacheinvalidation" > + "third_party/catapult" > + "third_party/catapult/common/py_vulcanize/thi= rd_party/rcssmin" > + "third_party/catapult/common/py_vulcanize/thi= rd_party/rjsmin" > + "third_party/catapult/third_party/polymer" > + "third_party/catapult/tracing/third_party/d3" > + "third_party/catapult/tracing/third_party/gl-= matrix" > + "third_party/catapult/tracing/third_party/jsz= ip" > + "third_party/catapult/tracing/third_party/man= nwhitneyu" > + "third_party/catapult/tracing/third_party/obo= e" > + "third_party/catapult/tracing/third_party/pak= o" > + "third_party/ced" > + "third_party/cld_3" > + "third_party/crashpad" > + (string-append "third_party/crashpad/crashpad= /" > + "third_party/zlib/zlib_crashpa= d.h") > + "third_party/crc32c" > + "third_party/cros_system_api" > + "third_party/dom_distiller_js" > + "third_party/fips181" > + "third_party/flatbuffers" > + "third_party/glslang-angle" > + "third_party/google_input_tools" > + "third_party/google_input_tools/third_party/c= losure_library" > + (string-append "third_party/google_input_tool= s/third_party" > + "/closure_library/third_party/= closure") > + "third_party/googletest" > + "third_party/hunspell" > + "third_party/iccjpeg" > + "third_party/inspector_protocol" > + "third_party/jinja2" > + "third_party/jstemplate" > + "third_party/khronos" > + "third_party/leveldatabase" > + "third_party/libXNVCtrl" > + "third_party/libaddressinput" > + "third_party/libaom" > + "third_party/libjingle_xmpp" > + "third_party/libphonenumber" > + "third_party/libsecret" ;FIXME: needs pkg-con= fig support. > + "third_party/libsrtp" > + "third_party/libsync" ;TODO: package > + "third_party/libudev" > + "third_party/libwebm" > + "third_party/libxml" > + "third_party/libyuv" > + "third_party/lss" > + "third_party/markupsafe" > + "third_party/mesa" > + "third_party/metrics_proto" > + "third_party/modp_b64" > + "third_party/node" > + (string-append "third_party/node/node_modules= /" > + "polymer-bundler/lib/third_par= ty/UglifyJS2") > + "third_party/ots" > + ;; TODO: Build as extension. > + "third_party/pdfium" > + "third_party/pdfium/third_party/agg23" > + "third_party/pdfium/third_party/base" > + "third_party/pdfium/third_party/bigint" > + "third_party/pdfium/third_party/skia_shared" > + (string-append "third_party/pdfium/third_part= y/freetype" > + "/include/pstables.h") > + "third_party/perfetto" > + "third_party/ply" > + "third_party/polymer" > + "third_party/protobuf" > + "third_party/protobuf/third_party/six" > + "third_party/pyjson5" > + "third_party/qcms" > + "third_party/rnnoise" > + "third_party/sfntly" > + "third_party/skia" > + "third_party/skia/third_party/skcms" > + "third_party/skia/third_party/vulkan" > + "third_party/skia/third_party/gif" > + "third_party/smhasher" > + "third_party/speech-dispatcher" > + "third_party/sqlite" > + "third_party/swiftshader" > + "third_party/swiftshader/third_party/llvm-sub= zero" > + "third_party/swiftshader/third_party/subzero" > + "third_party/s2cellid" > + "third_party/usb_ids" > + "third_party/usrsctp" > + "third_party/WebKit" > + "third_party/web-animations-js" > + "third_party/webrtc" > + "third_party/webrtc_overrides" > + "third_party/widevine/cdm/widevine_cdm_versio= n.h" > + "third_party/widevine/cdm/widevine_cdm_common= =2Eh" > + "third_party/woff2" > + "third_party/xdg-utils" > + "third_party/yasm/run_yasm.py" > + "third_party/zlib/google" > + "url/third_party/mozilla" > + "v8/src/third_party/utf8-decoder" > + "v8/src/third_party/valgrind" > + "v8/third_party/antlr4" > + "v8/third_party/inspector_protocol")))) > + > + (define (empty? dir) > + (equal? (scandir dir) '("." ".."))) > + > + (define (third_party? file) > + (if (string-contains file "third_party/") > + #t > + #f)) > + > + (define (useless? file) > + (any (cute string-suffix? <> file) > + '(".tar.gz" ".zip" ".exe" ".jar"))) > + > + (define (parents child) > + (let ((lst (reverse (string-split child #\/)))) > + (let loop ((hierarchy lst) > + (result '())) > + (if (or (null? hierarchy) > + (and (not (null? result)) > + (string-suffix? "third_party" (ca= r result)))) > + result > + (loop (cdr hierarchy) > + (cons (string-join (reverse hierarch= y) "/") > + result)))))) > + > + (define (delete-unwanted-files child stat flag base = level) > + (let ((protected (make-regexp "\\.(gn|gyp)i?$"))) > + (match flag > + ((or 'regular 'symlink 'stale-symlink) > + (when (third_party? child) > + (unless (or (member child preserved-club) > + (any (cute member <> preserved-= club) > + (parents child)) > + (regexp-exec protected child)) > + (format (current-error-port) "deleting ~s= ~%" child) > + (delete-file child))) > + (when (and (useless? child) (file-exists? chi= ld)) > + (delete-file child)) > + #t) > + ('directory-processed > + (when (empty? child) > + (rmdir child)) > + #t) > + (_ #t)))) > + > + (nftw "." delete-unwanted-files 'depth 'physical) > + > + ;; Assert that each listed item is present to catch = removals. > + (for-each (lambda (third-party) > + (unless (file-exists? third-party) > + (error (format #f "~s does not exist!"= third-party)))) > + preserved-club) > + > + ;; Replace "GN" files from third_party with shims for > + ;; building against system libraries. Keep this lis= t in > + ;; sync with "build/linux/unbundle/replace_gn_files.= py". > + (for-each (lambda (pair) > + (let ((source (string-append > + "build/linux/unbundle/" (= car pair))) > + (dest (cdr pair))) > + (copy-file source dest))) > + (list > + '("ffmpeg.gn" . "third_party/ffmpeg/BUILD= =2Egn") > + '("flac.gn" . "third_party/flac/BUILD.gn") > + '("fontconfig.gn" . "third_party/fontconf= ig/BUILD.gn") > + '("freetype.gn" . "build/config/freetype/= freetype.gni") > + '("harfbuzz-ng.gn" . > + "third_party/harfbuzz-ng/harfbuzz.gni") > + '("icu.gn" . "third_party/icu/BUILD.gn") > + '("libdrm.gn" . "third_party/libdrm/BUILD= =2Egn") > + '("libevent.gn" . "base/third_party/libev= ent/BUILD.gn") > + '("libjpeg.gn" . "third_party/libjpeg.gni= ") > + '("libpng.gn" . "third_party/libpng/BUILD= =2Egn") > + '("libvpx.gn" . "third_party/libvpx/BUILD= =2Egn") > + '("libwebp.gn" . "third_party/libwebp/BUI= LD.gn") > + '("libxml.gn" . "third_party/libxml/BUILD= =2Egn") > + '("libxslt.gn" . "third_party/libxslt/BUI= LD.gn") > + '("openh264.gn" . "third_party/openh264/B= UILD.gn") > + '("opus.gn" . "third_party/opus/BUILD.gn") > + '("re2.gn" . "third_party/re2/BUILD.gn") > + '("snappy.gn" . "third_party/snappy/BUILD= =2Egn") > + '("yasm.gn" . "third_party/yasm/yasm_asse= mble.gni") > + '("zlib.gn" . "third_party/zlib/BUILD.gn"= ))) > + #t))))) > + (build-system gnu-build-system) > + (arguments > + `(#:tests? #f > + ;; FIXME: There is a "gn" option specifically for setting -rpath,= but > + ;; it overrides the RUNPATH set by the linker. > + #:validate-runpath? #f > + #:modules ((guix build gnu-build-system) > + (guix build utils) > + (ice-9 ftw) > + (ice-9 regex) > + (srfi srfi-26)) > + #:configure-flags > + ;; See tools/gn/docs/cookbook.md and > + ;; https://www.chromium.org/developers/gn-build-configuration > + ;; for usage. Run "./gn args . --list" in the Release > + ;; directory for an exhaustive list of supported flags. > + ;; (Note: The 'configure' phase will do that for you.) > + (list "is_debug=3Dfalse" > + "use_gold=3Dfalse" > + "use_lld=3Dfalse" > + "linux_use_bundled_binutils=3Dfalse" > + "use_custom_libcxx=3Dfalse" > + "use_sysroot=3Dfalse" > + "enable_precompiled_headers=3Dfalse" > + "goma_dir=3D\"\"" > + "enable_nacl=3Dfalse" > + "enable_nacl_nonsfi=3Dfalse" > + "use_allocator=3D\"none\"" ;don't use tcmalloc > + "override_build_date=3D\"01 01 2000 05:00:00\"" > + "use_unofficial_version_number=3Dfalse" > + > + ;; Disable "safe browsing", which pulls in a dependency on > + ;; the nonfree "unrar" program (as of m66). > + "safe_browsing_mode=3D0" > + > + ;; Define a custom toolchain that simply looks up CC, AR and > + ;; friends from the environment. > + "custom_toolchain=3D\"//build/toolchain/linux/unbundle:defa= ult\"" > + "host_toolchain=3D\"//build/toolchain/linux/unbundle:defaul= t\"" > + > + ;; Don't assume it's clang. > + "is_clang=3Dfalse" > + > + ;; Optimize for building everything at once, as opposed to > + ;; incrementally for development. See "docs/jumbo.md". > + "use_jumbo_build=3Dtrue" > + > + ;; Disable debugging features to save space. > + "symbol_level=3D0" > + "remove_webcore_debug_symbols=3Dtrue" > + "enable_iterator_debugging=3Dfalse" > + > + ;; Some of the unbundled libraries throws deprecation > + ;; warnings, etc. Ignore it. > + "treat_warnings_as_errors=3Dfalse" > + > + ;; Don't add any API keys. End users can set them in the > + ;; environment if desired. See > + ;; . > + "use_official_google_api_keys=3Dfalse" > + > + ;; Disable "field trials". > + "fieldtrial_testing_like_official_build=3Dtrue" > + > + ;; Disable Chrome Remote Desktop (aka Chromoting). > + "enable_remoting=3Dfalse" > + > + ;; Use system libraries where possible. > + "use_system_freetype=3Dtrue" > + "use_system_harfbuzz=3Dtrue" > + "use_system_lcms2=3Dtrue" > + "use_system_libjpeg=3Dtrue" > + "use_system_libpng=3Dtrue" > + "use_system_zlib=3Dtrue" > + > + "use_gnome_keyring=3Dfalse" ;deprecated by libsecret > + "use_gtk3=3Dtrue" > + "use_openh264=3Dtrue" > + "use_xkbcommon=3Dtrue" > + "use_pulseaudio=3Dtrue" > + "link_pulseaudio=3Dtrue" > + > + ;; Don't arbitrarily restrict formats supported by system f= fmpeg. > + "proprietary_codecs=3Dtrue" > + "ffmpeg_branding=3D\"Chrome\"" > + > + ;; WebRTC stuff. > + "rtc_use_h264=3Dtrue" > + ;; Don't use bundled sources. > + "rtc_build_json=3Dfalse" > + "rtc_build_libevent=3Dfalse" > + "rtc_build_libvpx=3Dfalse" > + "rtc_build_opus=3Dfalse" > + "rtc_build_ssl=3Dfalse" > + > + "rtc_build_libsrtp=3Dtrue" ;FIXME: fails to find headers > + "rtc_build_usrsctp=3Dtrue" ;TODO: package this > + (string-append "rtc_jsoncpp_root=3D\"" > + (assoc-ref %build-inputs "jsoncpp") > + "/include/jsoncpp/json\"") > + (string-append "rtc_ssl_root=3D\"" > + (assoc-ref %build-inputs "openssl") > + "/include/openssl\"")) > + #:phases > + (modify-phases %standard-phases > + (add-after 'unpack 'patch-stuff > + (lambda* (#:key inputs #:allow-other-keys) > + (substitute* "printing/cups_config_helper.py" > + (("cups_config =3D.*") > + (string-append "cups_config =3D '" (assoc-ref inputs "cu= ps") > + "/bin/cups-config'\n"))) > + > + (substitute* > + '("base/process/launch_posix.cc" > + "base/third_party/dynamic_annotations/dynamic_annotat= ions.c" > + "sandbox/linux/seccomp-bpf/sandbox_bpf.cc" > + "sandbox/linux/services/credentials.cc" > + "sandbox/linux/services/namespace_utils.cc" > + "sandbox/linux/services/syscall_wrappers.cc" > + "sandbox/linux/syscall_broker/broker_host.cc") Not related to this section, but: NixOS has a "sandbox" output for Chromium which "contains the sandboxed wrapper" of Chromium. Maybe it requires somet= hing Nix/NixOS specific, maybe we can add that. > + (("include \"base/third_party/valgrind/") "include \"valg= rind/")) > + > + (for-each (lambda (file) > + (substitute* file > + ;; Fix opus include path. > + ;; Do not substitute opus_private.h. > + (("#include \"opus\\.h\"") > + "#include \"opus/opus.h\"") > + (("#include \"opus_custom\\.h\"") > + "#include \"opus/opus_custom.h\"") > + (("#include \"opus_defines\\.h\"") > + "#include \"opus/opus_defines.h\"") > + (("#include \"opus_multistream\\.h\"") > + "#include \"opus/opus_multistream.h\"") > + (("#include \"opus_types\\.h\"") > + "#include \"opus/opus_types.h\""))) > + (find-files (string-append "third_party/webrtc/mo= dules" > + "/audio_coding/codecs/= opus"))) > + > + (substitute* "chrome/common/chrome_paths.cc" > + (("/usr/share/chromium/extensions") > + ;; TODO: Add ~/.guix-profile. > + "/run/current-system/profile/share/chromium/extensions")) > + > + (substitute* > + ;; XXX: Probably not needed for M69. > + "third_party/blink/renderer/platform/image-encoders/ima= ge_encoder.h" > + (("#include \"third_party/libjpeg/") "#include \"") > + (("#include \"third_party/libwebp/src/") "#include \"")) > + > + (substitute* > + "third_party/breakpad/breakpad/src/common/linux/libcurl= _wrapper.h" > + (("include \"third_party/curl") "include \"curl")) > + (substitute* "media/base/decode_capabilities.cc" > + (("third_party/libvpx/source/libvpx/") "")) > + > + #t)) > + (add-before 'configure 'prepare-build-environment > + (lambda* (#:key inputs #:allow-other-keys) > + > + ;; Make sure the right build tools are used. > + (setenv "AR" "ar") (setenv "NM" "nm") > + (setenv "CC" "gcc") (setenv "CXX" "g++") > + > + ;; Work around . > + (unsetenv "C_INCLUDE_PATH") > + (unsetenv "CPLUS_INCLUDE_PATH") > + > + ;; TODO: pre-compile instead. Avoids a race condition. > + (setenv "PYTHONDONTWRITEBYTECODE" "1") > + > + ;; XXX: How portable is this. > + (mkdir-p "third_party/node/linux/node-linux-x64") > + (symlink (string-append (assoc-ref inputs "node") "/bin") > + "third_party/node/linux/node-linux-x64/bin") > + > + #t)) > + (add-after 'prepare-build-environment 'bootstrap-gn > + (lambda _ > + (invoke "python" "tools/gn/bootstrap/bootstrap.py" "-s" "-v= "))) > + (replace 'configure > + (lambda* (#:key configure-flags #:allow-other-keys) > + (let ((args (string-join configure-flags " "))) > + (with-directory-excursion "out/Release" > + ;; Generate ninja build files. > + (invoke "./gn" "gen" "." > + (string-append "--args=3D" args)) > + > + ;; Print the full list of supported arguments as well as > + ;; their current status for convenience. > + (format #t "Dumping configure flags...\n") > + (invoke "./gn" "args" "." "--list"))))) > + (replace 'build > + (lambda* (#:key outputs #:allow-other-keys) > + (invoke "ninja" "-C" "out/Release" > + "-j" (number->string (parallel-job-count)) > + "chrome"))) > + (replace 'install > + (lambda* (#:key inputs outputs #:allow-other-keys) > + (let* ((out (assoc-ref outputs "out")) > + (bin (string-append out "/bin")) > + (exe (string-append bin "/chromium")) > + (lib (string-append out "/lib")) > + (man (string-append out "/share/man/man1"= )) > + (applications (string-append out "/share/applicati= ons")) > + (install-regexp (make-regexp "\\.(bin|pak)$")) > + (locales (string-append lib "/locales")) > + (resources (string-append lib "/resources")) > + (preferences (assoc-ref inputs "master-preference= s")) > + (gtk+ (assoc-ref inputs "gtk+")) > + (mesa (assoc-ref inputs "mesa")) > + (nss (assoc-ref inputs "nss")) > + (udev (assoc-ref inputs "udev")) > + (sh (which "sh"))) > + > + (substitute* '("chrome/app/resources/manpage.1.in" > + "chrome/installer/linux/common/desktop.tem= plate") > + (("@@MENUNAME@@") "Chromium") > + (("@@PACKAGE@@") "chromium") > + (("/usr/bin/@@USR_BIN_SYMLINK_NAME@@") exe)) > + > + (mkdir-p man) > + (copy-file "chrome/app/resources/manpage.1.in" > + (string-append man "/chromium.1")) > + > + (mkdir-p applications) > + (copy-file "chrome/installer/linux/common/desktop.templat= e" > + (string-append applications "/chromium.desktop= ")) > + > + (mkdir-p lib) > + (copy-file preferences (string-append lib "/master_prefer= ences")) > + > + (with-directory-excursion "out/Release" > + (for-each (lambda (file) > + (install-file file lib)) > + (scandir "." (cut regexp-exec install-regexp = <>))) > + (copy-file "chrome" (string-append lib "/chromium")) > + > + ;; TODO: Install icons from "../../chrome/app/themes" i= nto > + ;; "out/share/icons/hicolor/$size". I have more icons here in my definition, the whole section looked like... > + (install-file > + "product_logo_48.png" > + (string-append out "/share/icons/48x48/chromium.png")) this: + ;; XXX: What about ../../chrome/app/theme/chromium/linux/? + (for-each + (lambda (file) + (let* ((size (string-filter char-numeric? file)) + (icons (string-append out "/share/icons/hicolor= /" + size "x" size "/apps"))) + (mkdir-p icons) + (copy-file file (string-append icons "/chromium.png"= )))) + '("../../chrome/app/theme/chromium/product_logo_128.png" + "../../chrome/app/theme/chromium/product_logo_22.png" + "../../chrome/app/theme/chromium/product_logo_22_mono.= png" + "../../chrome/app/theme/chromium/product_logo_24.png" + "../../chrome/app/theme/chromium/product_logo_256.png" + "../../chrome/app/theme/chromium/product_logo_48.png" + "../../chrome/app/theme/chromium/product_logo_64.png")) > + > + (copy-recursively "locales" locales) > + (copy-recursively "resources" resources) > + > + (mkdir-p bin) > + ;; Add a thin wrapper to prevent the user from inadvert= ently > + ;; installing non-free software through the Web Store. > + ;; TODO: Discover extensions from the profile and pass > + ;; something like "--disable-extensions-except=3D...". > + (call-with-output-file exe > + (lambda (port) > + (format port > + "#!~a~@ > + if [ -z \"$CHROMIUM_ENABLE_WEB_STORE\" ]~@ > + then~@ > + CHROMIUM_FLAGS=3D\" \\~@ > + --disable-background-networking \\~@ > + --disable-extensions \\~@ > + \"~@ > + fi~@ > + exec ~a $CHROMIUM_FLAGS \"$@\"~%" > + sh (string-append lib "/chromium")))) > + (chmod exe #o755) > + > + (wrap-program exe > + ;; TODO: Get these in RUNPATH. > + `("LD_LIBRARY_PATH" ":" prefix > + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib= :" > + mesa "/lib:" udev "/lib"))) > + ;; Avoid file manager crash. See . > + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/= share")))) > + #t))))))) > + (native-inputs > + `(("bison" ,bison) > + ("gcc" ,gcc-8) ;a recent compiler is requi= red > + ("gperf" ,gperf) > + ("ninja" ,ninja) > + ("node" ,node) > + ("pkg-config" ,pkg-config) > + ("master-preferences" ,(local-file "chromium-master-preferences.j= son")) > + ("which" ,which) > + ("yasm" ,yasm) > + > + ("python-beautifulsoup4" ,python2-beautifulsoup4) > + ("python-html5lib" ,python2-html5lib) > + ("python" ,python-2))) > + (inputs > + `(("alsa-lib" ,alsa-lib) > + ("atk" ,atk) > + ("cups" ,cups) > + ("curl" ,curl) > + ("dbus" ,dbus) > + ("dbus-glib" ,dbus-glib) > + ("expat" ,expat) > + ("flac" ,flac) > + ("ffmpeg" ,ffmpeg) > + ("fontconfig" ,fontconfig) > + ("freetype" ,freetype) > + ("gdk-pixbuf" ,gdk-pixbuf) > + ("glib" ,glib) > + ("gtk+" ,gtk+) > + ("harfbuzz" ,harfbuzz) > + ("icu4c" ,icu4c) > + ("jsoncpp" ,jsoncpp) > + ("lcms" ,lcms) > + ("libevent" ,libevent) > + ("libffi" ,libffi) > + ("libjpeg-turbo" ,libjpeg-turbo) > + ("libpng" ,libpng) > + ;;("libsrtp" ,libsrtp) > + ("libvpx" ,libvpx/chromium) > + ("libwebp" ,libwebp) > + ("libx11" ,libx11) > + ("libxcb" ,libxcb) > + ("libxcomposite" ,libxcomposite) > + ("libxcursor" ,libxcursor) > + ("libxdamage" ,libxdamage) > + ("libxext" ,libxext) > + ("libxfixes" ,libxfixes) > + ("libxi" ,libxi) > + ("libxkbcommon" ,libxkbcommon) > + ("libxml2" ,libxml2) > + ("libxrandr" ,libxrandr) > + ("libxrender" ,libxrender) > + ("libxscrnsaver" ,libxscrnsaver) > + ("libxslt" ,libxslt) > + ("libxtst" ,libxtst) > + ("mesa" ,mesa) > + ("minizip" ,minizip) > + ("mit-krb5" ,mit-krb5) > + ("nss" ,nss) > + ("openh264" ,openh264) > + ("openjpeg" ,openjpeg) ;PDFium only > + ("openssl" ,openssl) > + ("opus" ,opus+custom) > + ("pango" ,pango) > + ("pciutils" ,pciutils) > + ("pulseaudio" ,pulseaudio) > + ("re2" ,re2) > + ("snappy" ,snappy) > + ("speech-dispatcher" ,speech-dispatcher) > + ("udev" ,eudev) > + ("valgrind" ,valgrind))) > + (home-page "https://www.chromium.org/") > + (description > + "Chromium is a web browser designed for speed and security. This > +version incorporates features from > +@url{https://github.com/gcarq/inox-patchset,the Inox patchset} and > +@url{https://github.com/Eloston/ungoogled-chromium,ungoogled-chromium} in > +order to protect the users privacy.") > + ;; Chromium is developed as BSD-3, but bundles a large number of thi= rd-party > + ;; components with other licenses. For full information, see chrome= ://credits. > + (license (list license:bsd-3 > + license:bsd-2 > + license:expat > + license:asl2.0 > + license:mpl2.0 > + license:public-domain > + license:lgpl2.1+)))) > diff --git a/gnu/packages/patches/chromium-gcc-unique-ptr.patch b/gnu/pac= kages/patches/chromium-gcc-unique-ptr.patch > new file mode 100644 > index 000000000..9c9a9fc09 > --- /dev/null > +++ b/gnu/packages/patches/chromium-gcc-unique-ptr.patch > @@ -0,0 +1,33 @@ > +Help GCC resolve . > + > +Taken from upstream: > +https://chromium.googlesource.com/chromium/src/+/56cb5f7da1025f6db869e84= 0ed34d3b98b9ab899 > + > +diff --git a/components/bookmarks/browser/bookmark_storage.cc b/componen= ts/bookmarks/browser/bookmark_storage.cc > +index 1633ba1..3ae0c62 100644 > +--- a/components/bookmarks/browser/bookmark_storage.cc > ++++ b/components/bookmarks/browser/bookmark_storage.cc > +@@ -158,6 +158,10 @@ > + url_index_ =3D std::make_unique(std::move(root_node_)); > + } > +=20 > ++std::unique_ptr BookmarkLoadDetails::owned_url_index() { > ++ return std::move(url_index_); > ++} > ++ > + BookmarkPermanentNode* BookmarkLoadDetails::CreatePermanentNode( > + BookmarkClient* client, > + BookmarkNode::Type type) { > +diff --git a/components/bookmarks/browser/bookmark_storage.h b/component= s/bookmarks/browser/bookmark_storage.h > +index 08df5bb..0a1b1a1 100644 > +--- a/components/bookmarks/browser/bookmark_storage.h > ++++ b/components/bookmarks/browser/bookmark_storage.h > +@@ -104,7 +104,7 @@ > + bool ids_reassigned() const { return ids_reassigned_; } > +=20 > + void CreateUrlIndex(); > +- std::unique_ptr owned_url_index() { return std::move(url_in= dex_); } > ++ std::unique_ptr owned_url_index(); > +=20 > + private: > + // Creates one of the possible permanent nodes (bookmark bar node, ot= her node > diff --git a/gnu/packages/patches/chromium-remove-default-history.patch b= /gnu/packages/patches/chromium-remove-default-history.patch > new file mode 100644 > index 000000000..42363805b > --- /dev/null > +++ b/gnu/packages/patches/chromium-remove-default-history.patch > @@ -0,0 +1,13 @@ > +Don't pre-populate the New Tab Page for new profiles. > + > +--- a/chrome/browser/history/top_sites_factory.cc > ++++ b/chrome/browser/history/top_sites_factory.cc > +@@ -74,7 +74,7 @@ > +=20 > + void InitializePrepopulatedPageList( > + history::PrepopulatedPageList* prepopulated_pages) { > +-#if !defined(OS_ANDROID) > ++#if 0 > + DCHECK(prepopulated_pages); > + prepopulated_pages->reserve(arraysize(kRawPrepopulatedPages)); > + for (size_t i =3D 0; i < arraysize(kRawPrepopulatedPages); ++i) { > --=20 > 2.18.0 >=20 --4ntk4dcfcdzb4lwe Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAltnIzoACgkQ4i+bv+40 hYizlxAAkdUuL59mf7Z/i4u1lmVbsZNRNCkJ1x2DAA8aBdH04U85dUjXijQAysBg rSihMoRnIOzm2gfPPpebKiOmVSfsjfUQGHRkRW48Q+RDY9fMVNjYySO1XoazFSI9 DqwkmFzBz9a3GeXVHXlfM78xA09SijVPxpUkQYVIs5BuotE9KRZOpXruzr30i+dp Br4VcHcSAhkWTnIWp2Doea2vkGl7cCakScRxvkENSIKY5Nd1Vcg+c9LzkU28mOf9 JnT4ibvb/Txtkgeqn2ytBB5Cy7CUA4pBcyKStviyvGziUOb8T/nIiJMWluOkchx8 26jYtCrcPhAv82wAlnA3SPTmmJ1E93DmLjCkzIe8YoA6mdE7jKpHRsHi7VTIJJqi yyVDujsVyi1tgyhmeYd8gtklmoKHuIECGCK/Fe5Xn3elMvcGuwiW/+xBwk6Zs/VJ Z5www2ex1+MuiAtAxhg5P988xnfnDT1LR+uHOOuifZAa6JhDiS0W8Rr/lM0AfFao xGJPbEYkeuEwHr+NQkXGV+Ds6mhh2RgwGPD+Pe6u+x9mfT1NP2gM+hTw1iKNBiRK dcSvWlSX/YzBv5rFzFWjUIXriUhSDW/RQTATtRDWHYkDivXiCvNCMHkfNuHuD3TM x2xYYE+UCfYUj2O+1UojroSTTw2QXdJDYoCcTg4hYKpT/FTo7Vg= =dw1o -----END PGP SIGNATURE----- --4ntk4dcfcdzb4lwe-- From debbugs-submit-bounces@debbugs.gnu.org Sun Aug 05 14:25:41 2018 Received: (at 28004) by debbugs.gnu.org; 5 Aug 2018 18:25:41 +0000 Received: from localhost ([127.0.0.1]:42058 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fmNil-0001lq-Ci for submit@debbugs.gnu.org; Sun, 05 Aug 2018 14:25:41 -0400 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:59717) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fmNii-0001lh-R8 for 28004@debbugs.gnu.org; Sun, 05 Aug 2018 14:25:37 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 818A720FAD; Sun, 5 Aug 2018 14:25:36 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Sun, 05 Aug 2018 14:25:36 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm3; bh=ucSVRGK+/ynqxHS6EIuemoEATdV45H3vBFzNDSsynqU=; b=SgkXwZf0 gMErlMpWqFkwi6N5wL8SrshVU2eSCuX/uVS+Cfnw0LDUmfyG8jCR5aYROjAiRjFV n07Tx7K1wY8uKa96KSwOkmKw7mWEiWJHO1tYyIJOuz2xzYUUCs2ozQZoDWoZUGOP 2tshEKsyIRxiR92UO/SXxISFSzzCmU+L46B0GqQXiQlBDT6e2BKPN5zBzA7t7ZS/ 50w/T+FC9j4smSlo74D9jzgDC3j0XIcsvzkR0WC8MqJRQN0TrTttaBPH/Aow7icr jJBoF/p9AQ1eM96wvfMdt91Fkm2qVjR2NtoRSfOvVM3ouhxEBdLVN27NKOsRYnE0 jgNnPKp/HXkplA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm3; bh=ucSVRGK+/ynqxHS6EIuemoEATdV45 H3vBFzNDSsynqU=; b=a3bSnHWXL9Eb/WRYFaEOyUfNhmd1MzAJr8tXCb461mxl0 ojsLOmPv14DhN75PjQTgWyj9rFW/JKZ8mEKzxfL+bFYmwNCJEiBu2r+uhzf0LRft OZWTL2OKsjqVkbvH87CPoEN0WZ6GGzKGVeqLt3HeEsvRDAAAEB190ngF8pueGL6x 2BA8Jsr6wD2LTB/P8KHrIRULFkEFf1VvqQYNXYPwk1mFR2vTaX7BcZWYHhp0Vkkx PKZQNu3mLNyjl/iqz1Do9nLALOwuctUUxZscl8zPTs5tOcbuqko2Dhr4CqCchokK RZoIgVHjzZKRgQFYCz+F+ZRc8a9Sf4D3XOHBieOTA== X-ME-Proxy: X-ME-Sender: Received: from localhost (95.92-221-151.customer.lyse.net [92.221.151.95]) by mail.messagingengine.com (Postfix) with ESMTPA id BB11810255; Sun, 5 Aug 2018 14:25:35 -0400 (EDT) From: Marius Bakke To: ng0 Subject: Re: [bug#28004] Chromium In-Reply-To: <20180805161802.bif4ax5feqloxayz@abyayala> References: <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> <20180316173044.dctlydfij7smndxd@abyayala> <87h8pfc3tr.fsf@fastmail.com> <20180316175225.7jf4k2qaciyxnepp@abyayala> <20180725080800.stqijlny6om6powe@abyayala> <87tvo9c6cs.fsf@fastmail.com> <20180805161802.bif4ax5feqloxayz@abyayala> User-Agent: Notmuch/0.27 (https://notmuchmail.org) Emacs/26.1 (x86_64-pc-linux-gnu) Date: Sun, 05 Aug 2018 20:25:33 +0200 Message-ID: <87lg9kd61u.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain ng0 writes: > Once we merge this into master, can we document the update procedure? > Or even better, write an update script if possible? For me it was 40% > hit everything which doesn't move and take what's left over and 60% > reading. I understand the code, but some people might want an > explanation for how it's decided which folder gets to stay. The "preserved-club" are simply third_party directories that are necessary for the build. Removing any single one will cause the build to fail (in theory, there might be outdated entries..). It's difficult to automate because you don't know what's needed until the build process starts and fails because of some missing dependency. > Not related to this section, but: NixOS has a "sandbox" output for Chromium > which "contains the sandboxed wrapper" of Chromium. Maybe it requires something > Nix/NixOS specific, maybe we can add that. I guess that's for the SUID sandbox binary. I haven't had a reason to build that because the user namespace sandbox works just fine. Perhaps it's useful for distributions that don't have user namespaces enabled? >> + ;; TODO: Install icons from "../../chrome/app/themes" into >> + ;; "out/share/icons/hicolor/$size". > > I have more icons here in my definition, the whole section looked like... > >> + (install-file >> + "product_logo_48.png" >> + (string-append out "/share/icons/48x48/chromium.png")) > > this: > > + ;; XXX: What about ../../chrome/app/theme/chromium/linux/? > + (for-each > + (lambda (file) > + (let* ((size (string-filter char-numeric? file)) > + (icons (string-append out "/share/icons/hicolor/" > + size "x" size "/apps"))) > + (mkdir-p icons) > + (copy-file file (string-append icons "/chromium.png")))) > + '("../../chrome/app/theme/chromium/product_logo_128.png" > + "../../chrome/app/theme/chromium/product_logo_22.png" > + "../../chrome/app/theme/chromium/product_logo_22_mono.png" > + "../../chrome/app/theme/chromium/product_logo_24.png" > + "../../chrome/app/theme/chromium/product_logo_256.png" > + "../../chrome/app/theme/chromium/product_logo_48.png" > + "../../chrome/app/theme/chromium/product_logo_64.png")) Nice. Now the next step is to generate the latter list, maybe with find-files? Thanks for the feedback! --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAltnQR0ACgkQoqBt8qM6 VPp9YwgAkNFCcTpNOmo0VwqqSUCSYVTZ8e+v0EaWXgWNkOGvvh4d6nA+IUnEin2F W23JgtrtiFcHvj6hr6U4XiBkK4yumyv6WGCv1xRAXHAwB6mGUhRyQfr3n59tVHDD IlAQpNgH0JJ0NxCv/ORieJmsW+/SexBui19aEVxPXiS1Z7sUfBVljzKtpZ3NVDbR XXOpqiesekw88S2oS/Rh5gSlTHUkw2fEgJw9xYIB89FGL5asEGladg42mbmRQblI Cb3SdqhXr0WsPfmonSgfCTWizLfgBIgTYAHNXwPjUOdeRGfciUbkQtO/AGvdwRhQ v6ajiaK3FJcIPx94k2QBXez3KXUaOA== =6bjy -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sun Aug 05 16:31:40 2018 Received: (at 28004) by debbugs.gnu.org; 5 Aug 2018 20:31:40 +0000 Received: from localhost ([127.0.0.1]:42076 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fmPgi-0004oP-Hn for submit@debbugs.gnu.org; Sun, 05 Aug 2018 16:31:40 -0400 Received: from static.195.114.201.195.clients.your-server.de ([195.201.114.195]:48430 helo=conspiracy.of.n0.is) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fmPgg-0004oF-EC for 28004@debbugs.gnu.org; Sun, 05 Aug 2018 16:31:39 -0400 Received: by conspiracy.of.n0.is (OpenSMTPD) with ESMTPSA id ac266d14 (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256:NO); Sun, 5 Aug 2018 20:31:36 +0000 (UTC) Date: Sun, 5 Aug 2018 20:32:22 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180805203222.iyvpw5wansinz6tb@abyayala> References: <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> <20180316173044.dctlydfij7smndxd@abyayala> <87h8pfc3tr.fsf@fastmail.com> <20180316175225.7jf4k2qaciyxnepp@abyayala> <20180725080800.stqijlny6om6powe@abyayala> <87tvo9c6cs.fsf@fastmail.com> <20180805161802.bif4ax5feqloxayz@abyayala> <87lg9kd61u.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="el2ejmdr5osmi7mb" Content-Disposition: inline In-Reply-To: <87lg9kd61u.fsf@fastmail.com> X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --el2ejmdr5osmi7mb Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Marius Bakke transcribed 3.2K bytes: > ng0 writes: >=20 > > Once we merge this into master, can we document the update procedure? > > Or even better, write an update script if possible? For me it was 40% > > hit everything which doesn't move and take what's left over and 60% > > reading. I understand the code, but some people might want an > > explanation for how it's decided which folder gets to stay. >=20 > The "preserved-club" are simply third_party directories that are > necessary for the build. Removing any single one will cause the build > to fail (in theory, there might be outdated entries..). >=20 > It's difficult to automate because you don't know what's needed until > the build process starts and fails because of some missing dependency. Hm okay. Yes, I noticed. But they usually fail very early, so it's just 4 - 20 minutes waiting depending on your harddrive and network speed. > > Not related to this section, but: NixOS has a "sandbox" output for Chro= mium > > which "contains the sandboxed wrapper" of Chromium. Maybe it requires s= omething > > Nix/NixOS specific, maybe we can add that. >=20 > I guess that's for the SUID sandbox binary. I haven't had a reason to > build that because the user namespace sandbox works just fine. Perhaps > it's useful for distributions that don't have user namespaces enabled? Maybe, it's worth investigating. I haven't looked at it very much. >=20 > >> + ;; TODO: Install icons from "../../chrome/app/themes= " into > >> + ;; "out/share/icons/hicolor/$size". > > > > I have more icons here in my definition, the whole section looked like.= =2E. > > > >> + (install-file > >> + "product_logo_48.png" > >> + (string-append out "/share/icons/48x48/chromium.png= ")) > > > > this: > > > > + ;; XXX: What about ../../chrome/app/theme/chromium/li= nux/? > > + (for-each > > + (lambda (file) > > + (let* ((size (string-filter char-numeric? file)) > > + (icons (string-append out "/share/icons/hic= olor/" > > + size "x" size "/apps"= ))) > > + (mkdir-p icons) > > + (copy-file file (string-append icons "/chromium.= png")))) > > + '("../../chrome/app/theme/chromium/product_logo_128.= png" > > + "../../chrome/app/theme/chromium/product_logo_22.p= ng" > > + "../../chrome/app/theme/chromium/product_logo_22_m= ono.png" > > + "../../chrome/app/theme/chromium/product_logo_24.p= ng" > > + "../../chrome/app/theme/chromium/product_logo_256.= png" > > + "../../chrome/app/theme/chromium/product_logo_48.p= ng" > > + "../../chrome/app/theme/chromium/product_logo_64.p= ng")) >=20 > Nice. Now the next step is to generate the latter list, maybe with > find-files? >=20 > Thanks for the feedback! Thanks for your continued work on this monster ;) --el2ejmdr5osmi7mb Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAltnXtYACgkQ4i+bv+40 hYgK7g//aLZYqsqZBhgj4yyB3tY3LDqEmyBeRB9Tvw2G+X5ec9nYoU/W8c0u7vFh Za6xUuIa2DtKeyxq4++8+nA6AaX0ajwg6NpmxepRqgSJaCA9GrnPFHWG09vZ7Yjr K6VljcKwacTw9ABezE21szDx1Rk8OSvncgO64L4VVuee9Q/TBNUWpnEXJuvipKXL drSp+wbJMeIOmHoy/HzR/bleJpVu/JKxL5gyCarcIKfbqIwjNb6JG4RqSUt9i4aP M1ofQLS/ITTLOJo4OoE64KyqvgC3F3XP45oaP9iC4JOBefeNugGQYWRmJNXaHtkC dVnacmhI5zqdKUj2lROq7jEY/YWKGx0g+Y5qp99DLUUHLCuUfp29pMQniwkBKjcU 1PJsPUl1eTtoGtpmfXed1eimgF0otiGGaVSSnNP4FbWOHLBF5FL5Qq2t1ag/wFck W6HlJ/3TL4Ynf7m157nDz8FNGTEZWbqtzh3gqGaHjcJznnrh2agNngGP5MkgZgqV uEooahQG27kKWIVzG5Q+rTd04r5AGWJnJPlfRW4aJrawxKRFDrEpNaLbUsl9c3Bf sMlOuPtqMub9rl/FQRABtHN0E+Q+BPVZVr3Dtf1oqk7m69ZVkdTX4EokHt6NAjoX 4wPMOfEwqmdK6woZG1kUTFxXd8tXBaSsIbT5lgYVnSUsD/BfFHQ= =EkBc -----END PGP SIGNATURE----- --el2ejmdr5osmi7mb-- From debbugs-submit-bounces@debbugs.gnu.org Sun Aug 05 19:57:22 2018 Received: (at 28004) by debbugs.gnu.org; 5 Aug 2018 23:57:22 +0000 Received: from localhost ([127.0.0.1]:42117 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fmStl-0001Cj-A8 for submit@debbugs.gnu.org; Sun, 05 Aug 2018 19:57:22 -0400 Received: from static.195.114.201.195.clients.your-server.de ([195.201.114.195]:49168 helo=conspiracy.of.n0.is) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fmSth-0001CW-F4 for 28004@debbugs.gnu.org; Sun, 05 Aug 2018 19:57:19 -0400 Received: by conspiracy.of.n0.is (OpenSMTPD) with ESMTPSA id e7cb38eb (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256:NO); Sun, 5 Aug 2018 23:57:14 +0000 (UTC) Date: Sun, 5 Aug 2018 23:58:00 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180805235800.txqdbuawyu5y2i4m@abyayala> References: <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> <20180316173044.dctlydfij7smndxd@abyayala> <87h8pfc3tr.fsf@fastmail.com> <20180316175225.7jf4k2qaciyxnepp@abyayala> <20180725080800.stqijlny6om6powe@abyayala> <87tvo9c6cs.fsf@fastmail.com> <20180805161802.bif4ax5feqloxayz@abyayala> <87lg9kd61u.fsf@fastmail.com> <20180805203222.iyvpw5wansinz6tb@abyayala> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="ytlnuqtgu6hgpflx" Content-Disposition: inline In-Reply-To: <20180805203222.iyvpw5wansinz6tb@abyayala> X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --ytlnuqtgu6hgpflx Content-Type: multipart/mixed; boundary="avrxomh2xkp23zzn" Content-Disposition: inline --avrxomh2xkp23zzn Content-Type: text/plain; charset=utf-8 Content-Disposition: inline It took a while because of the heat, but here's a fail log appended. I'm going to bed, and I don't know when I have time to look into it. Maybe you get to work on it earlier than myself. Thanks --avrxomh2xkp23zzn Content-Type: text/plain; charset=utf-8 Content-Disposition: attachment; filename="chromium68.txt" Content-Transfer-Encoding: quoted-printable [13587/19325] CXX obj/chrome/browser/browser/browser_jumbo_2.o FAILED: obj/chrome/browser/browser/browser_jumbo_2.o=20 g++ -MMD -MF obj/chrome/browser/browser/browser_jumbo_2.o.d -DUSE_LIBSECRET= -DV8_DEPRECATION_WARNINGS -DUSE_UDEV -DUSE_AURA=3D1 -DUSE_GLIB=3D1 -DUSE_N= SS_CERTS=3D1 -DUSE_X11=3D1 -DNO_TCMALLOC -DCHROMIUM_BUILD -D_FILE_OFFSET_BI= TS=3D64=20 -D_LARGEFILE_SOURCE -D_LARGEFILE64_SOURCE -D__STDC_CONSTANT_MACROS -D__STDC= _FORMAT_MACROS -D_FORTIFY_SOURCE=3D2 -DNDEBUG -DNVALGRIND -DDYNAMIC_ANNOTAT= IONS_ENABLED=3D0 -DUSE_CUPS -DGLIB_VERSION_MAX_ALLOWED=3DGLIB_VERSION_2_32= =20 -DGLIB_VERSION_MIN_REQUIRED=3DGLIB_VERSION_2_26 -DGL_GLEXT_PROTOTYPES -DUSE= _GLX -DUSE_EGL -DTOOLKIT_VIEWS=3D1 -DEXPAT_RELATIVE_PATH -DUSING_SYSTEM_ICU= =3D1 -DICU_UTIL_DATA_IMPL=3DICU_UTIL_DATA_STATIC -DUCHAR_TYPE=3Duint16_t=20 -DU_IMPORT=3DU_EXPORT -DGOOGLE_PROTOBUF_NO_RTTI -DGOOGLE_PROTOBUF_NO_STATIC= _INITIALIZER -DHAVE_PTHREAD -DV8_USE_EXTERNAL_STARTUP_DATA -DSK_IGNORE_LINE= ONLY_AA_CONVEX_PATH_OPTS -DSK_HAS_PNG_LIBRARY -DSK_HAS_WEBP_LIBRARY=20 -DSK_HAS_JPEG_LIBRARY -DSK_SUPPORT_GPU=3D1 -DSK_GPU_WORKAROUNDS_HEADER=3D\"= gpu/config/gpu_driver_bug_workaround_autogen.h\" -DLEVELDB_PLATFORM_CHROMIU= M=3D1 -DWEBRTC_NON_STATIC_TRACE_EVENT_HANDLERS=3D0 -DGTEST_RELATIVE_PATH=20 -DWEBRTC_CHROMIUM_BUILD -DWEBRTC_POSIX -DWEBRTC_LINUX -DNO_MAIN_THREAD_WRAP= PING -DI18N_ADDRESS_VALIDATION_DATA_URL=3D\"https://chromium-i18n.appspot.c= om/ssl-aggregate-address/\" -DUSE_SYSTEM_ZLIB=3D1 -DHUNSPELL_STATIC=20 -DHUNSPELL_CHROME_CLIENT -DUSE_HUNSPELL -I. -I../.. -Igen -Igen/shim_header= s/libevent_shim -Igen/shim_headers/icui18n_shim -Igen/shim_headers/icuuc_sh= im -Igen/shim_headers/zlib_shim -Igen/shim_headers/libpng_shim=20 -Igen/shim_headers/re2_shim -Igen/shim_headers/snappy_shim -Igen/shim_heade= rs/libdrm_shim -I../../third_party/khronos -I../../gpu -I../../third_party/= libyuv/include -Igen/shim_headers/ffmpeg_shim -Igen/shim_headers/libvpx_shi= m=20 -Igen/shim_headers/opus_shim -Igen/shim_headers/openh264_shim -Igen/shim_he= aders/minizip_shim -Igen/shim_headers/flac_shim -I../../third_party/webrtc_= overrides -I../../testing/gtest/include -I../../third_party/libyuv/include= =20 -I../../third_party/usrsctp/usrsctplib -I../../third_party/webrtc -I../../t= hird_party/ced/src -I../../third_party/protobuf/src -I../../third_party/pro= tobuf/src -Igen/protoc_out -I../../third_party/boringssl/src/include=20 -I../../skia/config -I../../skia/ext -I../../third_party/skia/include/c -I.= =2E/../third_party/skia/include/config -I../../third_party/skia/include/cor= e -I../../third_party/skia/include/effects -I../../third_party/skia/include= /encode=20 -I../../third_party/skia/include/gpu -I../../third_party/skia/include/image= s -I../../third_party/skia/include/lazy -I../../third_party/skia/include/pa= thops -I../../third_party/skia/include/pdf -I../../third_party/skia/include= /pipe=20 -I../../third_party/skia/include/ports -I../../third_party/skia/include/uti= ls -I../../third_party/skia/src/gpu -I../../third_party/skia/src/sksl -I../= =2E./third_party/leveldatabase -I../../third_party/leveldatabase/src=20 -I../../third_party/leveldatabase/src/include -I../../third_party/libwebm/s= ource -I../../v8/include -Igen/v8/include -I../../third_party/webrtc_overri= des -I../../third_party/webrtc -Igen/third_party/metrics_proto=20 -I../../third_party/mesa/src/include -Igen -Igen -I../../third_party/libadd= ressinput/src/cpp/include -I../../third_party/perfetto/include -Igen/third_= party/perfetto/protos -I../../third_party/cacheinvalidation/overrides=20 -I../../third_party/cacheinvalidation/src -I../../third_party/flatbuffers/s= rc/include -I../../third_party/webrtc_overrides -I../../testing/gtest/inclu= de -I../../third_party/webrtc -I../../third_party/libsecret=20 -I../../third_party/breakpad/breakpad/src -Igen -fno-strict-aliasing --para= m=3Dssp-buffer-size=3D4 -fstack-protector -Wno-builtin-macro-redefined -D__= DATE__=3D -D__TIME__=3D -D__TIMESTAMP__=3D -funwind-tables -fPIC -pipe -pth= read -m64=20 -march=3Dx86-64 -Wall -Wno-unused-local-typedefs -Wno-maybe-uninitialized -= Wno-deprecated-declarations -fno-delete-null-pointer-checks -Wno-comments -= Wno-missing-field-initializers -Wno-unused-parameter -O2 -fno-ident -fdata-= sections=20 -ffunction-sections -fno-omit-frame-pointer -g0 -fvisibility=3Dhidden -isys= tem../../../../../gnu/store/x9lfcagl47zbb6krfpmwm31m70s9pk00-glib-2.56.0/in= clude/glib-2.0=20 -isystem../../../../../gnu/store/x9lfcagl47zbb6krfpmwm31m70s9pk00-glib-2.56= =2E0/lib/glib-2.0/include -isystem../../../../../gnu/store/9xx9gzlgp20bzb9r= 9ksajwzdcpm0qs5z-nss-3.38/include/nss=20 -isystem../../../../../gnu/store/714dy9b910rdvsy8i8bx6ln3ap032z2z-nspr-4.19= /include/nspr -isystem../../../../../gnu/store/kl4fr813f98mh1zjs6bwkardgnrz= xi8c-libxml2-2.9.8/include/libxml2=20 -isystem../../../../../gnu/store/84dgv1gy1cyms37zlmykpsafbpwbm7xr-dbus-1.12= =2E6/include/dbus-1.0 -isystem../../../../../gnu/store/84dgv1gy1cyms37zlmyk= psafbpwbm7xr-dbus-1.12.6/lib/dbus-1.0/include -std=3Dgnu++14 -Wno-narrowing= =20 -fno-exceptions -fno-rtti -fvisibility-inlines-hidden -c gen/chrome/browser= /browser_jumbo_2.cc -o obj/chrome/browser/browser/browser_jumbo_2.o In file included from gen/mojo/public/mojom/base/string16.mojom-shared-inte= rnal.h:12, from gen/device/usb/public/mojom/device.mojom-shared-inter= nal.h:12, from gen/device/usb/public/mojom/chooser_service.mojom-sha= red-internal.h:12, from gen/device/usb/public/mojom/chooser_service.mojom-sha= red.h:24, from gen/device/usb/public/mojom/chooser_service.mojom.h:2= 8, from ../../content/public/browser/content_browser_client.h= :30, from ../../chrome/browser/profiles/profile.h:18, from ./../../chrome/browser/browsing_data/browsing_data_qu= ota_helper_impl.cc:15, from gen/chrome/browser/browser_jumbo_2.cc:6: gen/mojo/public/mojom/base/big_buffer.mojom-shared-internal.h:30:48: warnin= g: alignment 1 of ?mojo_base::mojom::internal::BigBuffer_Data? is less than= 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJO_BASE_MOJOM_SHARED) BigBuffer_Data { ^~~~~~~~~~~~~~ In file included from gen/services/network/public/mojom/network_context.moj= om-shared-internal.h:14, from gen/services/network/public/mojom/network_service.moj= om-shared-internal.h:13, from gen/services/network/public/mojom/network_service.moj= om-shared.h:24, from gen/services/network/public/mojom/network_service.moj= om.h:28, from ../../content/public/browser/content_browser_client.h= :36, from ../../chrome/browser/profiles/profile.h:18, from ./../../chrome/browser/browsing_data/browsing_data_qu= ota_helper_impl.cc:15, from gen/chrome/browser/browser_jumbo_2.cc:6: gen/mojo/public/mojom/base/values.mojom-shared-internal.h:31:48: warning: a= lignment 1 of ?mojo_base::mojom::internal::Value_Data? is less than 8 [-Wpa= cked-not-aligned] class COMPONENT_EXPORT(MOJO_BASE_MOJOM_SHARED) Value_Data { ^~~~~~~~~~ In file included from gen/media/mojo/interfaces/video_decode_perf_history.m= ojom-shared-internal.h:12, from gen/media/mojo/interfaces/video_decode_perf_history.m= ojom-shared.h:24, from gen/media/mojo/interfaces/video_decode_perf_history.m= ojom.h:28, from ../../media/mojo/services/video_decode_perf_history.h= :18, from ./../../chrome/browser/browsing_data/chrome_browsing_= data_remover_delegate.cc:93, from gen/chrome/browser/browser_jumbo_2.cc:10: gen/media/mojo/interfaces/media_types.mojom-shared-internal.h:89:8: warning= : alignment 1 of ?media::mojom::internal::VideoFrameData_Data? is less than= 8 [-Wpacked-not-aligned] class VideoFrameData_Data { ^~~~~~~~~~~~~~~~~~~ In file included from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom-shared.h:24, from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom.h:28, from ../../content/public/browser/render_process_host.h:25, from ./../../chrome/browser/budget_service/budget_service_= impl.cc:13, from gen/chrome/browser/browser_jumbo_2.cc:27: gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:92:53: warning: alignment 1 of ?blink::mojom::intern= al::OpenResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) OpenResult_Data { ^~~~~~~~~~~~~~~ gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:171:53: warning: alignment 1 of ?blink::mojom::inter= nal::MatchResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) MatchResult_Data { ^~~~~~~~~~~~~~~~ gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:250:53: warning: alignment 1 of ?blink::mojom::inter= nal::MatchAllResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) MatchAllResult_Data { ^~~~~~~~~~~~~~~~~~~ In file included from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom-shared.h:24, from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom.h:28, from ../../content/public/browser/render_process_host.h:25, from ./../../chrome/browser/budget_service/budget_service_= impl.cc:13, from gen/chrome/browser/browser_jumbo_2.cc:27: gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:329:53: warning: alignment 1 of ?blink::mojom::inter= nal::CacheKeysResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) CacheKeysResult_Data { ^~~~~~~~~~~~~~~~~~~~ In file included from gen/services/resource_coordinator/public/mojom/memory= _instrumentation/memory_instrumentation.mojom-shared.h:24, from gen/services/resource_coordinator/public/mojom/memory= _instrumentation/memory_instrumentation.mojom.h:28, from ../../services/resource_coordinator/public/cpp/memory= _instrumentation/coordinator.h:8, from ../../services/resource_coordinator/public/cpp/memory= _instrumentation/memory_instrumentation.h:12, from ../../chrome/browser/resource_coordinator/render_proc= ess_probe.h:17, from ./../../chrome/browser/chrome_browser_main.cc:97, from gen/chrome/browser/browser_jumbo_2.cc:31: gen/services/resource_coordinator/public/mojom/memory_instrumentation/memor= y_instrumentation.mojom-shared-internal.h:174:66: warning: alignment 1 of ?= memory_instrumentation::mojom::internal::RawAllocatorDumpEntryValue_Data? i= s less=20 than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(RESOURCE_COORDINATOR_PUBLIC_MOJOM_SHARED) RawAlloca= torDumpEntryValue_Data { ^~~~~~~~~= ~~~~~~~~~~~~~~~~~~~~~~ In file included from gen/third_party/blink/public/platform/modules/present= ation/presentation.mojom-shared.h:24, from gen/third_party/blink/public/platform/modules/present= ation/presentation.mojom.h:28, from ../../content/public/browser/presentation_service_del= egate.h:17, from ../../chrome/browser/media/router/media_router.h:26, from ../../chrome/browser/media/router/presentation/presen= tation_service_delegate_impl.h:20, from ./../../chrome/browser/chrome_content_browser_client.= cc:54, from gen/chrome/browser/browser_jumbo_2.cc:34: gen/third_party/blink/public/platform/modules/presentation/presentation.moj= om-shared-internal.h:137:53: warning: alignment 1 of ?blink::mojom::interna= l::PresentationConnectionMessage_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) PresentationConnection= Message_Data { ^~~~~~~~~~~~~~~~~~~~~~= ~~~~~~~~~~~~ In file included from gen/services/preferences/public/mojom/preferences.moj= om-shared.h:24, from gen/services/preferences/public/mojom/preferences.moj= om.h:28, from ./../../chrome/browser/chrome_content_browser_client.= cc:255, from gen/chrome/browser/browser_jumbo_2.cc:34: gen/services/preferences/public/mojom/preferences.mojom-shared-internal.h:1= 74:8: warning: alignment 1 of ?prefs::mojom::internal::PrefUpdateValue_Data= ? is less than 8 [-Wpacked-not-aligned] class PrefUpdateValue_Data { ^~~~~~~~~~~~~~~~~~~~ g++: fatal error: Killed signal terminated program cc1plus compilation terminated. [13588/19325] CXX obj/chrome/browser/browser/browser_jumbo_23.o In file included from gen/mojo/public/mojom/base/string16.mojom-shared-inte= rnal.h:12, from gen/device/usb/public/mojom/device.mojom-shared-inter= nal.h:12, from gen/device/usb/public/mojom/chooser_service.mojom-sha= red-internal.h:12, from gen/device/usb/public/mojom/chooser_service.mojom-sha= red.h:24, from gen/device/usb/public/mojom/chooser_service.mojom.h:2= 8, from ../../content/public/browser/content_browser_client.h= :30, from ../../chrome/browser/browser_process_platform_part_ba= se.h:11, from ../../chrome/browser/browser_process_platform_part.h:= 20, from ../../chrome/browser/browser_process.h:21, from ./../../chrome/browser/printing/cloud_print/privet_ur= l_fetcher.cc:22, from gen/chrome/browser/browser_jumbo_23.cc:5: gen/mojo/public/mojom/base/big_buffer.mojom-shared-internal.h:30:48: warnin= g: alignment 1 of ?mojo_base::mojom::internal::BigBuffer_Data? is less than= 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJO_BASE_MOJOM_SHARED) BigBuffer_Data { ^~~~~~~~~~~~~~ In file included from gen/services/network/public/mojom/network_context.moj= om-shared-internal.h:14, from gen/services/network/public/mojom/network_service.moj= om-shared-internal.h:13, from gen/services/network/public/mojom/network_service.moj= om-shared.h:24, from gen/services/network/public/mojom/network_service.moj= om.h:28, from ../../content/public/browser/content_browser_client.h= :36, from ../../chrome/browser/browser_process_platform_part_ba= se.h:11, from ../../chrome/browser/browser_process_platform_part.h:= 20, from ../../chrome/browser/browser_process.h:21, from ./../../chrome/browser/printing/cloud_print/privet_ur= l_fetcher.cc:22, from gen/chrome/browser/browser_jumbo_23.cc:5: gen/mojo/public/mojom/base/values.mojom-shared-internal.h:31:48: warning: a= lignment 1 of ?mojo_base::mojom::internal::Value_Data? is less than 8 [-Wpa= cked-not-aligned] class COMPONENT_EXPORT(MOJO_BASE_MOJOM_SHARED) Value_Data { ^~~~~~~~~~ In file included from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom-shared.h:24, from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom.h:28, from ../../content/public/browser/render_process_host.h:25, from ./../../chrome/browser/sessions/session_restore.cc:58, from gen/chrome/browser/browser_jumbo_23.cc:6: gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:92:53: warning: alignment 1 of ?blink::mojom::intern= al::OpenResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) OpenResult_Data { ^~~~~~~~~~~~~~~ gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:171:53: warning: alignment 1 of ?blink::mojom::inter= nal::MatchResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) MatchResult_Data { ^~~~~~~~~~~~~~~~ gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:250:53: warning: alignment 1 of ?blink::mojom::inter= nal::MatchAllResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) MatchAllResult_Data { ^~~~~~~~~~~~~~~~~~~ In file included from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom-shared.h:24, from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom.h:28, from ../../content/public/browser/render_process_host.h:25, from ./../../chrome/browser/sessions/session_restore.cc:58, from gen/chrome/browser/browser_jumbo_23.cc:6: gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:329:53: warning: alignment 1 of ?blink::mojom::inter= nal::CacheKeysResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) CacheKeysResult_Data { ^~~~~~~~~~~~~~~~~~~~ In file included from gen/chrome/browser/browser_jumbo_23.cc:42: =2E/../../chrome/browser/supervised_user/supervised_user_url_filter.cc:76:3= 3: warning: ?SupervisedUserURLFilter::Contents? has a field ?SupervisedUser= URLFilter::Contents::hostname_hashes? whose type uses the anonymous namespa= ce=20 [-Wsubobject-linkage] struct SupervisedUserURLFilter::Contents { ^~~~~~~~ In file included from gen/chrome/browser/browser_jumbo_23.cc:53: =2E/../../chrome/browser/net/trial_comparison_cert_verifier.cc: In function= ?void {anonymous}::SendTrialVerificationReport(void*, const net::CertVerif= ier::RequestParams&, const net::CertVerifyResult&, const net::CertVerifyRes= ult&)?: =2E/../../chrome/browser/net/trial_comparison_cert_verifier.cc:85:12: warni= ng: unused variable ?profile? [-Wunused-variable] Profile* profile =3D reinterpret_cast(profile_id); ^~~~~~~ [13589/19325] CXX obj/chrome/browser/browser/browser_jumbo_8.o In file included from gen/mojo/public/mojom/base/string16.mojom-shared-inte= rnal.h:12, from gen/device/usb/public/mojom/device.mojom-shared-inter= nal.h:12, from gen/device/usb/public/mojom/chooser_service.mojom-sha= red-internal.h:12, from gen/device/usb/public/mojom/chooser_service.mojom-sha= red.h:24, from gen/device/usb/public/mojom/chooser_service.mojom.h:2= 8, from ../../content/public/browser/content_browser_client.h= :30, from ../../chrome/browser/browser_process_platform_part_ba= se.h:11, from ../../chrome/browser/browser_process_platform_part.h:= 20, from ../../chrome/browser/browser_process.h:21, from ./../../chrome/browser/page_load_metrics/observers/co= re_page_load_metrics_observer.cc:13, from gen/chrome/browser/browser_jumbo_8.cc:8: gen/mojo/public/mojom/base/big_buffer.mojom-shared-internal.h:30:48: warnin= g: alignment 1 of ?mojo_base::mojom::internal::BigBuffer_Data? is less than= 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJO_BASE_MOJOM_SHARED) BigBuffer_Data { ^~~~~~~~~~~~~~ In file included from gen/services/network/public/mojom/network_context.moj= om-shared-internal.h:14, from gen/services/network/public/mojom/network_service.moj= om-shared-internal.h:13, from gen/services/network/public/mojom/network_service.moj= om-shared.h:24, from gen/services/network/public/mojom/network_service.moj= om.h:28, from ../../content/public/browser/content_browser_client.h= :36, from ../../chrome/browser/browser_process_platform_part_ba= se.h:11, from ../../chrome/browser/browser_process_platform_part.h:= 20, from ../../chrome/browser/browser_process.h:21, from ./../../chrome/browser/page_load_metrics/observers/co= re_page_load_metrics_observer.cc:13, from gen/chrome/browser/browser_jumbo_8.cc:8: gen/mojo/public/mojom/base/values.mojom-shared-internal.h:31:48: warning: a= lignment 1 of ?mojo_base::mojom::internal::Value_Data? is less than 8 [-Wpa= cked-not-aligned] class COMPONENT_EXPORT(MOJO_BASE_MOJOM_SHARED) Value_Data { ^~~~~~~~~~ In file included from gen/services/resource_coordinator/public/mojom/memory= _instrumentation/memory_instrumentation.mojom-shared.h:24, from gen/services/resource_coordinator/public/mojom/memory= _instrumentation/memory_instrumentation.mojom.h:28, from ../../services/resource_coordinator/public/cpp/memory= _instrumentation/coordinator.h:8, from ../../services/resource_coordinator/public/cpp/memory= _instrumentation/memory_instrumentation.h:12, from ../../chrome/browser/page_load_metrics/observers/data= _reduction_proxy_metrics_observer.h:18, from ./../../chrome/browser/page_load_metrics/observers/da= ta_reduction_proxy_metrics_observer.cc:5, from gen/chrome/browser/browser_jumbo_8.cc:10: gen/services/resource_coordinator/public/mojom/memory_instrumentation/memor= y_instrumentation.mojom-shared-internal.h:174:66: warning: alignment 1 of ?= memory_instrumentation::mojom::internal::RawAllocatorDumpEntryValue_Data? i= s less=20 than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(RESOURCE_COORDINATOR_PUBLIC_MOJOM_SHARED) RawAlloca= torDumpEntryValue_Data { ^~~~~~~~~= ~~~~~~~~~~~~~~~~~~~~~~ In file included from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom-shared.h:24, from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom.h:28, from ../../content/public/browser/render_process_host.h:25, from ./../../chrome/browser/page_load_metrics/observers/da= ta_reduction_proxy_metrics_observer.cc:30, from gen/chrome/browser/browser_jumbo_8.cc:10: gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:92:53: warning: alignment 1 of ?blink::mojom::intern= al::OpenResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) OpenResult_Data { ^~~~~~~~~~~~~~~ gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:171:53: warning: alignment 1 of ?blink::mojom::inter= nal::MatchResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) MatchResult_Data { ^~~~~~~~~~~~~~~~ gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:250:53: warning: alignment 1 of ?blink::mojom::inter= nal::MatchAllResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) MatchAllResult_Data { ^~~~~~~~~~~~~~~~~~~ In file included from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom-shared.h:24, from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom.h:28, from ../../content/public/browser/render_process_host.h:25, from ./../../chrome/browser/page_load_metrics/observers/da= ta_reduction_proxy_metrics_observer.cc:30, from gen/chrome/browser/browser_jumbo_8.cc:10: gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:329:53: warning: alignment 1 of ?blink::mojom::inter= nal::CacheKeysResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) CacheKeysResult_Data { ^~~~~~~~~~~~~~~~~~~~ [13590/19325] CXX obj/chrome/browser/browser/browser_jumbo_5.o In file included from gen/mojo/public/mojom/base/string16.mojom-shared-inte= rnal.h:12, from gen/device/usb/public/mojom/device.mojom-shared-inter= nal.h:12, from gen/device/usb/public/mojom/chooser_service.mojom-sha= red-internal.h:12, from gen/device/usb/public/mojom/chooser_service.mojom-sha= red.h:24, from gen/device/usb/public/mojom/chooser_service.mojom.h:2= 8, from ../../content/public/browser/content_browser_client.h= :30, from ../../chrome/browser/profiles/profile.h:18, from ../../chrome/browser/google/google_search_domain_mixi= ng_metrics_emitter_factory.h:11, from ./../../chrome/browser/google/google_search_domain_mi= xing_metrics_emitter_factory.cc:5, from gen/chrome/browser/browser_jumbo_5.cc:5: gen/mojo/public/mojom/base/big_buffer.mojom-shared-internal.h:30:48: warnin= g: alignment 1 of ?mojo_base::mojom::internal::BigBuffer_Data? is less than= 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJO_BASE_MOJOM_SHARED) BigBuffer_Data { ^~~~~~~~~~~~~~ In file included from gen/services/network/public/mojom/network_context.moj= om-shared-internal.h:14, from gen/services/network/public/mojom/network_service.moj= om-shared-internal.h:13, from gen/services/network/public/mojom/network_service.moj= om-shared.h:24, from gen/services/network/public/mojom/network_service.moj= om.h:28, from ../../content/public/browser/content_browser_client.h= :36, from ../../chrome/browser/profiles/profile.h:18, from ../../chrome/browser/google/google_search_domain_mixi= ng_metrics_emitter_factory.h:11, from ./../../chrome/browser/google/google_search_domain_mi= xing_metrics_emitter_factory.cc:5, from gen/chrome/browser/browser_jumbo_5.cc:5: gen/mojo/public/mojom/base/values.mojom-shared-internal.h:31:48: warning: a= lignment 1 of ?mojo_base::mojom::internal::Value_Data? is less than 8 [-Wpa= cked-not-aligned] class COMPONENT_EXPORT(MOJO_BASE_MOJOM_SHARED) Value_Data { ^~~~~~~~~~ In file included from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom-shared.h:24, from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom.h:28, from ../../content/public/browser/render_process_host.h:25, from ../../content/public/browser/network_quality_observer= _factory.h:14, from ./../../chrome/browser/io_thread.cc:60, from gen/chrome/browser/browser_jumbo_5.cc:31: gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:92:53: warning: alignment 1 of ?blink::mojom::intern= al::OpenResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) OpenResult_Data { ^~~~~~~~~~~~~~~ gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:171:53: warning: alignment 1 of ?blink::mojom::inter= nal::MatchResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) MatchResult_Data { ^~~~~~~~~~~~~~~~ gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:250:53: warning: alignment 1 of ?blink::mojom::inter= nal::MatchAllResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) MatchAllResult_Data { ^~~~~~~~~~~~~~~~~~~ In file included from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom-shared.h:24, from gen/third_party/blink/public/platform/modules/cache_s= torage/cache_storage.mojom.h:28, from ../../content/public/browser/render_process_host.h:25, from ../../content/public/browser/network_quality_observer= _factory.h:14, from ./../../chrome/browser/io_thread.cc:60, from gen/chrome/browser/browser_jumbo_5.cc:31: gen/third_party/blink/public/platform/modules/cache_storage/cache_storage.m= ojom-shared-internal.h:329:53: warning: alignment 1 of ?blink::mojom::inter= nal::CacheKeysResult_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) CacheKeysResult_Data { ^~~~~~~~~~~~~~~~~~~~ In file included from gen/third_party/blink/public/platform/modules/present= ation/presentation.mojom-shared.h:24, from gen/third_party/blink/public/platform/modules/present= ation/presentation.mojom.h:28, from ../../content/public/browser/presentation_service_del= egate.h:17, from ../../chrome/browser/media/router/media_router.h:26, from ./../../chrome/browser/media/cast_remoting_connector.= cc:16, from gen/chrome/browser/browser_jumbo_5.cc:39: gen/third_party/blink/public/platform/modules/presentation/presentation.moj= om-shared-internal.h:137:53: warning: alignment 1 of ?blink::mojom::interna= l::PresentationConnectionMessage_Data? is less than 8 [-Wpacked-not-aligned] class COMPONENT_EXPORT(MOJOM_SHARED_CONTENT_EXPORT) PresentationConnection= Message_Data { ^~~~~~~~~~~~~~~~~~~~~~= ~~~~~~~~~~~~ ninja: build stopped: subcommand failed. Backtrace: 4 (primitive-load "/gnu/store/zic2hlrw2j88fsw8b731kmrk1d5?") In ice-9/eval.scm: 191:35 3 (_ _) In srfi/srfi-1.scm: 640:9 2 (for-each # ?) In /gnu/store/f95ghy8mx00fc22nrvswvnpqlfdkf2nk-module-import/guix/build/gnu= -build-system.scm: 799:31 1 (_ _) In /gnu/store/f95ghy8mx00fc22nrvswvnpqlfdkf2nk-module-import/guix/build/uti= ls.scm: 616:6 0 (invoke _ . _) /gnu/store/f95ghy8mx00fc22nrvswvnpqlfdkf2nk-module-import/guix/build/utils.= scm:616:6: In procedure invoke: Throw to key `srfi-34' with args `(#)'. builder for `/gnu/store/nlxwmgqigbysmjq3j9vx1rk7kdqc74zp-chromium-68.0.3440= =2E84.drv' failed with exit code 1 @ build-failed /gnu/store/nlxwmgqigbysmjq3j9vx1rk7kdqc74zp-chromium-68.0.34= 40.84.drv - 1 builder for `/gnu/store/nlxwmgqigbysmjq3j9vx1rk7kdqc74zp-chro= mium-68.0.3440.84.drv' failed with exit code 1 derivation '/gnu/store/nlxwmgqigbysmjq3j9vx1rk7kdqc74zp-chromium-68.0.3440.= 84.drv' offloaded to '192.168.1.198' failed: build of `/gnu/store/nlxwmgqig= bysmjq3j9vx1rk7kdqc74zp-chromium-68.0.3440.84.drv' failed @ build-failed /gnu/store/nlxwmgqigbysmjq3j9vx1rk7kdqc74zp-chromium-68.0.34= 40.84.drv - 1 builder for `/gnu/store/nlxwmgqigbysmjq3j9vx1rk7kdqc74zp-chro= mium-68.0.3440.84.drv' failed with exit code 100 guix build: error: build failed: build of `/gnu/store/nlxwmgqigbysmjq3j9vx1= rk7kdqc74zp-chromium-68.0.3440.84.drv' failed --avrxomh2xkp23zzn-- --ytlnuqtgu6hgpflx Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCgAdFiEEqIyK3RKYKNfqwC5S4i+bv+40hYgFAltnjwgACgkQ4i+bv+40 hYjY1RAAr9vNjO5Np5VHwNffptodsFeE9pT3urEtdi18uDA9Cc0Pa4iekbHfj9nL +6Yvu+/kcF8njlXu/GvJNy4odexb2O8JSvAHF3DG0vkcrNxpw71IddVPAlvOW6gu U600x/RR96RvekqSjTHI907Tq1uM1kLy5WNuW7zSf3cVc5PsxBFQgyS1ISpEmpri S+HtsmnPJgAB6wqci4BWZLjBSuwT6Oxkb6Jiyt72rH4xqo8SiGyZjvmzuhwOlI+e HEAxPdj6ZTlGSBzutUOUHWUfCf7MivpZJec/4IuyX2g6mGrTcZsLvEKB4aFMxW0N 3wLNEFd9QP7e1S/0K6HNBMo8T5+fGslBrsF9Yh35JP6i3Un1aXXZ84HXRyB7HHyD gmx/iQvpW68XwV3xcjahhvMGn2+6OUXMYxeOI7PTuRlT7k7d7qxWs4duw6qF4TRk yqKJWoiXjTe4JwgDUh5RmeApn/gRw1S7F/0t3SmSLNNnYpyZgbVi/xmjw8/lwttN Mpt7WjyYk++0M361OvnJDK/nui/tlR3LdFiXMqFUpweGLzH/ZJHwSAWGG8I6eMMU 84HNt35xiTkP3OUeT+FAHVHwNiZAUdeh0aCHANLCyQ6lgXV8idLTjd0GP+7FyJrv x7erFvIZSDHwErx5UKjDCNOETGTT02iHsAVLAGKpJG8yY475WzE= =8Dz1 -----END PGP SIGNATURE----- --ytlnuqtgu6hgpflx-- From debbugs-submit-bounces@debbugs.gnu.org Mon Aug 06 04:22:38 2018 Received: (at 28004) by debbugs.gnu.org; 6 Aug 2018 08:22:39 +0000 Received: from localhost ([127.0.0.1]:42257 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fmamk-0002ei-Ou for submit@debbugs.gnu.org; Mon, 06 Aug 2018 04:22:38 -0400 Received: from mail-lj1-f169.google.com ([209.85.208.169]:33715) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fmamj-0002eS-8k for 28004@debbugs.gnu.org; Mon, 06 Aug 2018 04:22:37 -0400 Received: by mail-lj1-f169.google.com with SMTP id s12-v6so9890987ljj.0 for <28004@debbugs.gnu.org>; Mon, 06 Aug 2018 01:22:37 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:to:cc:subject:references:date:in-reply-to:message-id :user-agent:mime-version; bh=J7bv3mrLiNdBt7BMizG28Q1CWXpdUzkY5PydPFS8/tg=; b=p2JA47ze9DadJ6YDZJ0cEQqV1VKezLMtcOX+J0/JXzd2QsEmX0FkISURa8QKR+l2Cy Nq3Y8RPxt69DIfVLpTXas3eOSCX8Nevccv9uy/MCj4QOz+mNSSHif+934uee267WdQ4S o5lhNbadFoG5PRaPpGTIahAmVwgIpIeZ/CRdWkoAiADXA1LKKyLEYDgDSpE1JIR3qzmm sdMRMPAwfbvtAlVqm31kum4IJ0hJI35bPsEPrR2+q3Tp3+MyYysk5EpQjNdiJkcNZVHS r1fpAXJw02/nw0bihK0AHukSE8LO7Ctk9ttVmaYx35ezWIZrkeS7tiJDxrIIHrcamwWc rqng== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:to:cc:subject:references:date:in-reply-to :message-id:user-agent:mime-version; bh=J7bv3mrLiNdBt7BMizG28Q1CWXpdUzkY5PydPFS8/tg=; b=fOso3NhOUJJaPgW6v+AChvipT4COhfKviXzOXDrilRmCp/l6oJBkuyW0OlTXg6fibJ QPtu+UqMy4aQst8rCOjtgL9EYRmo9kD0dbHeSSHhvgDMcqZE6Ez/UD1WPJ2Cf5JEdTaI 1NI0iqtOCrAH+hJVS3RUxgsRSNb5DWVxFBu16J7+co26B1qIM/2o4XJzbDuH4rsee2Mv inYizAxb0s5Hemx+D7k//CzCEc3RtaSkEx4jNbbZDpvVxjD/iYPiYy6n2eEUgJkjNoqc 61UIgL5jJJJV/oQAUSNNvAtvaN/pL54l/lUEZrTjL8RSJq3cY4J8r7UYAXJEHw3zymRp +asg== X-Gm-Message-State: AOUpUlHVVMJKBH9/6KYeS71VBnYBUQhN89bRR82h88KBlfFsO/y99dSc BDsIiMWwKBIftCVX+9UCpOjUAA6w X-Google-Smtp-Source: AAOMgpeABtFig711wDei7IFa6DNfkHju1jTPnTt0TtyepF/4KNNeL4itO9R72lOkDyrayl+fa98QeA== X-Received: by 2002:a2e:97c8:: with SMTP id m8-v6mr12735283ljj.52.1533543750953; Mon, 06 Aug 2018 01:22:30 -0700 (PDT) Received: from magnolia (92-100-243-83.dynamic.avangarddsl.ru. [92.100.243.83]) by smtp.gmail.com with ESMTPSA id o86-v6sm2082228lfi.82.2018.08.06.01.22.29 (version=TLS1_2 cipher=ECDHE-RSA-CHACHA20-POLY1305 bits=256/256); Mon, 06 Aug 2018 01:22:30 -0700 (PDT) From: Oleg Pykhalov To: Marius Bakke Subject: Re: [bug#28004] Chromium References: <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> <20180316173044.dctlydfij7smndxd@abyayala> <87h8pfc3tr.fsf@fastmail.com> <20180316175225.7jf4k2qaciyxnepp@abyayala> <20180725080800.stqijlny6om6powe@abyayala> <87tvo9c6cs.fsf@fastmail.com> Date: Mon, 06 Aug 2018 11:22:25 +0300 In-Reply-To: <87tvo9c6cs.fsf@fastmail.com> (Marius Bakke's message of "Sun, 05 Aug 2018 15:04:19 +0200") Message-ID: <87tvo7lxa6.fsf@gmail.com> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --=-=-= Content-Type: text/plain Hello, compiled successfully on 340ee00bbf91a8e0ea567d00d7ff54dd025abc05 Thanks, Oleg. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAEBCgAdFiEEc+OyAXw1EaDPCmAPckbhHGm3lWkFAltoBUEACgkQckbhHGm3 lWnbDxAAtgEmUKqqvSyoVLZ7K5RShwgSVySLHudzWu+cYWvJpA+eAzPgKzZYdJwu larVccguqwL1JodI1Gveoct5h1Pebmht5ivWKgC52Dgxziym9E4fpBoCJ4sGpIU1 DmKydR9Y5jmgXcsQGh1myywUHoZgX6dWGOlJYiZVUl67IATp7d1Z+KdOb5ybt9gw ZMEJ265KKiTAoSn8dScHoCr1ZU87+YRZH2MASIRWU6g9qiGReGTGJyywGsl36X8B ro/rcL9WJ5K4lmQvhfrvd5judhxq8gAouZwVxd2epu3JhYbysTn35GcVepsR0S8v TFcv0+TZ8feNGN4UARuz+Y/GZAeq1FwsFmK/xooCkc7EjUpl8oKiJiFDj1Z9D/F0 QfhpSNRz/eUG9qWhnlqCjfyBUqmSW3tC+e9tj14kimlwTwr71r6x15RkF6rmkkxu /dZVeEa+tiSNWI8aPYHuaqoXXZP+6Zy4dO6xPQS/PS4fG/mOUPvwr8onGjU4IMYi T/DzcOpk6B4ONtDyUwAVqvDsH/6x/FoQr9rJnsNGVxD9INac1LKx6VQuEAqZ0ht4 35n0bIR3qnzdVBITaq41b7G3HI2+1R5Q6knLxA16UMvyenIroYPvrH2OEi8HcHjR WSL6aW/zie0s/MCe/tir+vxVtipxreC/vQKbAS1qSAgn6biUH00= =drr5 -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Wed Aug 29 19:31:49 2018 Received: (at 28004) by debbugs.gnu.org; 29 Aug 2018 23:31:49 +0000 Received: from localhost ([127.0.0.1]:37633 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fv9wD-0003dt-Jk for submit@debbugs.gnu.org; Wed, 29 Aug 2018 19:31:49 -0400 Received: from relay1-d.mail.gandi.net ([217.70.183.193]:53143) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fv9wC-0003cH-DR for 28004@debbugs.gnu.org; Wed, 29 Aug 2018 19:31:48 -0400 Received: from webmail.gandi.net (webmail1.sd4.0x35.net [10.200.201.1]) (Authenticated sender: amirouche@hypermove.net) by relay1-d.mail.gandi.net (Postfix) with ESMTPA id 24399240003 for <28004@debbugs.gnu.org>; Wed, 29 Aug 2018 23:31:46 +0000 (UTC) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII; format=flowed Content-Transfer-Encoding: 7bit Date: Thu, 30 Aug 2018 01:31:46 +0200 From: Amirouche Boubekki To: 28004@debbugs.gnu.org Subject: (no subject) Message-ID: X-Sender: amirouche@hypermove.net User-Agent: Roundcube Webmail/1.1.2 X-Spam-Score: 1.3 (+) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: I would like to work on the TODO items. * There is still some data transmitted when starting the browser for the first time. It seems related to the "domain_reliability" component. * Remove remaining "Web Store" links. Currently I've only found it in settings, under "accessibility" and "fonts". [...] Content analysis details: (1.3 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 2.0 SLIGHTLY_BAD_SUBJECT Subject contains something slightly spammy -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low trust [217.70.183.193 listed in list.dnswl.org] X-Debbugs-Envelope-To: 28004 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 0.3 (/) I would like to work on the TODO items. * There is still some data transmitted when starting the browser for the first time. It seems related to the "domain_reliability" component. * Remove remaining "Web Store" links. Currently I've only found it in settings, under "accessibility" and "fonts". Is is taken by anybody? The build is in progress, I will report later. From debbugs-submit-bounces@debbugs.gnu.org Thu Aug 30 02:04:21 2018 Received: (at 28004) by debbugs.gnu.org; 30 Aug 2018 06:04:21 +0000 Received: from localhost ([127.0.0.1]:37825 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fvG45-0007nN-6g for submit@debbugs.gnu.org; Thu, 30 Aug 2018 02:04:21 -0400 Received: from relay4-d.mail.gandi.net ([217.70.183.196]:40629) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fvG44-0007nG-A8 for 28004@debbugs.gnu.org; Thu, 30 Aug 2018 02:04:20 -0400 Received: from webmail.gandi.net (webmail1.sd4.0x35.net [10.200.201.1]) (Authenticated sender: amirouche@hypermove.net) by relay4-d.mail.gandi.net (Postfix) with ESMTPA id B64C5E000B; Thu, 30 Aug 2018 06:04:18 +0000 (UTC) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII; format=flowed Content-Transfer-Encoding: 7bit Date: Thu, 30 Aug 2018 08:04:18 +0200 From: Amirouche Boubekki To: Oleg Pykhalov Subject: Re: [bug#28004] Chromium In-Reply-To: <87tvo7lxa6.fsf@gmail.com> References: <87fu75aar5.fsf@fastmail.com> <874lnkr0vf.fsf@gnu.org> <87vaejvclc.fsf@fastmail.com> <20180226200133.zsnahblbgzovrtmu@abyayala> <87muzvv7ku.fsf@fastmail.com> <20180226234144.032af030@alma-ubu> <87woyxt3nz.fsf@fastmail.com> <20180316173044.dctlydfij7smndxd@abyayala> <87h8pfc3tr.fsf@fastmail.com> <20180316175225.7jf4k2qaciyxnepp@abyayala> <20180725080800.stqijlny6om6powe@abyayala> <87tvo9c6cs.fsf@fastmail.com> <87tvo7lxa6.fsf@gmail.com> Message-ID: <867c3ef88a05a8398281df6bd717e24a@hypermove.net> X-Sender: amirouche@hypermove.net User-Agent: Roundcube Webmail/1.1.2 X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, Marius Bakke , Guix-patches X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) compiled successfully on 256d5c6e339d59287284bb83f35c594f13bd08f9 I have the following messages appear: Gtk-Message: 07:58:25.671: Failed to load module "canberra-gtk-module" [3434:3434:0830/075901.665931:ERROR:sandbox_linux.cc(378)] InitializeSandbox() called with multiple threads in process gpu-process. libpng warning: iCCP: known incorrect sRGB profile (pkix_CacheCert_Add: PKIX_PL_HashTable_Add for Certs skipped: entry existed I tested http://hyperdev.fr/ and https://zty.pe/ If nobody is working on the remaining TODO items, I will work my way through it. LMK. From debbugs-submit-bounces@debbugs.gnu.org Thu Aug 30 05:57:42 2018 Received: (at 28004) by debbugs.gnu.org; 30 Aug 2018 09:57:42 +0000 Received: from localhost ([127.0.0.1]:37926 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fvJhu-0004z1-1L for submit@debbugs.gnu.org; Thu, 30 Aug 2018 05:57:42 -0400 Received: from eggs.gnu.org ([208.118.235.92]:42934) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fvJhs-0004yi-Bi for 28004@debbugs.gnu.org; Thu, 30 Aug 2018 05:57:40 -0400 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1fvJhj-0005Gn-Pt for 28004@debbugs.gnu.org; Thu, 30 Aug 2018 05:57:34 -0400 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00 autolearn=disabled version=3.3.2 Received: from fencepost.gnu.org ([2001:4830:134:3::e]:42464) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1fvJhj-0005Gg-MN; Thu, 30 Aug 2018 05:57:31 -0400 Received: from [193.50.110.186] (port=42692 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1fvJhj-0000iV-DV; Thu, 30 Aug 2018 05:57:31 -0400 From: ludo@gnu.org (Ludovic =?utf-8?Q?Court=C3=A8s?=) To: =?utf-8?Q?Cl=C3=A9ment?= Lassieur Subject: Re: Firefox 52's end of life, packaging Chromium References: <87ftyx35pw.fsf@lassieur.org> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 13 Fructidor an 226 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Thu, 30 Aug 2018 11:57:29 +0200 In-Reply-To: <87ftyx35pw.fsf@lassieur.org> (=?utf-8?Q?=22Cl=C3=A9ment?= Lassieur"'s message of "Wed, 29 Aug 2018 11:03:07 +0200") Message-ID: <87h8jcyy5y.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Received-From: 2001:4830:134:3::e X-Spam-Score: -5.0 (-----) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org, Marius Bakke X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -6.0 (------) Hello, Cl=C3=A9ment Lassieur skribis: > So the question is: can we push the Chromium package? I've read it's > almost ready[2]. It's probably far better than everything we have, > despite not being totally 'finished'. Maybe we can add what's left to > do as a TODO and fix the package later? As long as the freedom issues and phone-home issues are addressed, which appears to be the case, I=E2=80=99m all for it. Marius? Thanks, Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Thu Aug 30 09:25:01 2018 Received: (at 28004) by debbugs.gnu.org; 30 Aug 2018 13:25:01 +0000 Received: from localhost ([127.0.0.1]:38078 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fvMwX-0007lR-Go for submit@debbugs.gnu.org; Thu, 30 Aug 2018 09:25:01 -0400 Received: from static.195.114.201.195.clients.your-server.de ([195.201.114.195]:37156 helo=conspiracy.of.n0.pm) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fvMwU-0007l9-TW for 28004@debbugs.gnu.org; Thu, 30 Aug 2018 09:24:59 -0400 Received: by conspiracy.of.n0.pm (OpenSMTPD) with ESMTPSA id 84244e19 (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256:NO); Thu, 30 Aug 2018 13:24:51 +0000 (UTC) Date: Thu, 30 Aug 2018 13:25:41 +0000 From: ng0 To: Marius Bakke Subject: Re: [bug#28004] Chromium Message-ID: <20180830132541.6kyqgmp4w7f2i2di@abyayala> References: <87woyxt3nz.fsf@fastmail.com> <20180316173044.dctlydfij7smndxd@abyayala> <87h8pfc3tr.fsf@fastmail.com> <20180316175225.7jf4k2qaciyxnepp@abyayala> <20180725080800.stqijlny6om6powe@abyayala> <87tvo9c6cs.fsf@fastmail.com> <20180805161802.bif4ax5feqloxayz@abyayala> <87lg9kd61u.fsf@fastmail.com> <20180805203222.iyvpw5wansinz6tb@abyayala> <20180805235800.txqdbuawyu5y2i4m@abyayala> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline In-Reply-To: <20180805235800.txqdbuawyu5y2i4m@abyayala> X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, ng0 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Build sucessfully on f9e140a243b6d6b5d28bd0813b69604562a39653. Previously the lack of a swapfile was to blame - when you don't run headless this really requires a swapfile when you have 8 GB RAM. From debbugs-submit-bounces@debbugs.gnu.org Sun Sep 02 00:39:39 2018 Received: (at 28004) by debbugs.gnu.org; 2 Sep 2018 04:39:39 +0000 Received: from localhost ([127.0.0.1]:42303 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fwKAl-000263-N3 for submit@debbugs.gnu.org; Sun, 02 Sep 2018 00:39:39 -0400 Received: from world.peace.net ([64.112.178.59]:50436) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fwKAk-00025p-BP for 28004@debbugs.gnu.org; Sun, 02 Sep 2018 00:39:38 -0400 Received: from mhw by world.peace.net with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.89) (envelope-from ) id 1fwKAe-0006me-4n; Sun, 02 Sep 2018 00:39:32 -0400 From: Mark H Weaver To: Marius Bakke Subject: Re: [bug#28004] Chromium FSDG requirements Date: Sun, 02 Sep 2018 00:37:53 -0400 Message-ID: <87lg8kzf8e.fsf@netris.org> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hi Marius, Does the modified version of Chromium in your draft package support Encrypted Media Extensions (EME)? https://en.wikipedia.org/wiki/Encrypted_Media_Extensions Does it refer to third-party repositories of software that are not committed to only including free software? Does it contain spyware? Thanks, Mark From debbugs-submit-bounces@debbugs.gnu.org Sun Sep 02 09:18:07 2018 Received: (at 28004) by debbugs.gnu.org; 2 Sep 2018 13:18:07 +0000 Received: from localhost ([127.0.0.1]:42443 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fwSGF-0004II-RX for submit@debbugs.gnu.org; Sun, 02 Sep 2018 09:18:06 -0400 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:58563) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fwSFe-0004HI-OU for 28004@debbugs.gnu.org; Sun, 02 Sep 2018 09:17:40 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id D838A21910; Sun, 2 Sep 2018 09:17:03 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Sun, 02 Sep 2018 09:17:03 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm3; bh=tBWgVG8nWIhDU/j3MTEv7hFLRBq7cHLWStDzfTbGeYk=; b=bz8AfRIb 4bb+YK9VFympJQPxbBbTfCLfBiod7HrGWL165ipWWIQH68zgGjZLWh0dO4oiQ4nO TBxJMSgrZInmifjxRQMUA/DNiMiSsrnkU1B4yDPFmdpNYCXfSC+G8f70/bCceHPC UcxH4kcPQc4XVgGKe0rsA8U8Uk8vO25pUQhyRYDoyLnXulbqTZKloB9y4YKlumdJ 1WfU2CI4Tk7kPSqHtnEX9DY2rd+5P8Vgt/9WITQi8z5VEffMZVMEGiSR9F2IogAD pi8x1tpUA6T2kfYXuIYLSZzOAgUqlIFXUpwy7Y/oTfEUj/A7eh1Ro8XxfYjytAmh rPIiQrTUFTJm4w== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm3; bh=tBWgVG8nWIhDU/j3MTEv7hFLRBq7c HLWStDzfTbGeYk=; b=cb0Bu5xEiIpXtnbAvWy0lG/bHOndFptgpoeIMWXLr5F6k 5aSgBG6e4i7DD+pWXkBQRvYrlBl9EJw9hk13PLkzvpp9GTCPLyQf0EvPh91n01Ei Bxykv+R5Zman6k6eKFod98w3mZ1JP8KWin6+flevkHO7ilqy0sUmrq4Lm3sMDEFu tgAurjCegOflhY+Vrv/eeqtPWNkEiIuZOZrTgf9Hj6QWNGZHe8T4QVBdr9g94Trx cfQ0DLzsDW0hfhMmdeoL7tpxhIeA3zieCAlpV5s2XoT6EQRkqFWnaPLZ4Vm5vOy5 bKzl5p5LwTToMGr0wXu+Gq2vf8RwOT++EGDJ0NmBg== X-ME-Proxy: X-ME-Sender: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 0C2B910294; Sun, 2 Sep 2018 09:17:02 -0400 (EDT) From: Marius Bakke To: Mark H Weaver Subject: Re: [bug#28004] Chromium FSDG requirements In-Reply-To: <87lg8kzf8e.fsf@netris.org> References: <87lg8kzf8e.fsf@netris.org> User-Agent: Notmuch/0.27 (https://notmuchmail.org) Emacs/26.1 (x86_64-pc-linux-gnu) Date: Sun, 02 Sep 2018 15:16:55 +0200 Message-ID: <87sh2sjayg.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --=-=-= Content-Type: text/plain Mark H Weaver writes: > Hi Marius, > > Does the modified version of Chromium in your draft package support > Encrypted Media Extensions (EME)? > > https://en.wikipedia.org/wiki/Encrypted_Media_Extensions No. EME is called "Widevine" in Chromium lingo and I believe all components are purged from the source. > Does it refer to third-party repositories of software that are not > committed to only including free software? Yes. It includes support for the Chromium "Web Store", although it's not usable in the default configuration. > Does it contain spyware? Not to my knowledge. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAluL4sgACgkQoqBt8qM6 VPpZyQf+MeQc6zGR4e1k8Im6HmI2zAC/goCSZk3yW/NmLFAIbc6a+QKwmlurVcQ2 bRPR3giLDNAAOWtEusaBaZzH7VPxjq3Rqzb82WHwsLCxmaaoV5vLnjxHlSPPduX9 qPsNAI07hs8V6LHl6dgY8tpG3n/Mg+1PjhHxI93TqIjNb5QeY5/2IYde6XMTL9Gg gBcBmkxjmOLQqB7QlbNQNaSdYLqiToI5CRHZcNHQv/HybOtra7izxvxW8vI2ygU9 n57DcMAVj+ImnBRfVbUia14W/cpwriGrmNwHtyxxWmFUwgVBv/7RziLD0BogRAuj xVDJgG4B2ACvKzduFciway/XXysXeA== =X/B0 -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Fri Sep 07 05:29:47 2018 Received: (at 28004) by debbugs.gnu.org; 7 Sep 2018 09:29:47 +0000 Received: from localhost ([127.0.0.1]:48796 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fyD5H-0004Qy-3E for submit@debbugs.gnu.org; Fri, 07 Sep 2018 05:29:47 -0400 Received: from mail.lassieur.org ([83.152.10.219]:54000) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1fyD5E-0004Qp-V1 for 28004@debbugs.gnu.org; Fri, 07 Sep 2018 05:29:45 -0400 Received: from newt (smtp.parrot.biz [62.23.167.188]) by mail.lassieur.org (OpenSMTPD) with ESMTPSA id 68acc2c2 (TLSv1.2:ECDHE-RSA-CHACHA20-POLY1305:256:NO); Fri, 7 Sep 2018 09:25:58 +0000 (UTC) References: <87ftyx35pw.fsf@lassieur.org> <87h8jcyy5y.fsf@gnu.org> User-agent: mu4e 1.0; emacs 26.1 From: =?utf-8?Q?Cl=C3=A9ment?= Lassieur To: Marius Bakke Subject: Re: Firefox 52's end of life, packaging Chromium In-reply-to: <87h8jcyy5y.fsf@gnu.org> Date: Fri, 07 Sep 2018 11:29:42 +0200 Message-ID: <87y3cdlkop.fsf@lassieur.org> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org, Ludovic =?utf-8?Q?Court?= =?utf-8?Q?=C3=A8s?= X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hello :-) Ludovic Court=C3=A8s writes: > Hello, > > Cl=C3=A9ment Lassieur skribis: > >> So the question is: can we push the Chromium package? I've read it's >> almost ready[2]. It's probably far better than everything we have, >> despite not being totally 'finished'. Maybe we can add what's left to >> do as a TODO and fix the package later? > > As long as the freedom issues and phone-home issues are addressed, which > appears to be the case, I=E2=80=99m all for it. > > Marius? Marius, what is the status, can we merge it? Cl=C3=A9ment From debbugs-submit-bounces@debbugs.gnu.org Sat Sep 15 06:36:59 2018 Received: (at 28004) by debbugs.gnu.org; 15 Sep 2018 10:36:59 +0000 Received: from localhost ([127.0.0.1]:41139 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1g17wh-0002d5-AR for submit@debbugs.gnu.org; Sat, 15 Sep 2018 06:36:59 -0400 Received: from mail.lassieur.org ([83.152.10.219]:54396) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1g17wd-0002cv-Ta for 28004@debbugs.gnu.org; Sat, 15 Sep 2018 06:36:57 -0400 Received: from rodion (88.191.118.83 [88.191.118.83]) by mail.lassieur.org (OpenSMTPD) with ESMTPSA id 9b1e3d1d (TLSv1.2:ECDHE-RSA-CHACHA20-POLY1305:256:NO); Sat, 15 Sep 2018 10:31:43 +0000 (UTC) References: <87ftyx35pw.fsf@lassieur.org> <87h8jcyy5y.fsf@gnu.org> <87y3cdlkop.fsf@lassieur.org> User-agent: mu4e 1.0; emacs 26.1 From: =?utf-8?Q?Cl=C3=A9ment?= Lassieur To: Marius Bakke Subject: Re: Firefox 52's end of life, packaging Chromium In-reply-to: <87y3cdlkop.fsf@lassieur.org> Date: Sat, 15 Sep 2018 12:36:53 +0200 Message-ID: <87sh2bnj22.fsf@lassieur.org> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Cl=C3=A9ment Lassieur writes: > Hello :-) > > Ludovic Court=C3=A8s writes: > >> Hello, >> >> Cl=C3=A9ment Lassieur skribis: >> >>> So the question is: can we push the Chromium package? I've read it's >>> almost ready[2]. It's probably far better than everything we have, >>> despite not being totally 'finished'. Maybe we can add what's left to >>> do as a TODO and fix the package later? >> >> As long as the freedom issues and phone-home issues are addressed, which >> appears to be the case, I=E2=80=99m all for it. >> >> Marius? > > Marius, what is the status, can we merge it? Ping > > Cl=C3=A9ment From debbugs-submit-bounces@debbugs.gnu.org Mon Sep 17 09:28:27 2018 Received: (at 28004) by debbugs.gnu.org; 17 Sep 2018 13:28:28 +0000 Received: from localhost ([127.0.0.1]:42673 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1g1tZj-00045D-H1 for submit@debbugs.gnu.org; Mon, 17 Sep 2018 09:28:27 -0400 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:55487) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1g1tZh-000455-SO for 28004@debbugs.gnu.org; Mon, 17 Sep 2018 09:28:26 -0400 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id A3663219E6; Mon, 17 Sep 2018 09:28:25 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Mon, 17 Sep 2018 09:28:25 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= cc:content-type:date:from:in-reply-to:message-id:mime-version :references:subject:to:x-me-sender:x-me-sender:x-sasl-enc; s= fm3; bh=DgX0u/3prLIdC+2abldqPZHRPjTvnnqpoZGgQeHHNOM=; b=Ek54ErUL XW7oOGOLNbBhgLVwTNABonBZWKc63EJBK4cNMMOWohCDKN95qOiv39AvjbaJnCA2 oGjmQUvyMFlKeBfWwjYsjAXliE3w4CZjQooKwX9lvppCypaPfE5jvEjsNel6W/SR 7kqDwYM6kqwmyrHAVnEszeB8e4dd0UJbv361Rl1gsWbsNrUYd6qn4djZtkC2qQ7N VTMP36pey442sFBVbJVeLCNNUs3wg/yVs9vAw7dqPDe6j+hsqGK7MJEW4leWushW dTCILo9bYtzTcsoEtLjRcNCgKa4WCpRQmVS1e3jdx9wUExluj0tkSsQEs7eODtk1 5nT+YntLv2BsdQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-sender :x-me-sender:x-sasl-enc; s=fm3; bh=DgX0u/3prLIdC+2abldqPZHRPjTvn nqpoZGgQeHHNOM=; b=BR2e6soRdQ+oicSsXgGI8zuLuJ3OEsHVgFWD0aGJkAbNG +ELsagrONIJoNxs2/73tisMSYlzp17Vuz6vCDblB6OwGPuMQ0L4/Zi1Fh6r3uDOR lVZ2HmJ+spjAVPz35IKqoIWhPzI6rnMw41u9UVyxTVt+aRTs9v1kIsBuUKUfehTq 2+idk+oOgE65UVhDNu0qT+E/yMvL2Ye19n1zaFUJPoPy4tjXbySzYq/c35OaGMT0 Ht+jpIvzYEmEmzKokvuAy6tFYu5Z8uuIK+zwbI0YzxFasv9zo4mPQfyChJDtv+fu jPYpK7MTDLDH/FVFcW4cFAMZCVemrZcs1+emYgbzw== X-ME-Proxy: X-ME-Sender: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id E8343102D9; Mon, 17 Sep 2018 09:28:24 -0400 (EDT) From: Marius Bakke To: =?utf-8?Q?Cl=C3=A9ment?= Lassieur Subject: Chromium channel In-Reply-To: <87sh2bnj22.fsf@lassieur.org> References: <87ftyx35pw.fsf@lassieur.org> <87h8jcyy5y.fsf@gnu.org> <87y3cdlkop.fsf@lassieur.org> <87sh2bnj22.fsf@lassieur.org> User-Agent: Notmuch/0.27 (https://notmuchmail.org) Emacs/26.1 (x86_64-pc-linux-gnu) Date: Mon, 17 Sep 2018 15:28:23 +0200 Message-ID: <87efdsp820.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Cl=C3=A9ment Lassieur writes: > Cl=C3=A9ment Lassieur writes: > >> Hello :-) >> >> Ludovic Court=C3=A8s writes: >> >>> Hello, >>> >>> Cl=C3=A9ment Lassieur skribis: >>> >>>> So the question is: can we push the Chromium package? I've read it's >>>> almost ready[2]. It's probably far better than everything we have, >>>> despite not being totally 'finished'. Maybe we can add what's left to >>>> do as a TODO and fix the package later? >>> >>> As long as the freedom issues and phone-home issues are addressed, which >>> appears to be the case, I=E2=80=99m all for it. >>> >>> Marius? >> >> Marius, what is the status, can we merge it? > > Ping Hello, sorry for the delay. I've set up a channel for Chromium here: https://gitlab.com/mbakke/guix-chromium Chromium has been updated for version 69 as well. I don't think we can merge as-is due to the tight Web Store integration (even if it's disabled), but I will start work on packaging the full "Ungoogled-Chromium" next: https://github.com/Eloston/ungoogled-chromium I'll bump this thread once it is ready for testing. Developments will happen in the Gitlab repository. Pull requests welcome! :-) --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlufq/cACgkQoqBt8qM6 VPqH1gf/ZgiTMb5+8b85Jch3VtUWF5AWK+0V79MyQ/BR5+79sktDt9H4U2petp3G 7E4TV76DyloMw7ARNthlZgClJd7IsMt7j8KieX+m5zTmyH8oa+GV0Z04X5XnMZCi Pfu4+TtQODnWjhpd/0I/U6lR7OofElPQHilxGs1RFZ2Bupak93P22YMnHVAMe7h/ n5ewxqjAuQtZHBZLVnV9q5uWw1BWoMUUFoR87k/ZWVkD8n4b3fE/ynUGef7LSLFl I76dv0vduO0nBXLBOX03a9djQaGTlyUYvUwTUt5iFhzPy3wDXdjHM6+aNmF96RWo OyueOoGE6dqLUjeu8vGhgkuq15CL4A== =ubKT -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Mon Sep 17 10:16:53 2018 Received: (at 28004) by debbugs.gnu.org; 17 Sep 2018 14:16:53 +0000 Received: from localhost ([127.0.0.1]:43230 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1g1uKX-0005Ox-EZ for submit@debbugs.gnu.org; Mon, 17 Sep 2018 10:16:53 -0400 Received: from mail.lassieur.org ([83.152.10.219]:58078) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1g1uKV-0005Ol-Dz for 28004@debbugs.gnu.org; Mon, 17 Sep 2018 10:16:48 -0400 Received: from newt (smtp.parrot.biz [62.23.167.188]) by mail.lassieur.org (OpenSMTPD) with ESMTPSA id c72ac34b (TLSv1.2:ECDHE-RSA-CHACHA20-POLY1305:256:NO); Mon, 17 Sep 2018 14:16:10 +0000 (UTC) References: <87ftyx35pw.fsf@lassieur.org> <87h8jcyy5y.fsf@gnu.org> <87y3cdlkop.fsf@lassieur.org> <87sh2bnj22.fsf@lassieur.org> <87efdsp820.fsf@fastmail.com> User-agent: mu4e 1.0; emacs 26.1 From: =?utf-8?Q?Cl=C3=A9ment?= Lassieur To: Marius Bakke Subject: Re: Chromium channel In-reply-to: <87efdsp820.fsf@fastmail.com> Date: Mon, 17 Sep 2018 16:16:43 +0200 Message-ID: <87pnxccipg.fsf@lassieur.org> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Marius Bakke writes: > Cl=C3=A9ment Lassieur writes: > >> Cl=C3=A9ment Lassieur writes: >> >>> Hello :-) >>> >>> Ludovic Court=C3=A8s writes: >>> >>>> Hello, >>>> >>>> Cl=C3=A9ment Lassieur skribis: >>>> >>>>> So the question is: can we push the Chromium package? I've read it's >>>>> almost ready[2]. It's probably far better than everything we have, >>>>> despite not being totally 'finished'. Maybe we can add what's left to >>>>> do as a TODO and fix the package later? >>>> >>>> As long as the freedom issues and phone-home issues are addressed, whi= ch >>>> appears to be the case, I=E2=80=99m all for it. >>>> >>>> Marius? >>> >>> Marius, what is the status, can we merge it? >> >> Ping > > Hello, sorry for the delay. > > I've set up a channel for Chromium here: > > https://gitlab.com/mbakke/guix-chromium > > Chromium has been updated for version 69 as well. > > I don't think we can merge as-is due to the tight Web Store integration > (even if it's disabled), but I will start work on packaging the full > "Ungoogled-Chromium" next: > > https://github.com/Eloston/ungoogled-chromium > > I'll bump this thread once it is ready for testing. Developments will > happen in the Gitlab repository. Pull requests welcome! :-) Great! Thank you very much Marius, and sorry for insisting. The 'channels' solution seems to fit very well! Cl=C3=A9ment From debbugs-submit-bounces@debbugs.gnu.org Mon Sep 17 13:57:16 2018 Received: (at 28004) by debbugs.gnu.org; 17 Sep 2018 17:57:16 +0000 Received: from localhost ([127.0.0.1]:43336 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1g1xlr-0002u5-Ry for submit@debbugs.gnu.org; Mon, 17 Sep 2018 13:57:16 -0400 Received: from mail.thebird.nl ([94.142.245.5]:48970) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1g1xlq-0002tp-93 for 28004@debbugs.gnu.org; Mon, 17 Sep 2018 13:57:14 -0400 Received: by mail.thebird.nl (Postfix, from userid 1000) id F1DB28EAA; Mon, 17 Sep 2018 19:57:07 +0200 (CEST) Date: Mon, 17 Sep 2018 19:57:07 +0200 From: Pjotr Prins To: Marius Bakke Subject: Re: Chromium channel Message-ID: <20180917175707.hfxkyr6r7q6geqdb@thebird.nl> References: <87ftyx35pw.fsf@lassieur.org> <87h8jcyy5y.fsf@gnu.org> <87y3cdlkop.fsf@lassieur.org> <87sh2bnj22.fsf@lassieur.org> <87efdsp820.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <87efdsp820.fsf@fastmail.com> User-Agent: NeoMutt/20170113 (1.7.2) X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org, =?iso-8859-1?Q?Cl=E9ment?= Lassieur X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) On Mon, Sep 17, 2018 at 03:28:23PM +0200, Marius Bakke wrote: > I've set up a channel for Chromium here: > > https://gitlab.com/mbakke/guix-chromium Too much coolness. I am fainting! Pj. From debbugs-submit-bounces@debbugs.gnu.org Mon Sep 17 14:07:31 2018 Received: (at 28004) by debbugs.gnu.org; 17 Sep 2018 18:07:31 +0000 Received: from localhost ([127.0.0.1]:43340 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1g1xvi-0003AH-Qr for submit@debbugs.gnu.org; Mon, 17 Sep 2018 14:07:30 -0400 Received: from static.195.114.201.195.clients.your-server.de ([195.201.114.195]:51426 helo=conspiracy.of.n0.pm) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1g1xvg-0003A3-Gb for 28004@debbugs.gnu.org; Mon, 17 Sep 2018 14:07:25 -0400 Received: by conspiracy.of.n0.pm (OpenSMTPD) with ESMTPSA id 545b28b1 (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256:NO); Mon, 17 Sep 2018 18:07:16 +0000 (UTC) Date: Mon, 17 Sep 2018 18:08:10 +0000 From: Nils Gillmann To: =?utf-8?Q?Cl=C3=A9ment?= Lassieur Subject: Re: Chromium channel Message-ID: <20180917180810.4phfdlo34jmu4r4r@abyayala> Mail-Followup-To: =?utf-8?Q?Cl=C3=A9ment?= Lassieur , Marius Bakke , guix-devel@gnu.org, 28004@debbugs.gnu.org References: <87ftyx35pw.fsf@lassieur.org> <87h8jcyy5y.fsf@gnu.org> <87y3cdlkop.fsf@lassieur.org> <87sh2bnj22.fsf@lassieur.org> <87efdsp820.fsf@fastmail.com> <87pnxccipg.fsf@lassieur.org> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: 8bit In-Reply-To: <87pnxccipg.fsf@lassieur.org> X-Spam-Score: 2.0 (++) X-Spam-Report: Spam detection software, running on the system "debbugs.gnu.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: Clément Lassieur transcribed 1.4K bytes: > Marius Bakke writes: > > > Clément Lassieur writes: > > > >> Clément Lassieur writes: > >> > >>> Hello :-) > >>> > >>> Ludovic Courtès writes: > >>> > >>>> Hello, > >>>> > >>>> Clément Lassieur skribis: > >>>> > >>>>> So the question is: can we push the Chromium package? I've read it's > >>>>> almost ready[2]. It's probably far better than everything we have, > >>>>> despite not being totally 'finished'. Maybe we can add what's left to > >>>>> do as a TODO and fix the package later? > >>>> > >>>> As long as the freedom issues and phone-home issues are addressed, which > >>>> appears to be the case, I’m all for it. > >>>> > >>>> Marius? > >>> > >>> Marius, what is the status, can we merge it? > >> > >> Ping > > > > Hello, sorry for the delay. > > > > I've set up a channel for Chromium here: > > > > https://gitlab.com/mbakke/guix-chromium > > > > Chromium has been updated for version 69 as well. [...] Content analysis details: (2.0 points, 10.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -0.0 SPF_HELO_PASS SPF: HELO matches SPF record -0.0 SPF_PASS SPF: sender matches SPF record 2.0 KHOP_DYNAMIC Relay looks like a dynamic address X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org, Marius Bakke X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: 1.0 (+) Clément Lassieur transcribed 1.4K bytes: > Marius Bakke writes: > > > Clément Lassieur writes: > > > >> Clément Lassieur writes: > >> > >>> Hello :-) > >>> > >>> Ludovic Courtès writes: > >>> > >>>> Hello, > >>>> > >>>> Clément Lassieur skribis: > >>>> > >>>>> So the question is: can we push the Chromium package? I've read it's > >>>>> almost ready[2]. It's probably far better than everything we have, > >>>>> despite not being totally 'finished'. Maybe we can add what's left to > >>>>> do as a TODO and fix the package later? > >>>> > >>>> As long as the freedom issues and phone-home issues are addressed, which > >>>> appears to be the case, I’m all for it. > >>>> > >>>> Marius? > >>> > >>> Marius, what is the status, can we merge it? > >> > >> Ping > > > > Hello, sorry for the delay. > > > > I've set up a channel for Chromium here: > > > > https://gitlab.com/mbakke/guix-chromium > > > > Chromium has been updated for version 69 as well. Huh! Did the requirement for building go up by 100% with version 69? I will test if my 8GB RAM buildmachine can still build it like it used to up to version 68.x. > > I don't think we can merge as-is due to the tight Web Store integration > > (even if it's disabled), but I will start work on packaging the full > > "Ungoogled-Chromium" next: > > > > https://github.com/Eloston/ungoogled-chromium > > > > I'll bump this thread once it is ready for testing. Developments will > > happen in the Gitlab repository. Pull requests welcome! :-) > > Great! > > Thank you very much Marius, and sorry for insisting. The 'channels' > solution seems to fit very well! > > Clément > From debbugs-submit-bounces@debbugs.gnu.org Sat Sep 22 08:44:22 2018 Received: (at 28004) by debbugs.gnu.org; 22 Sep 2018 12:44:22 +0000 Received: from localhost ([127.0.0.1]:48824 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1g3hGo-00071k-Kv for submit@debbugs.gnu.org; Sat, 22 Sep 2018 08:44:22 -0400 Received: from eggs.gnu.org ([208.118.235.92]:46344) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1g3hGl-00071S-BN for 28004@debbugs.gnu.org; Sat, 22 Sep 2018 08:44:21 -0400 Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71) (envelope-from ) id 1g3hGb-0005HU-Ud for 28004@debbugs.gnu.org; Sat, 22 Sep 2018 08:44:11 -0400 X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org X-Spam-Level: X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00 autolearn=disabled version=3.3.2 Received: from fencepost.gnu.org ([2001:4830:134:3::e]:55130) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1g3hGb-0005HA-Oc; Sat, 22 Sep 2018 08:44:09 -0400 Received: from [2a01:e0a:1d:7270:af76:b9b:ca24:c465] (port=48590 helo=ribbon) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1g3hGb-0001fE-DO; Sat, 22 Sep 2018 08:44:09 -0400 From: ludo@gnu.org (Ludovic =?utf-8?Q?Court=C3=A8s?=) To: Marius Bakke Subject: Re: Chromium channel References: <87ftyx35pw.fsf@lassieur.org> <87h8jcyy5y.fsf@gnu.org> <87y3cdlkop.fsf@lassieur.org> <87sh2bnj22.fsf@lassieur.org> <87efdsp820.fsf@fastmail.com> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 1 =?utf-8?Q?Vend=C3=A9miaire?= an 227 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Sat, 22 Sep 2018 14:44:07 +0200 In-Reply-To: <87efdsp820.fsf@fastmail.com> (Marius Bakke's message of "Mon, 17 Sep 2018 15:28:23 +0200") Message-ID: <87r2hlwvl4.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Received-From: 2001:4830:134:3::e X-Spam-Score: -5.0 (-----) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org, =?utf-8?Q?Cl=C3=A9ment?= Lassieur X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -6.0 (------) Hello Marius, Marius Bakke skribis: > I've set up a channel for Chromium here: > > https://gitlab.com/mbakke/guix-chromium Nice! Great to see channels put to good use. :-) Though=E2=80=A6 let=E2=80=99s make sure this channel doesn=E2=80=99t derail= =E2=80=9Cus=E2=80=9D from the goal of having an FSDG-compliant Chromium in Guix proper! Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 02 14:20:53 2019 Received: (at 28004) by debbugs.gnu.org; 2 Feb 2019 19:20:53 +0000 Received: from localhost ([127.0.0.1]:56589 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gq0qI-0003F6-Rc for submit@debbugs.gnu.org; Sat, 02 Feb 2019 14:20:53 -0500 Received: from out1-smtp.messagingengine.com ([66.111.4.25]:50571) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gq0qC-0003El-JA for 28004@debbugs.gnu.org; Sat, 02 Feb 2019 14:20:40 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 6BCA021614; Sat, 2 Feb 2019 14:20:31 -0500 (EST) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Sat, 02 Feb 2019 14:20:31 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:date:message-id:mime-version:content-type :content-transfer-encoding; s=fm2; bh=DtHL4j/8io3AleXQ+UYt9XFbw3 un/sc8AuXGHya5Xp4=; b=Sa5/Q57dpoazLYXf9oPLbvhnQk0/efXawBoHJef0Nl UQBP3ndyhsZ1jKN5oTfHcCXrokBsZniuzVMLAxYdkCSHIaf5HqkvpjRaD80VPY/3 VhG6goepWZ3IHdRPb4wnO/3aZVA1JRC/bI/k9MsKjK9CQMDVA+uM7B968XOZmG4+ 6IHLm9Z68cFT9F2+BLER4ad3sivuQkKwFqTbDq2606U+e9ByDmcwJVqMxlQMJ1x7 SW1JPmgg3P8ZuonNU8i/E9c4NQVkOKTDrZYwvKFrWIGJq22uBEUndR71HJXmkzW/ 7+KvkqCZXKkG0T9U8s1MAuxGnS7KbwYmJpdbcqcmYLXA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-transfer-encoding:content-type :date:from:message-id:mime-version:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; bh=DtHL4j /8io3AleXQ+UYt9XFbw3un/sc8AuXGHya5Xp4=; b=hNmfGOAEEAJceOIjcFijZB FzZodo9hw0YkNLA5EucRsY7kFLhU9a/OUTx6uxgt5RgMYyCKAhqJ1ZqlrzZNSCOL xSRQufawPhWdMRGyk6hTEcd45v91KHkkkgZ7U+m7e+L+Qc5RXps3X+bEyXjTGs4Z TZy/PBk6VHDM+GBqa2XrCwNbD3O1NJ7ehol77+kNZdrIrsgJqymaAAuIOEHs/T8t 5iBYtVr1p9tyy1EzV3WLOT5UvjQtUxG2rDg42bWYUBLxGeviLrOHB6rlGWvszR67 bgW4Uxc/79ONMLSAN/JDsQe3wXXkaR/zPAGl5NlMXxA4EY0oiuagKeVnr+sk/tkA == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtledrkedtgdduvdehucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffogggtgfesthekredtredtjeenucfhrhhomhepof grrhhiuhhsuceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheqnecu ffhomhgrihhnpehfrhgvvgguvghskhhtohhprdhorhhgpdgthhhrohhmihhumhdrohhrgh dpghhoohhglhgvshhouhhrtggvrdgtohhmpdhguhhigidqphhrohhfihhlvgdrrhhunhdp ghhithhhuhgsrdgtohhmpdhgohhoghhlvggrphhishdrtghomhdpghhnuhdrohhrghenuc fkphepiedvrdduiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmhgs rghkkhgvsehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 7FE0D1030F; Sat, 2 Feb 2019 14:20:30 -0500 (EST) From: Marius Bakke To: guix-devel@gnu.org Subject: [PATCH] gnu: Add ungoogled-chromium. Date: Sat, 2 Feb 2019 20:20:23 +0100 Message-Id: <20190202192023.22087-1-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.1 MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Thanks to Marks beautiful "computed-origin-method", Ungoogled-Chromium is finally ready for inclusion in Guix. Features: * Chromium 72. * No unsolicited network traffic. * Free software only. * No DRM. * Not an April Fools joke. It's currently using my trivial "fork" of Ungoogled-Chromium[0], which will be upstreamed once the upstream reorganization[1] is done. Comments appreciated! [0]: https://github.com/mbakke/ungoogled-chromium/commit/f9b9074c322a67b04baf0982797cd7b7e09614b5 [1]: https://github.com/Eloston/ungoogled-chromium/issues/651 * gnu/packages/aux-files/chromium/master-preferences.json, gnu/packages/chromium.scm: New files. * gnu/local.mk (GNU_SYSTEM_MODULES): Adjust accordingly. --- gnu/local.mk | 1 + .../chromium/master-preferences.json | 26 + gnu/packages/chromium.scm | 741 ++++++++++++++++++ 3 files changed, 768 insertions(+) create mode 100644 gnu/packages/aux-files/chromium/master-preferences.json create mode 100644 gnu/packages/chromium.scm diff --git a/gnu/local.mk b/gnu/local.mk index 82db1488d6..b5e937cdd7 100644 --- a/gnu/local.mk +++ b/gnu/local.mk @@ -100,6 +100,7 @@ GNU_SYSTEM_MODULES = \ %D%/packages/check.scm \ %D%/packages/chemistry.scm \ %D%/packages/chez.scm \ + %D%/packages/chromium.scm \ %D%/packages/ci.scm \ %D%/packages/cinnamon.scm \ %D%/packages/clojure.scm \ diff --git a/gnu/packages/aux-files/chromium/master-preferences.json b/gnu/packages/aux-files/chromium/master-preferences.json new file mode 100644 index 0000000000..0caa7cc4cd --- /dev/null +++ b/gnu/packages/aux-files/chromium/master-preferences.json @@ -0,0 +1,26 @@ +{ + "distribution": { + "import_bookmarks": false, + "make_chrome_default": false, + "make_chrome_default_for_user": false, + "verbose_logging": true, + "skip_first_run_ui": true, + "suppress_first_run_default_browser_prompt": true + }, + "browser": { + "has_seen_welcome_page" : true, + "check_default_browser" : false + }, + "dns_prefetching": { + "enabled": false + }, + "alternate_error_pages": { + "enabled": false + }, + "hardware": { + "audio_capture_enabled": false + }, + "default_apps": "noinstall", + "hide_web_store_icon": true, + "homepage": "https://www.gnu.org/software/guix" +} diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm new file mode 100644 index 0000000000..eb404246d3 --- /dev/null +++ b/gnu/packages/chromium.scm @@ -0,0 +1,741 @@ +;;; GNU Guix --- Functional package management for GNU +;;; Copyright © 2019 Marius Bakke +;;; +;;; GNU Guix is free software; you can redistribute it and/or modify it +;;; under the terms of the GNU General Public License as published by +;;; the Free Software Foundation; either version 3 of the License, or (at +;;; your option) any later version. +;;; +;;; GNU Guix is distributed in the hope that it will be useful, but +;;; WITHOUT ANY WARRANTY; without even the implied warranty of +;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +;;; GNU General Public License for more details. +;;; +;;; You should have received a copy of the GNU General Public License +;;; along with GNU Guix. If not, see . + +(define-module (gnu packages chromium) + #:use-module ((guix licenses) #:prefix license:) + #:use-module (guix packages) + #:use-module (guix gexp) + #:use-module (guix store) + #:use-module (guix monads) + #:use-module (guix download) + #:use-module (guix git-download) + #:use-module (guix utils) + #:use-module (guix build-system gnu) + #:use-module (gnu packages) + #:use-module (gnu packages assembly) + #:use-module (gnu packages base) + #:use-module (gnu packages bison) + #:use-module (gnu packages build-tools) + #:use-module (gnu packages compression) + #:use-module (gnu packages cups) + #:use-module (gnu packages curl) + #:use-module (gnu packages fontutils) + #:use-module (gnu packages gcc) + #:use-module (gnu packages ghostscript) + #:use-module (gnu packages gl) + #:use-module (gnu packages glib) + #:use-module (gnu packages gnome) + #:use-module (gnu packages gnuzilla) + #:use-module (gnu packages gperf) + #:use-module (gnu packages gtk) + #:use-module (gnu packages icu4c) + #:use-module (gnu packages image) + #:use-module (gnu packages libevent) + #:use-module (gnu packages libffi) + #:use-module (gnu packages linux) + #:use-module (gnu packages kerberos) + #:use-module (gnu packages ninja) + #:use-module (gnu packages node) + #:use-module (gnu packages pciutils) + #:use-module (gnu packages pkg-config) + #:use-module (gnu packages pulseaudio) + #:use-module (gnu packages python) + #:use-module (gnu packages python-web) + #:use-module (gnu packages python-xyz) + #:use-module (gnu packages regex) + #:use-module (gnu packages serialization) + #:use-module (gnu packages speech) + #:use-module (gnu packages tls) + #:use-module (gnu packages valgrind) + #:use-module (gnu packages vulkan) + #:use-module (gnu packages video) + #:use-module (gnu packages xiph) + #:use-module (gnu packages xml) + #:use-module (gnu packages xdisorg) + #:use-module (gnu packages xorg)) + +(define %preserved-third-party-files + '("base/third_party/dmg_fp" ;X11-style + "base/third_party/dynamic_annotations" ;BSD-2 + "base/third_party/icu" ;Unicode, X11-style + "base/third_party/superfasthash" ;BSD-3 + "base/third_party/symbolize" ;BSD-3 + "base/third_party/xdg_mime" ;LGPL2.1+ or Academic 2.0 + "base/third_party/xdg_user_dirs" ;Expat + "chrome/third_party/mozilla_security_manager" ;MPL-1.1/GPL2+/LGPL2.1+ + "courgette/third_party/bsdiff" ;BSD-2, BSD protection license + "courgette/third_party/divsufsort" ;Expat + "net/third_party/http2" ;BSD-3 + "net/third_party/mozilla_security_manager" ;MPL-1.1/GPL2+/LGPL2.1+ + "net/third_party/nss" ;MPL-2.0 + "net/third_party/quic" ;BSD-3 + "net/third_party/spdy" ;BSD-3 + "net/third_party/uri_template" ;ASL2.0 + "third_party/abseil-cpp" ;ASL2.0 + "third_party/adobe/flash/flapper_version.h" ;no license, trivial + "third_party/angle" ;BSD-3 + "third_party/angle/src/common/third_party/base" ;BSD-3 + "third_party/angle/src/common/third_party/smhasher" ;Public domain + "third_party/angle/src/common/third_party/xxhash" ;BSD-2 + "third_party/angle/src/third_party/compiler" ;BSD-2 + "third_party/angle/src/third_party/libXNVCtrl" ;Expat + "third_party/angle/src/third_party/trace_event" ;BSD-3 + "third_party/angle/third_party/glslang" ;BSD-3 + "third_party/angle/third_party/spirv-headers" ;Expat + "third_party/angle/third_party/spirv-tools" ;Expat + "third_party/angle/third_party/vulkan-headers" ;ASL2.0 + "third_party/angle/third_party/vulkan-loader" ;ASL2.0 + "third_party/angle/third_party/vulkan-tools" ;ASL2.0 + "third_party/angle/third_party/vulkan-validation-layers" ;ASL2.0 + "third_party/apple_apsl" ;APSL2.0 + "third_party/blink" ;BSD-3 + "third_party/boringssl" ;OpenSSL/ISC (Google additions are ISC) + "third_party/boringssl/src/third_party/fiat" ;Expat + "third_party/breakpad" ;BSD-3 + "third_party/brotli" ;Expat + "third_party/cacheinvalidation" ;ASL2.0 + "third_party/catapult" ;BSD-3 + "third_party/catapult/common/py_vulcanize/third_party/rcssmin" ;ASL2.0 + "third_party/catapult/common/py_vulcanize/third_party/rjsmin" ;ASL2.0 + "third_party/catapult/third_party/polymer" ;BSD-3 + "third_party/catapult/tracing/third_party/d3" ;BSD-3 + "third_party/catapult/tracing/third_party/gl-matrix" ;Expat + "third_party/catapult/tracing/third_party/jszip" ;Expat or GPL3 + "third_party/catapult/tracing/third_party/mannwhitneyu" ;Expat + "third_party/catapult/tracing/third_party/oboe" ;BSD-2 + "third_party/catapult/tracing/third_party/pako" ;Expat + "third_party/ced" ;BSD-3 + "third_party/cld_3" ;ASL2.0 + "third_party/closure_compiler" ;ASL2.0 + "third_party/crashpad" ;ASL2.0 + "third_party/crashpad/crashpad/third_party/zlib/zlib_crashpad.h" ;Zlib + "third_party/crc32c" ;BSD-3 + "third_party/cros_system_api" ;BSD-3 + "third_party/dom_distiller_js" ;BSD-3 + "third_party/fips181" ;BSD-3 + "third_party/flatbuffers" ;ASL2.0 + "third_party/google_input_tools" ;ASL2.0 + "third_party/google_input_tools/third_party/closure_library" ;ASL2.0 + "third_party/google_input_tools/third_party/closure_library/third_party/closure" ;Expat + "third_party/googletest" ;BSD-3 + "third_party/hunspell" ;MPL1.1/GPL2+/LGPL2.1+ + "third_party/iccjpeg" ;IJG + "third_party/inspector_protocol" ;BSD-3 + "third_party/jinja2" ;BSD-3 + "third_party/jstemplate" ;ASL2.0 + "third_party/khronos" ;Expat, SGI + "third_party/leveldatabase" ;BSD-3 + "third_party/libXNVCtrl" ;Expat + "third_party/libaddressinput" ;ASL2.0 + "third_party/libaom" ;BSD-2 or "Alliance for Open Media Patent License 1.0" + "third_party/libaom/source/libaom/third_party/vector" ;Expat + "third_party/libaom/source/libaom/third_party/x86inc" ;ISC + "third_party/libjingle_xmpp" ;BSD-3 + "third_party/libphonenumber" ;ASL2.0 + "third_party/libsecret" ;LGPL2.1+ + "third_party/libsrtp" ;BSD-3 + "third_party/libsync" ;ASL2.0 + "third_party/libudev" ;LGPL2.1+ + "third_party/libwebm" ;BSD-3 + "third_party/libxml/chromium" ;BSD-3 + "third_party/libyuv" ;BSD-3 + "third_party/lss" ;BSD-3 + "third_party/markupsafe" ;BSD-3 + "third_party/mesa_headers" ;Expat, SGI + "third_party/metrics_proto" ;BSD-3 + "third_party/modp_b64" ;BSD-3 + "third_party/nasm" ;BSD-2 + "third_party/node" ;Expat + "third_party/node/node_modules/polymer-bundler/lib/third_party/UglifyJS2" ;BSD-2 + "third_party/ots" ;BSD-3 + "third_party/pdfium" ;BSD-3 + "third_party/pdfium/third_party/agg23" ;Expat + "third_party/pdfium/third_party/base" ;BSD-3 + "third_party/pdfium/third_party/bigint" ;Public domain, BSD-3 + "third_party/pdfium/third_party/skia_shared" ;BSD-3 + "third_party/pdfium/third_party/freetype/include/pstables.h" ;FreeType + "third_party/ply" ;BSD-3 + "third_party/polymer" ;BSD-3 + "third_party/protobuf" ;BSD-3 + "third_party/protobuf/third_party/six" ;Expat + "third_party/pyjson5" ;ASL2.0 + "third_party/qcms" ;Expat + "third_party/rnnoise" ;BSD-3 + "third_party/s2cellid" ;ASL2.0 + "third_party/sfntly" ;ASL2.0 + "third_party/skia" ;BSD-3 + "third_party/skia/third_party/gif" ;MPL1.1/GPL2+/LGPL2.1+ + "third_party/skia/third_party/skcms" ;BSD-3 + "third_party/skia/third_party/vulkan" ;BSD-3 + "third_party/smhasher" ;Expat, public domain + "third_party/speech-dispatcher" ;GPL2+ + "third_party/spirv-headers" ;ASL2.0 + "third_party/SPIRV-Tools" ;ASL2.0 + "third_party/sqlite" ;Public domain + "third_party/ungoogled" ;BSD-3 + "third_party/usb_ids" ;BSD-3 + "third_party/usrsctp" ;BSD-2 + "third_party/web-animations-js" ;ASL2.0 + "third_party/webdriver" ;ASL2.0 + "third_party/webrtc" ;BSD-3 + "third_party/webrtc/common_audio/third_party/fft4g" ;Non-copyleft + "third_party/webrtc/common_audio/third_party/spl_sqrt_floor" ;Public domain + "third_party/webrtc/modules/third_party/fft" ;Non-copyleft + "third_party/webrtc/modules/third_party/g711" ;Public domain + "third_party/webrtc/modules/third_party/g722" ;Public domain + "third_party/webrtc/rtc_base/third_party/base64" ;Non-copyleft + "third_party/webrtc/rtc_base/third_party/sigslot" ;Public domain + "third_party/widevine/cdm/widevine_cdm_version.h" ;BSD-3 + "third_party/widevine/cdm/widevine_cdm_common.h" ;BSD-3 + "third_party/woff2" ;ASL2.0 + "third_party/xdg-utils" ;Expat + "third_party/yasm/run_yasm.py" ;BSD-2 or BSD-3 + "third_party/zlib/google" ;BSD-3 + "url/third_party/mozilla" ;BSD-3, MPL1.1/GPL2+/LGPL2.1+ + "v8/src/third_party/utf8-decoder" ;Expat + "v8/src/third_party/valgrind" ;BSD-4 + "v8/third_party/inspector_protocol" ;BSD-3 + "v8/third_party/v8/builtins")) ;PSFL + +(define* (computed-origin-method gexp-promise hash-algo hash + #:optional (name "source") + #:key (system (%current-system)) + (guile (default-guile))) + "Return a derivation that executes the G-expression that results +from forcing GEXP-PROMISE." + (mlet %store-monad ((guile (package->derivation guile system))) + (gexp->derivation (or name "computed-origin") + (force gexp-promise) + #:system system + #:guile-for-build guile))) + +(define %chromium-version "72.0.3626.81") +(define %ungoogled-revision "f9b9074c322a67b04baf0982797cd7b7e09614b5") + +;; This is a computed origin that does the following: +;; 1) Runs the Ungoogled scripts on a pristine Chromium tarball. +;; 2) Prunes all third_party folders that are not explicitly preserved. +;; 3) Adjusts "GN" build files such that system libraries are preferred. +(define ungoogled-chromium-source + (let* ((chromium-source + (origin + (method url-fetch) + (uri (string-append "https://commondatastorage.googleapis.com" + "/chromium-browser-official/chromium-" + %chromium-version ".tar.xz")) + (sha256 + (base32 + "01l0vlvcckpag376mjld7qprv63l0z8li689k0h6v3h0i7irzs6z")))) + (ungoogled-source + (origin + (method git-fetch) + (uri (git-reference (url "https://github.com/mbakke/ungoogled-chromium") + (commit %ungoogled-revision))) + (file-name (git-file-name "ungoogled-chromium" + (string-take %ungoogled-revision 7))) + (sha256 + (base32 + "0gmk1n3i7lbm7rw8zl4df171yhvrlimj8ksj096bf2dlfhbd44rb"))))) + + (origin + (method computed-origin-method) + (file-name (string-append "ungoogled-chromium-" %chromium-version ".tar.xz")) + (sha256 #f) + (uri + (delay + (with-imported-modules '((guix build utils)) + #~(begin + (use-modules (guix build utils)) + (let ((chromium-dir (string-append "chromium-" #$%chromium-version)) + (preserved-files (list #$@%preserved-third-party-files))) + + (mkdir "/tmp/bin") + (set-path-environment-variable + "PATH" '("bin") + (list "/tmp" + #+(canonical-package patch) + #+(canonical-package xz) + #+(canonical-package tar) + #+python-2 + #+python)) + + (copy-recursively #+ungoogled-source "/tmp/ungoogled") + + (with-directory-excursion "/tmp/ungoogled" + + (format #t "Unpacking chromium tarball...~%") + (force-output) + (invoke "tar" "xf" #+chromium-source) + + (format #t "Ungooglifying...~%") + (force-output) + (invoke "python3" "run_buildkit_cli.py" "prune" + "-b" "config_bundles/guix" chromium-dir) + (invoke "python3" "run_buildkit_cli.py" "patches" "apply" + "-b" "config_bundles/guix" chromium-dir) + (invoke "python3" "run_buildkit_cli.py" "domains" "apply" + "-b" "config_bundles/linux_rooted" + "-c" "/tmp/domainscache.tar.gz" chromium-dir) + + (with-directory-excursion chromium-dir + (format #t "Pruning third party files...~%") + (force-output) + (apply invoke "python" + "build/linux/unbundle/remove_bundled_libraries.py" + "--do-remove" preserved-files) + + (format #t "Replacing GN files...~%") + (force-output) + (invoke "python3" "build/linux/unbundle/replace_gn_files.py" + "--system-libraries" "ffmpeg" "flac" "fontconfig" + "freetype" "harfbuzz-ng" "icu" "libdrm" "libevent" + "libjpeg" "libpng" "libvpx" "libwebp" "libxml" + "libxslt" "openh264" "opus" "re2" "snappy" "yasm" + "zlib")) + + (format #t (string-append "Packing new Ungoogled tarball ...~%")) + (force-output) + (invoke "tar" "cvfa" #$output + ;; Avoid non-determinism in the archive. + "--mtime=@0" + "--owner=root:0" + "--group=root:0" + "--sort=name" + chromium-dir) + + #t))))))))) + +(define opus+custom + (package/inherit opus + (name "opus+custom") + (arguments + (substitute-keyword-arguments (package-arguments opus) + ((#:configure-flags flags ''()) + ;; Opus Custom is an optional extension of the Opus + ;; specification that allows for unsupported frame + ;; sizes. Chromium requires that this is enabled. + `(cons "--enable-custom-modes" + ,flags)))))) + +(define libvpx/chromium + ;; Chromium 66 and later requires an unreleased libvpx, so we take the + ;; commit from "third_party/libvpx/README.chromium" in the tarball. + (let ((version (package-version libvpx)) + (commit "e188b5435de71bcd602c378f1ac0441111f0f915") + (revision "0")) + (package/inherit libvpx + (name "libvpx-chromium") + (version (git-version version revision commit)) + (source (origin + (method git-fetch) + (uri (git-reference + (url "https://chromium.googlesource.com/webm/libvpx") + (commit commit))) + (file-name (git-file-name name version)) + (sha256 + (base32 + "0v7lzvgy45zh7zwzmmzkvbcqmhs4xa97z0h97hd3j6myrxcfz1n9"))))))) + +;; Transitional package until HarfBuzz 2.2 is available in Guix master branch. +(define harfbuzz/chromium + (package/inherit harfbuzz + (version "2.2.0") + (source (origin + (inherit (package-source harfbuzz)) + (uri (string-append "https://www.freedesktop.org/software/harfbuzz" + "/release/harfbuzz-" version ".tar.bz2")) + (sha256 + (base32 + "047q63jr513azf3g1y7f5xn60b4jdjs9zsmrx04sfw5rasyzrk5p")))))) + +(define-public ungoogled-chromium + (package + (name "ungoogled-chromium") + (version %chromium-version) + (synopsis "Graphical web browser") + (source ungoogled-chromium-source) + (build-system gnu-build-system) + (arguments + `(#:tests? #f + ;; FIXME: There is a "gn" option specifically for setting -rpath, but + ;; it overrides the RUNPATH set by the linker. + #:validate-runpath? #f + #:modules ((guix build gnu-build-system) + (guix build utils) + (ice-9 ftw) + (ice-9 regex) + (srfi srfi-26)) + #:configure-flags + ;; See tools/gn/docs/cookbook.md and + ;; https://www.chromium.org/developers/gn-build-configuration + ;; for usage. Run "./gn args . --list" in the Release + ;; directory for an exhaustive list of supported flags. + ;; (Note: The 'configure' phase will do that for you.) + (list "is_debug=false" + "use_gold=false" + "use_lld=false" + "linux_use_bundled_binutils=false" + "use_custom_libcxx=false" + "use_sysroot=false" + "enable_precompiled_headers=false" + "goma_dir=\"\"" + "enable_nacl=false" + "enable_nacl_nonsfi=false" + "use_allocator=\"none\"" ;don't use tcmalloc + "use_unofficial_version_number=false" + + ;; Define a custom toolchain that simply looks up CC, AR and + ;; friends from the environment. + "custom_toolchain=\"//build/toolchain/linux/unbundle:default\"" + "host_toolchain=\"//build/toolchain/linux/unbundle:default\"" + + ;; Don't assume it's clang. + "is_clang=false" + + ;; Optimize for building everything at once, as opposed to + ;; incrementally for development. See "docs/jumbo.md". + "use_jumbo_build=true" + + ;; Disable type-checking for the Web UI to avoid a Java dependency. + "closure_compile=false" + + ;; Disable debugging features to save space. + "blink_symbol_level=0" + "enable_iterator_debugging=false" + + ;; Some of the unbundled libraries throws deprecation + ;; warnings, etc. Ignore it. + "treat_warnings_as_errors=false" + + ;; Don't add any API keys. End users can set them in the + ;; environment if desired. See + ;; . + "use_official_google_api_keys=false" + + ;; Disable "safe browsing", which pulls in a dependency on + ;; the nonfree "unrar" program (as of m66). + "safe_browsing_mode=0" + + ;; Disable "field trials". + "fieldtrial_testing_like_official_build=true" + + ;; Ungoogled components. + "enable_mdns=false" + "enable_one_click_signin=false" + "enable_reading_list=false" + "enable_remoting=false" + "enable_reporting=false" + "enable_service_discovery=false" + "enable_swiftshader=false" + "use_vaapi=true" + + ;; Use system libraries where possible. + "use_system_freetype=true" + "use_system_harfbuzz=true" + "use_system_lcms2=true" + "use_system_libdrm=true" + "use_system_libjpeg=true" + "use_system_libpng=true" + ;;"use_system_libsync=true" + "use_system_zlib=true" + + "use_gnome_keyring=false" ;deprecated by libsecret + "use_openh264=true" + "use_pulseaudio=true" + "link_pulseaudio=true" + + ;; Don't arbitrarily restrict formats supported by system ffmpeg. + "proprietary_codecs=true" + "ffmpeg_branding=\"Chrome\"" + + ;; WebRTC stuff. + "rtc_use_h264=true" + ;; Don't use bundled sources. + "rtc_build_json=false" + "rtc_build_libevent=false" + "rtc_build_libvpx=false" + "rtc_build_opus=false" + "rtc_build_ssl=false" + + "rtc_build_libsrtp=true" ;FIXME: fails to find headers + "rtc_build_usrsctp=true" ;TODO: package this + (string-append "rtc_jsoncpp_root=\"" + (assoc-ref %build-inputs "jsoncpp") + "/include/jsoncpp/json\"") + (string-append "rtc_ssl_root=\"" + (assoc-ref %build-inputs "openssl") + "/include/openssl\"")) + #:phases + (modify-phases %standard-phases + (add-after 'unpack 'patch-stuff + (lambda* (#:key inputs #:allow-other-keys) + (substitute* "printing/cups_config_helper.py" + (("cups_config =.*") + (string-append "cups_config = '" (assoc-ref inputs "cups") + "/bin/cups-config'\n"))) + + (substitute* + '("base/process/launch_posix.cc" + "base/third_party/dynamic_annotations/dynamic_annotations.c" + "sandbox/linux/seccomp-bpf/sandbox_bpf.cc" + "sandbox/linux/services/credentials.cc" + "sandbox/linux/services/namespace_utils.cc" + "sandbox/linux/services/syscall_wrappers.cc" + "sandbox/linux/syscall_broker/broker_host.cc") + (("include \"base/third_party/valgrind/") "include \"valgrind/")) + + (for-each (lambda (file) + (substitute* file + ;; Fix opus include path. + ;; Do not substitute opus_private.h. + (("#include \"opus\\.h\"") + "#include \"opus/opus.h\"") + (("#include \"opus_custom\\.h\"") + "#include \"opus/opus_custom.h\"") + (("#include \"opus_defines\\.h\"") + "#include \"opus/opus_defines.h\"") + (("#include \"opus_multistream\\.h\"") + "#include \"opus/opus_multistream.h\"") + (("#include \"opus_types\\.h\"") + "#include \"opus/opus_types.h\""))) + (find-files (string-append "third_party/webrtc/modules" + "/audio_coding/codecs/opus"))) + + (substitute* "chrome/common/chrome_paths.cc" + (("/usr/share/chromium/extensions") + ;; TODO: Add ~/.guix-profile. + "/run/current-system/profile/share/chromium/extensions")) + + ;; XXX: Should be unnecessary when use_system_lcms2=true. + (substitute* "third_party/pdfium/core/fxcodec/codec/ccodec_iccmodule.h" + (("include \"third_party/lcms/include/lcms2\\.h\"") + "include \"lcms2.h\"")) + + (substitute* + "third_party/breakpad/breakpad/src/common/linux/libcurl_wrapper.h" + (("include \"third_party/curl") "include \"curl")) + + (substitute* "third_party/webrtc/rtc_base/strings/json.h" + (("#include \"third_party/jsoncpp/") "#include \"json/")) + + (substitute* "media/base/decode_capabilities.cc" + (("third_party/libvpx/source/libvpx/") "")) + + (substitute* "ui/gfx/skia_util.h" + (("third_party/vulkan/include/") "")) + + ;; Building chromedriver embeds some files using the ZIP + ;; format which doesn't support timestamps before + ;; 1980. Therefore, advance the timestamps of the files + ;; which are included so that building chromedriver + ;; works. + (let ((circa-1980 (* 10 366 24 60 60))) + (for-each (lambda (file) + (utime file circa-1980 circa-1980)) + '("chrome/test/chromedriver/extension/background.js" + "chrome/test/chromedriver/extension/manifest.json"))) + + #t)) + (add-before 'configure 'prepare-build-environment + (lambda* (#:key inputs #:allow-other-keys) + + ;; Make sure the right build tools are used. + (setenv "AR" "ar") (setenv "NM" "nm") + (setenv "CC" "gcc") (setenv "CXX" "g++") + + ;; Work around . + (unsetenv "C_INCLUDE_PATH") + (unsetenv "CPLUS_INCLUDE_PATH") + + ;; TODO: pre-compile instead. Avoids a race condition. + (setenv "PYTHONDONTWRITEBYTECODE" "1") + + ;; XXX: How portable is this. + (mkdir-p "third_party/node/linux/node-linux-x64") + (symlink (string-append (assoc-ref inputs "node") "/bin") + "third_party/node/linux/node-linux-x64/bin") + + #t)) + (replace 'configure + (lambda* (#:key configure-flags #:allow-other-keys) + (let ((args (string-join configure-flags " "))) + ;; Generate ninja build files. + (invoke "gn" "gen" "out/Release" + (string-append "--args=" args)) + + ;; Print the full list of supported arguments as well as + ;; their current status for convenience. + (format #t "Dumping configure flags...\n") + (invoke "gn" "args" "out/Release" "--list")))) + (replace 'build + (lambda* (#:key outputs #:allow-other-keys) + (invoke "ninja" "-C" "out/Release" + "-j" (number->string (parallel-job-count)) + "chrome" + "chromedriver"))) + (replace 'install + (lambda* (#:key inputs outputs #:allow-other-keys) + (let* ((out (assoc-ref outputs "out")) + (bin (string-append out "/bin")) + (exe (string-append bin "/chromium")) + (lib (string-append out "/lib")) + (man (string-append out "/share/man/man1")) + (applications (string-append out "/share/applications")) + (install-regexp (make-regexp "\\.(bin|pak)$")) + (locales (string-append lib "/locales")) + (resources (string-append lib "/resources")) + (preferences (assoc-ref inputs "master-preferences")) + (gtk+ (assoc-ref inputs "gtk+")) + (mesa (assoc-ref inputs "mesa")) + (nss (assoc-ref inputs "nss")) + (udev (assoc-ref inputs "udev")) + (sh (which "sh"))) + + (substitute* '("chrome/app/resources/manpage.1.in" + "chrome/installer/linux/common/desktop.template") + (("@@MENUNAME@@") "Chromium") + (("@@PACKAGE@@") "chromium") + (("/usr/bin/@@USR_BIN_SYMLINK_NAME@@") exe)) + + (mkdir-p man) + (copy-file "chrome/app/resources/manpage.1.in" + (string-append man "/chromium.1")) + + (mkdir-p applications) + (copy-file "chrome/installer/linux/common/desktop.template" + (string-append applications "/chromium.desktop")) + + (mkdir-p lib) + (copy-file preferences (string-append lib "/master_preferences")) + + (with-directory-excursion "out/Release" + (for-each (lambda (file) + (install-file file lib)) + (scandir "." (cut regexp-exec install-regexp <>))) + (copy-file "chrome" (string-append lib "/chromium")) + + ;; TODO: Install icons from "../../chrome/app/themes" into + ;; "out/share/icons/hicolor/$size". + (install-file + "product_logo_48.png" + (string-append out "/share/icons/48x48/chromium.png")) + + (copy-recursively "locales" locales) + (copy-recursively "resources" resources) + + (mkdir-p bin) + (symlink "../lib/chromium" exe) + (install-file "chromedriver" bin) + + (wrap-program exe + ;; TODO: Get these in RUNPATH. + `("LD_LIBRARY_PATH" ":" prefix + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib:" + mesa "/lib:" udev "/lib"))) + ;; Avoid file manager crash. See . + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/share")))) + #t))))))) + (native-inputs + `(("bison" ,bison) + ("gcc" ,gcc-8) + ("gn" ,gn) + ("gperf" ,gperf) + ("ninja" ,ninja) + ("node" ,node) + ("pkg-config" ,pkg-config) + ("which" ,which) + ("yasm" ,yasm) + + ;; This file contains defaults for new user profiles. + ("master-preferences" ,(local-file "aux-files/chromium/master-preferences.json")) + + ("python-beautifulsoup4" ,python2-beautifulsoup4) + ("python-html5lib" ,python2-html5lib) + ("python" ,python-2))) + (inputs + `(("alsa-lib" ,alsa-lib) + ("atk" ,atk) + ("cups" ,cups) + ("curl" ,curl) + ("dbus" ,dbus) + ("dbus-glib" ,dbus-glib) + ("expat" ,expat) + ("flac" ,flac) + ("ffmpeg" ,ffmpeg) + ("fontconfig" ,fontconfig) + ("freetype" ,freetype) + ("gdk-pixbuf" ,gdk-pixbuf) + ("glib" ,glib) + ("gtk+" ,gtk+) + ("harfbuzz" ,harfbuzz/chromium) + ("icu4c" ,icu4c) + ("jsoncpp" ,jsoncpp) + ("lcms" ,lcms) + ("libevent" ,libevent) + ("libffi" ,libffi) + ("libjpeg-turbo" ,libjpeg-turbo) + ("libpng" ,libpng) + ("libva" ,libva) + ("libvpx" ,libvpx/chromium) + ("libwebp" ,libwebp) + ("libx11" ,libx11) + ("libxcb" ,libxcb) + ("libxcomposite" ,libxcomposite) + ("libxcursor" ,libxcursor) + ("libxdamage" ,libxdamage) + ("libxext" ,libxext) + ("libxfixes" ,libxfixes) + ("libxi" ,libxi) + ("libxml2" ,libxml2) + ("libxrandr" ,libxrandr) + ("libxrender" ,libxrender) + ("libxscrnsaver" ,libxscrnsaver) + ("libxslt" ,libxslt) + ("libxtst" ,libxtst) + ("mesa" ,mesa) + ("minizip" ,minizip) + ("mit-krb5" ,mit-krb5) + ("nss" ,nss) + ("openh264" ,openh264) + ("openjpeg" ,openjpeg) ;PDFium only + ("openssl" ,openssl) + ("opus" ,opus+custom) + ("pango" ,pango) + ("pciutils" ,pciutils) + ("pulseaudio" ,pulseaudio) + ("re2" ,re2) + ("snappy" ,snappy) + ("speech-dispatcher" ,speech-dispatcher) + ("udev" ,eudev) + ("valgrind" ,valgrind) + ("vulkan-headers" ,vulkan-headers))) + (home-page "https://www.chromium.org/") + (description + "Ungoogled-Chromium is the Chromium web browser, sans integration with +Google web services.") + ;; Chromium is developed as BSD-3, but bundles a large number of third-party + ;; components with other licenses. For full information, see chrome://credits. + (license (list license:bsd-3 + license:bsd-2 + license:expat + license:asl2.0 + license:mpl1.1 + license:mpl2.0 + license:public-domain + license:isc + (license:non-copyleft "chrome://credits" + "See chrome://credits for more information.") + license:lgpl2.1+)))) -- 2.20.1 From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 03 15:21:13 2019 Received: (at 28004) by debbugs.gnu.org; 3 Feb 2019 20:21:13 +0000 Received: from localhost ([127.0.0.1]:57779 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqOGP-0003RS-IZ for submit@debbugs.gnu.org; Sun, 03 Feb 2019 15:21:13 -0500 Received: from eggs.gnu.org ([209.51.188.92]:37268) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqOGN-0003RE-GK for 28004@debbugs.gnu.org; Sun, 03 Feb 2019 15:21:12 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]:46308) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1gqOGH-0002LM-Fo; Sun, 03 Feb 2019 15:21:05 -0500 Received: from [2607:fea8:3b80:184::9] (port=53202 helo=localhost) by fencepost.gnu.org with esmtpsa (TLS1.2:RSA_AES_256_CBC_SHA1:256) (Exim 4.82) (envelope-from ) id 1gqOGH-00068d-5J; Sun, 03 Feb 2019 15:21:05 -0500 From: Amin Bandali To: Marius Bakke Subject: Re: [PATCH] gnu: Add ungoogled-chromium. References: <20190202192023.22087-1-mbakke@fastmail.com> Date: Sun, 03 Feb 2019 15:21:08 -0500 In-Reply-To: <20190202192023.22087-1-mbakke@fastmail.com> (Marius Bakke's message of "Sat, 2 Feb 2019 20:20:23 +0100") Message-ID: <878sywsjwr.fsf@aminb.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org, bill-auger X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Hello Marius, Thanks for your work patching and packaging ungoogled-chromium! I haven=E2=80=99t had a chance to have a closer look at your patch, but wou= ld you mind elaborating on the =E2=80=9C* Free software only.=E2=80=9D part of= your stated feature-set and if/how it addresses licensing concerns raised previously e.g. by bill-auger here[1] with respect to the FSDG status of Chromium, as well as maintaining solidarity with other FSDG-complying distros? [1]: https://lists.gnu.org/r/guix-devel/2018-09/msg00264.html Best, amin From debbugs-submit-bounces@debbugs.gnu.org Sun Feb 03 23:52:46 2019 Received: (at 28004) by debbugs.gnu.org; 4 Feb 2019 04:52:46 +0000 Received: from localhost ([127.0.0.1]:57961 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqWFS-0003Ld-Aa for submit@debbugs.gnu.org; Sun, 03 Feb 2019 23:52:46 -0500 Received: from indri.birch.relay.mailchannels.net ([23.83.209.92]:64925) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqWFP-0003LT-T5 for 28004@debbugs.gnu.org; Sun, 03 Feb 2019 23:52:45 -0500 X-Sender-Id: dreamhost|x-authsender|bill-auger@peers.community Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id 46C8E1230A5; Mon, 4 Feb 2019 04:52:41 +0000 (UTC) Received: from pdx1-sub0-mail-a49.g.dreamhost.com (unknown [100.96.11.179]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id CA24312425D; Mon, 4 Feb 2019 04:52:40 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|bill-auger@peers.community Received: from pdx1-sub0-mail-a49.g.dreamhost.com (pop.dreamhost.com [64.90.62.162]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384) by 0.0.0.0:2500 (trex/5.16.2); Mon, 04 Feb 2019 04:52:41 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|bill-auger@peers.community X-MailChannels-Auth-Id: dreamhost X-Trouble-Whispering: 08697c75406460d4_1549255961094_3960206215 X-MC-Loop-Signature: 1549255961094:257071308 X-MC-Ingress-Time: 1549255961093 Received: from pdx1-sub0-mail-a49.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a49.g.dreamhost.com (Postfix) with ESMTP id 4D5CA8218D; Sun, 3 Feb 2019 20:52:40 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=peers.community; h=date :from:to:cc:subject:message-id:in-reply-to:references :mime-version:content-type:content-transfer-encoding; s= peers.community; bh=zPkORRV0F+MzEblMefS6mtQ4F/A=; b=ZZOlcBGS1eWP DB5yyXEWDzQe+wj6eUg4hc/RuaXM1/mrTfwdHPPF3qLqaUwhjx5nTWEXDkMosx1z fsxfw8b5gE8J40uTfcXISBHnRJUMT4583qjAUw0rYfPK0jQF8RzchjeR0uPGFtqK XQRbi92zOyk7ai5ZmVW/fV3Plghmvuo= Received: from parabola (75-138-186-142.dhcp.oxfr.ma.charter.com [75.138.186.142]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: bill-auger@peers.community) by pdx1-sub0-mail-a49.g.dreamhost.com (Postfix) with ESMTPSA id 3BBC082175; Sun, 3 Feb 2019 20:52:38 -0800 (PST) Date: Sun, 3 Feb 2019 23:52:04 -0500 X-DH-BACKEND: pdx1-sub0-mail-a49 From: bill-auger To: guix-devel@gnu.org Subject: Re: [PATCH] gnu: Add ungoogled-chromium. Message-ID: <20190203235204.63970587@parabola> In-Reply-To: <87k1igpwk8.fsf@dismail.de> References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> X-Mailer: Claws Mail 3.17.3 (GTK+ 2.24.32; x86_64-pc-linux-gnu) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-VR-OUT-STATUS: OK X-VR-OUT-SCORE: 0 X-VR-OUT-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedtledrkeefgdejhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucggtfgfnhhsuhgsshgtrhhisggvpdfftffgtefojffquffvnecuuegrihhlohhuthemuceftddtnecunecujfgurhepfffhvffukfgjfhfogggtgfesthejfedtredtvdenucfhrhhomhepsghilhhlqdgruhhgvghruceosghilhhlqdgruhhgvghrsehpvggvrhhsrdgtohhmmhhunhhithihqeenucffohhmrghinheplhhisghrvghplhgrnhgvthdrohhrghdpghhnuhdrohhrghdpnhhonhhgnhhurdhorhhgnecukfhppeejhedrudefkedrudekiedrudegvdenucfrrghrrghmpehmohguvgepshhmthhppdhhvghlohepphgrrhgrsgholhgrpdhinhgvthepjeehrddufeekrddukeeirddugedvpdhrvghtuhhrnhdqphgrthhhpegsihhllhdqrghughgvrhcuoegsihhllhdqrghughgvrhesphgvvghrshdrtghomhhmuhhnihhthieqpdhmrghilhhfrhhomhepsghilhhlqdgruhhgvghrsehpvggvrhhsrdgtohhmmhhunhhithihpdhnrhgtphhtthhopehgnhhuqdhlihhnuhigqdhlihgsrhgvsehnohhnghhnuhdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org, gnu-linux-libre@nongnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) re: https://lists.gnu.org/archive/html/guix-devel/2019-02/msg00009.html i would like to remind readers of the guix-devel list that it was discussed some months ago, why no FSDG distros currently distribute chromium[1] - it appeared at that time, that most people in that discussion were in agreement that chromium should not be included in guix; and marius was instead hosting it in a private repo, as not to taint the main guix repos with dubious software - has there been a notable break-through since then? what is the evidence for this claim that this guix package is "free software only"? - what does "Marks beautiful computed-origin-method" do toward that end? - if a procedure for liberating any chromium-derived software has been discovered, this would be a marvelous accomplishment and very good news indeed, of which people outside of the guix dev team would also be interested to learn if the guix team has discovered some new information or has concocted a viable liberation recipe for chromium or any of it's offspring, then i hope that, for the benefit of all fellow Fosstopians, someone would present that information to the FSDG mailing list for review and discussion - it would be extra neighborly if that happened *before* offering this program to guix users, while fully knowing that the other FSDG distros are still intentionally suppressing it in solidarity again, i am totally indifferent as to whether anyone uses chromium or not - my only interest in this is that i would like to strengthen the FSDG by convincing FSDG distros to communicate and collaborate with each other, and to achieve consensus about common issues such as this, that clearly affect all distros equally; so that no one is compelled to ask "why does guixsd endorse that popular program if other FSDG distros reject it on principal?" - it is difficult enough to explain to users why these programs are rejected in the first place; but at least the way things are now, we can say that all FSDG distros are in agreement to err on the conservative side until a satisfactory liberation procedure is found and documented - currently, the documented liberation procedure is: "Remove program/package. Use GNU IceCat, or equivalent"[2] - if there is a better candidate procedure now, let us get it onto the table for discussion i would like to consider all FSDG distros as being part of a larger federation, sharing the same primary goals; but we cant all be reading all of the dev lists - let us communicate whenever applicable, in the common venue that exists for that purpose[3] - i tried enticing the folks on the guix team to do that previously - if there is indeed something new to announce regarding chromium's dubious FSDG status, please elect someone from guix to do so now - this would be very interesting news to the readers of that list, and your effort and/or accomplishment would be sincerely applauded - other FSDG distros would be happy (and some quite eager) to re-instate any of these chromium-derived packages if a consensus could be reached that any of them could be distributed 100% freely; but if all distros are to decide for themselves what is freely distributable and what is not, without evidence and without discussing it with the other FSDG distros nor the FSF, then the FSDG loses its teeth, and we all look wishy-washy and flakey on that, the main, central FSDG concern: which programs are freely distributable and which are not [1]: https://lists.gnu.org/archive/html/guix-devel/2018-09/msg00264.html [2]: https://libreplanet.org/wiki/List_of_software_that_does_not_respect_the_Free_System_Distribution_Guidelines#chromium-browser [3]: https://lists.nongnu.org/mailman/listinfo/gnu-linux-libre From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 04 00:52:42 2019 Received: (at 28004) by debbugs.gnu.org; 4 Feb 2019 05:52:42 +0000 Received: from localhost ([127.0.0.1]:57979 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqXBR-0004vt-Lu for submit@debbugs.gnu.org; Mon, 04 Feb 2019 00:52:42 -0500 Received: from mout01.posteo.de ([185.67.36.65]:41583) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqXBN-0004vb-Oy for 28004@debbugs.gnu.org; Mon, 04 Feb 2019 00:52:39 -0500 Received: from submission (posteo.de [89.146.220.130]) by mout01.posteo.de (Postfix) with ESMTPS id 603AB160060 for <28004@debbugs.gnu.org>; Mon, 4 Feb 2019 06:52:31 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=posteo.net; s=2017; t=1549259551; bh=GJUO6CP/iZAxhSmM9jEnhLFs7Q3KPWelpvfz1BccK6M=; h=Date:From:To:Cc:Subject:From; b=QYPdk7pO53dwoL/o1lmtboElFNuKN19W+bVluD/TTr1IrY6JlXcdJyxCqPMGxyuou xcch91GetXoGvzG3J1qfz8VapiwLhPpxNh24eUNbkvzWBAYskj5x3kgcM2Mdjaogqf 7WGzRTfAySjIbOWh0RjLdlFUAQ0SIps9QuyClz2HluDICc06UbRQsBYiB1j0HDvcR+ ED42civ2hCnft7HxW8YYFVx+INjFphdjx/h8v5VHGHLvmT4uvPtoxvfVnUD7k9oJdz UUhRYqJmKeWQQ0mjnFHACP0oa0cinLPBFXJ8CKDpyZsGkHMhB3qNDqc2ebsGx9I+OM c3Wfek8nwDxmQ== Received: from customer (localhost [127.0.0.1]) by submission (posteo.de) with ESMTPSA id 43tH0t3wwrz6tm6; Mon, 4 Feb 2019 06:52:30 +0100 (CET) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII; format=flowed Content-Transfer-Encoding: 7bit Date: Mon, 04 Feb 2019 06:52:30 +0100 From: brettg@posteo.net To: bill-auger Subject: Re: [PATCH] gnu: Add ungoogled-chromium. In-Reply-To: <20190203235204.63970587@parabola> References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> Message-ID: <25092084972c94d8c03a0a440465b924@posteo.net> X-Sender: brettg@posteo.net User-Agent: Posteo Webmail X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org, Guix-devel , gnu-linux-libre@nongnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) As always, I second Bill here. There is a lot of history behind the Chromium project that I think many of us are aware of. There, to my knowledge, remains to be a complete audit of the Chromium source. Such an audit is crucial for us to even know what is problematic and what is not when it comes to FSDG compliance. So, unless the ungoogled chromium project has done this audit successfully I remain a kind skeptic. On 04.02.2019 05:52, bill-auger wrote: > re: https://lists.gnu.org/archive/html/guix-devel/2019-02/msg00009.html > > i would like to remind readers of the guix-devel list that it was > discussed some months ago, why no FSDG distros currently distribute > chromium[1] - it appeared at that time, that most people in that > discussion were in agreement that chromium should not be included in > guix; and marius was instead hosting it in a private repo, as not to > taint the main guix repos with dubious software - has there been a > notable break-through since then? > > what is the evidence for this claim that this guix package is "free > software only"? - what does "Marks beautiful computed-origin-method" do > toward that end? - if a procedure for liberating any chromium-derived > software has been discovered, this would be a marvelous accomplishment > and very good news indeed, of which people outside of the guix dev team > would also be interested to learn > > if the guix team has discovered some new information or has concocted a > viable liberation recipe for chromium or any of it's offspring, then i > hope that, for the benefit of all fellow Fosstopians, someone would > present that information to the FSDG mailing list for review and > discussion - it would be extra neighborly if that happened *before* > offering this program to guix users, while fully knowing that the other > FSDG distros are still intentionally suppressing it in solidarity > > again, i am totally indifferent as to whether anyone uses chromium or > not - my only interest in this is that i would like to strengthen the > FSDG by convincing FSDG distros to communicate and collaborate with > each > other, and to achieve consensus about common issues such as this, that > clearly affect all distros equally; so that no one is compelled to ask > "why does guixsd endorse that popular program if other FSDG distros > reject it on principal?" - it is difficult enough to explain to users > why these programs are rejected in the first place; but at least the > way things are now, we can say that all FSDG distros are in agreement > to > err on the conservative side until a satisfactory liberation procedure > is found and documented - currently, the documented liberation > procedure is: "Remove program/package. Use GNU IceCat, or > equivalent"[2] - if there is a better candidate procedure now, let us > get it onto the table for discussion > > i would like to consider all FSDG distros as being part of a larger > federation, sharing the same primary goals; but we cant all be reading > all of the dev lists - let us communicate whenever applicable, in the > common venue that exists for that purpose[3] - i tried enticing the > folks on the guix team to do that previously - if there is indeed > something new to announce regarding chromium's dubious FSDG status, > please elect someone from guix to do so now - this would be very > interesting news to the readers of that list, and your effort and/or > accomplishment would be sincerely applauded - other FSDG distros would > be happy (and some quite eager) to re-instate any of these > chromium-derived packages if a consensus could be reached that any of > them could be distributed 100% freely; but if all distros are to decide > for themselves what is freely distributable and what is not, without > evidence and without discussing it with the other FSDG distros nor the > FSF, then the FSDG loses its teeth, and we all look wishy-washy and > flakey on that, the main, central FSDG concern: which programs are > freely distributable and which are not > > > [1]: > https://lists.gnu.org/archive/html/guix-devel/2018-09/msg00264.html > [2]: > https://libreplanet.org/wiki/List_of_software_that_does_not_respect_the_Free_System_Distribution_Guidelines#chromium-browser > [3]: https://lists.nongnu.org/mailman/listinfo/gnu-linux-libre From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 04 02:46:38 2019 Received: (at 28004) by debbugs.gnu.org; 4 Feb 2019 07:46:38 +0000 Received: from localhost ([127.0.0.1]:58018 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqYxh-0008DN-Lm for submit@debbugs.gnu.org; Mon, 04 Feb 2019 02:46:37 -0500 Received: from eggs.gnu.org ([209.51.188.92]:60677) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqYxf-0008D5-HO for 28004@debbugs.gnu.org; Mon, 04 Feb 2019 02:46:35 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]:59079) by eggs.gnu.org with esmtp (Exim 4.71) (envelope-from ) id 1gqYxa-0005am-8Z; Mon, 04 Feb 2019 02:46:30 -0500 Received: from ineiev by fencepost.gnu.org with local (Exim 4.82) (envelope-from ) id 1gqYxa-00012p-5n; Mon, 04 Feb 2019 02:46:30 -0500 Date: Mon, 4 Feb 2019 02:46:30 -0500 From: Ineiev To: Workgroup for fully free GNU/Linux distributions Subject: Re: [GNU-linux-libre] [PATCH] gnu: Add ungoogled-chromium. Message-ID: <20190204074629.GD14481@gnu.org> References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="whpHMr7UwS4k4x4q" Content-Disposition: inline In-Reply-To: <20190203235204.63970587@parabola> User-Agent: Mutt/1.5.21 (2010-09-15) X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic] X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --whpHMr7UwS4k4x4q Content-Type: text/plain; charset=us-ascii Content-Disposition: inline On Sun, Feb 03, 2019 at 11:52:04PM -0500, bill-auger wrote: > FSF, then the FSDG loses its teeth, and we all look wishy-washy and > flakey on that, the main, central FSDG concern: which programs are > freely distributable and which are not I don't think the main FSDG concern is which programs are freely distributable, and even which programs are free; IMHO it is, "a free system distribution must not steer users towards obtaining any nonfree information for practical use." --whpHMr7UwS4k4x4q Content-Type: application/pgp-signature; name="signature.asc" Content-Description: Digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEvZ1N7nsv8cvvLuDE4KzT4Mvnh0oFAlxX7dUACgkQ4KzT4Mvn h0rDJwgAijceNPXVYo3IJs8nnIfuFqlkOFMfY9Y9RuThvZmsrrhLkyvkkaulzSVS SD789mNKzSffuN/uJnT7Py83NG4PByll1OGeAi5ZgKNW3SlbGDggUfMw/PaiEEYL fJ4vZ7UKxwZBkEius7YfutUeec1xVJ/M8S3o6GJ7ninqDO2m9M7qpPLev4PWfyML xGBpTomM4xgnhuqn/Q+FPgX5py6HSv9u+QVxiW4Guor07NNyZcU2vASnSWDrutQD CVc6V/gCNU1hitqMLd8PhnK8fTvOrEVr6t5R/DBsa+x/pNweEl7BLGX0gdgcS7yA sTTGUxE+YygvM2uCMoJwfpbwTZfjvw== =U1og -----END PGP SIGNATURE----- --whpHMr7UwS4k4x4q-- From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 04 08:46:53 2019 Received: (at 28004) by debbugs.gnu.org; 4 Feb 2019 13:46:53 +0000 Received: from localhost ([127.0.0.1]:58249 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqeaI-0001SI-6X for submit@debbugs.gnu.org; Mon, 04 Feb 2019 08:46:52 -0500 Received: from wout2-smtp.messagingengine.com ([64.147.123.25]:45025) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqeaG-0001M5-GQ for 28004@debbugs.gnu.org; Mon, 04 Feb 2019 08:46:49 -0500 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.west.internal (Postfix) with ESMTP id 3F11B2ED5; Mon, 4 Feb 2019 08:46:42 -0500 (EST) Received: from mailfrontend2 ([10.202.2.163]) by compute4.internal (MEProxy); Mon, 04 Feb 2019 08:46:42 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=famulari.name; h=date:from:to:cc:subject:message-id:references:mime-version :content-type:in-reply-to; s=mesmtp; bh=Dm/5X28d7hiDvspUj7swKnxR P3/UoIW4kdHzAXMmc+o=; b=nHRDYzlvsLfkBWjbxW81ENG//j/ULjdlZkKV4V24 Jxj16qL0aOer1c/yN0zXOxWL9SfPDadn4eGwXHti0Qk0zBLbQ8dfi5eqeyS8f9Hk QldhI5wn3Ras20tJa9R/xmWSbKzhGeA4m1WFhP9HvJYUTMYHuYjJltuSp4DWLA/t Q1w= DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; bh=Dm/5X2 8d7hiDvspUj7swKnxRP3/UoIW4kdHzAXMmc+o=; b=GtUOyVYIE4XiP0+YBQ2hFZ G7NVTvC/hr2F6mR26SG+HiJP4PXYFQGBDjBfZTlcPyGWpfS5Kr1R3g61VPa4Q+5T cd8WbcaaxKBUO5KgqDTmn4A734+1I+edbXNOzZUbYB4GAJjawCiUW07/SUAZXU0G TuLYPxQdhPygBPXrnDsvkni8krUmmkK5+kCxplvLS49z5AU9ynpiY5+hEz2KgJks vjsdSsvxYIzl+snzlOUVGNnZYAeBOQ5yopSAbUNQrEwygnzxAB2weIyg0CCYcMs7 NvFnR0fEAh+KoaYNrqA6bBdc5kNwinzf+jv9sb4kiONpgn8dQUosfbH8k+8YWZkw == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtledrkeeggdehiecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfhuthenuceurghilhhouhhtmecufedt tdenucenucfjughrpeffhffvuffkfhggtggujggfsehgtderredtredvnecuhfhrohhmpe fnvghoucfhrghmuhhlrghrihcuoehlvghosehfrghmuhhlrghrihdrnhgrmhgvqeenucfk phepleegrddutdelrdeihedrvddtleenucfrrghrrghmpehmrghilhhfrhhomheplhgvoh esfhgrmhhulhgrrhhirdhnrghmvgenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (cust-209-65-109-94.dyn.as47377.net [94.109.65.209]) by mail.messagingengine.com (Postfix) with ESMTPA id 12513100E5; Mon, 4 Feb 2019 08:46:39 -0500 (EST) Date: Mon, 4 Feb 2019 14:46:38 +0100 From: Leo Famulari To: bill-auger Subject: Re: [PATCH] gnu: Add ungoogled-chromium. Message-ID: <20190204134638.GA8269@jasmine.lan> References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="2fHTh5uZTiUOsy+g" Content-Disposition: inline In-Reply-To: <20190203235204.63970587@parabola> User-Agent: Mutt/1.11.2 (2019-01-07) X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --2fHTh5uZTiUOsy+g Content-Type: text/plain; charset=us-ascii Content-Disposition: inline On Sun, Feb 03, 2019 at 11:52:04PM -0500, bill-auger wrote: > what is the evidence for this claim that this guix package is "free > software only"? - what does "Marks beautiful computed-origin-method" do > toward that end? - if a procedure for liberating any chromium-derived > software has been discovered, this would be a marvelous accomplishment > and very good news indeed, of which people outside of the guix dev team > would also be interested to learn If you have a concrete example of a Chromium component that is not free software please list it in a reply-all this email. In general, if upstream developers say their software is released under a free software license by putting the license header in the repo or in the files, then we take them at their word. --2fHTh5uZTiUOsy+g Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEEsFFZSPHn08G5gDigJkb6MLrKfwgFAlxYQjcACgkQJkb6MLrK fwi+KhAAhu6rRIJtnL3jhGFuB+S7yQcwb2vYinLXn/BWurEvX3rfiY3tw7zfCjq4 d85halwnQOAI/m1X0v9PhGN0ZMsFkGoCsOpZiOzi/KR5L26ScQoUsLQl2Yn+sd06 LlryQU+hRPNYLJV9zPhdROrcQJTy1RwfONGbPluupwRxZxLW8+3fuj3xu5ZcH2cp O9MlPu3D+UwGTe3ysnJ8F3uvdEL6068jPTqRRYSi6/gQ0AXKZB+5QDLHiSAoiwu3 3OHnFBHxm+qm53fbXqh2fSbQE1CUPJD1vVCvZVhbydsVL92VxnSWY0sFjO6cQxvD Xp0AoFO6DxnyfNvqYI69iyiSaXdMU1E/3d6VStXu0jzZ2QRjboFL4p8oOrIAnLjl dorf9RRREgGv2kb3GNIJaNmp18MlydR7WMrqro9SvFHUPEc7WRDPnALdv6DOgyod 4+ZF3+AFM094n546g5SD+Ifzn/7RMgFWpUJTTlguOrnsVnVRsaUtGoqP8uwfrVm+ AzN+Z7N2uZLU4TJNfoQi1ybF9qtD7BuNhdpC7yupsvQ0tkPHSA0UJiOl15VZ1Von vSWlp7UE3WtMW2xeSVgPIZUrMdSc202pTmpYGVQmtEN9shgEBLFhQq2cpPjyomH3 c8Zl0M1FfEKbeAg8RS9ie1TTkRl8hQHRYHcpDUB1jfWYCu5VD9A= =N6fH -----END PGP SIGNATURE----- --2fHTh5uZTiUOsy+g-- From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 04 09:48:32 2019 Received: (at 28004) by debbugs.gnu.org; 4 Feb 2019 14:48:32 +0000 Received: from localhost ([127.0.0.1]:58276 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqfY0-0005Tt-0X for submit@debbugs.gnu.org; Mon, 04 Feb 2019 09:48:32 -0500 Received: from catfish.maple.relay.mailchannels.net ([23.83.214.32]:31750) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqfXy-0005Ti-Hz for 28004@debbugs.gnu.org; Mon, 04 Feb 2019 09:48:31 -0500 X-Sender-Id: dreamhost|x-authsender|bill-auger@peers.community Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id D7F475E3C41 for <28004@debbugs.gnu.org>; Mon, 4 Feb 2019 14:48:27 +0000 (UTC) Received: from pdx1-sub0-mail-a18.g.dreamhost.com (unknown [100.96.20.98]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id 96C6C5E3775 for <28004@debbugs.gnu.org>; Mon, 4 Feb 2019 14:48:27 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|bill-auger@peers.community Received: from pdx1-sub0-mail-a18.g.dreamhost.com (pop.dreamhost.com [64.90.62.162]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384) by 0.0.0.0:2500 (trex/5.16.2); Mon, 04 Feb 2019 14:48:27 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|bill-auger@peers.community X-MailChannels-Auth-Id: dreamhost X-Tank-Cooperative: 696c286c43827d82_1549291707751_3547155621 X-MC-Loop-Signature: 1549291707751:3065913619 X-MC-Ingress-Time: 1549291707751 Received: from pdx1-sub0-mail-a18.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a18.g.dreamhost.com (Postfix) with ESMTP id 3D0D27F742 for <28004@debbugs.gnu.org>; Mon, 4 Feb 2019 06:48:27 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=peers.community; h=date :from:to:subject:message-id:in-reply-to:references:mime-version :content-type:content-transfer-encoding; s=peers.community; bh=z 9EPcad36a5nhmzd5mK7P7JjWNU=; b=HAAnXtUFait9FEU+X1UcF2M7M4tyAohNx 9MDNxRj5hCFu2Dn+wu+UHLVyL3CeG1REeetM1OIK45FK4Q+IPFM59PDUp5+f2AS1 10Nm2aMSOIDaWwpjdKRSLpi10aO5ZhFrIO6DTeR01u0IJnW8HZ33OZpVqdmabpLS UCnWcqKCCk= Received: from parabola (75-138-186-142.dhcp.oxfr.ma.charter.com [75.138.186.142]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: bill-auger@peers.community) by pdx1-sub0-mail-a18.g.dreamhost.com (Postfix) with ESMTPSA id E079F7F741 for <28004@debbugs.gnu.org>; Mon, 4 Feb 2019 06:48:26 -0800 (PST) Date: Mon, 4 Feb 2019 09:47:54 -0500 X-DH-BACKEND: pdx1-sub0-mail-a18 From: bill-auger To: 28004@debbugs.gnu.org Subject: Re: [PATCH] gnu: Add ungoogled-chromium. Message-ID: <20190204094754.449ea14d@parabola> In-Reply-To: <20190204134638.GA8269@jasmine.lan> References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> <20190204134638.GA8269@jasmine.lan> X-Mailer: Claws Mail 3.17.3 (GTK+ 2.24.32; x86_64-pc-linux-gnu) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-VR-OUT-STATUS: OK X-VR-OUT-SCORE: 0 X-VR-OUT-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedtledrkeeggdeilecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucggtfgfnhhsuhgsshgtrhhisggvpdfftffgtefojffquffvnecuuegrihhlohhuthemuceftddtnecunecujfgurhepfffhvffukfgjfhfogggtgfesthejredtredtvdenucfhrhhomhepsghilhhlqdgruhhgvghruceosghilhhlqdgruhhgvghrsehpvggvrhhsrdgtohhmmhhunhhithihqeenucffohhmrghinheptghhrhhomhhiuhhmrdhorhhgnecukfhppeejhedrudefkedrudekiedrudegvdenucfrrghrrghmpehmohguvgepshhmthhppdhhvghlohepphgrrhgrsgholhgrpdhinhgvthepjeehrddufeekrddukeeirddugedvpdhrvghtuhhrnhdqphgrthhhpegsihhllhdqrghughgvrhcuoegsihhllhdqrghughgvrhesphgvvghrshdrtghomhhmuhhnihhthieqpdhmrghilhhfrhhomhepsghilhhlqdgruhhgvghrsehpvggvrhhsrdgtohhmmhhunhhithihpdhnrhgtphhtthhopedvkedttdegseguvggssghughhsrdhgnhhurdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) On Mon, 4 Feb 2019 14:46:38 +0100 Leo wrote: > If you have a concrete example of a Chromium component that is not > free software please list it in a reply-all this email. this is not a discussion list i will apologize in advance for this length reply - i did not CC this list if you demand evidence you need look no further than the upstream itself - the upstream developers can not verify for themselves that their program is freely licensed; as evidenced by the 10 year old bug report on this issue that is still open https://bugs.chromium.org/p/chromium/issues/detail?id=28291 the default copy permissions for every copyrighted work is "none" - in order for that work be be set free, the author must very explicitly label it as such, and try their very best to ensure that their formal statement of permission follows along with any copies of it - because if that permission is missing, or difficult to locate or to comprehend, there is no reason to assume the work is freely distributable i would hope that i would not need to explain that to a member of GNU the burden of proof is not upon the one who claims that the default case applies, it is upon the one who claims that some special case applies and anyway - let me please repeat this one more time - i have no desire to defend nor condemn this particular program - this has been discussed ad nauseam for many years - all that i intend today is to entice the guix developers to communicate with the other FSDG distros and the FSF to reach a uniform consensus on the matter - rather than to see guix choose to distribute it, while all other FSDG distros are in agreement not to distribute it From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 04 10:34:49 2019 Received: (at 28004) by debbugs.gnu.org; 4 Feb 2019 15:34:49 +0000 Received: from localhost ([127.0.0.1]:59598 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqgGm-0000Zb-O0 for submit@debbugs.gnu.org; Mon, 04 Feb 2019 10:34:49 -0500 Received: from mx1.riseup.net ([198.252.153.129]:45386) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqdL5-0002NY-9V for 28004@debbugs.gnu.org; Mon, 04 Feb 2019 07:27:03 -0500 Received: from capuchin.riseup.net (capuchin-pn.riseup.net [10.0.1.176]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "COMODO RSA Domain Validation Secure Server CA" (verified OK)) by mx1.riseup.net (Postfix) with ESMTPS id 1D2561A20C9; Mon, 4 Feb 2019 04:27:02 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1549283222; bh=kAUsSx8BgCbhUC446vh3PqQqL5rKlXB1d1HB4VZEPak=; h=Subject:To:Cc:References:From:Date:In-Reply-To:From; b=Pg/qV45NrHM7JWTpnEJSotsgP1f7fTNSzJx59TYcw1QnAvBLhZsXVcM0B4Jgq+ui5 B00olYNg+W08/L3DxaBmbS8RcTrssTZrJC1VgEEjegQrn4mlQfk07kfI14WHxmG4fq XvP+Ep5PaZhil5UKrkh9mT3afc6Nusan3Gznagi4= X-Riseup-User-ID: 005C579A15B45DACB4889F57CBCCE7E0C780B41D09FEAA9A5906CAFD7E3E0EA2 Received: from [127.0.0.1] (localhost [127.0.0.1]) by capuchin.riseup.net with ESMTPSA id 77688120BFF; Mon, 4 Feb 2019 04:27:00 -0800 (PST) Subject: Re: [GNU-linux-libre] [PATCH] gnu: Add ungoogled-chromium. To: guix-devel@gnu.org References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> From: Julie Marchant Openpgp: preference=signencrypt Autocrypt: addr=onpon4@riseup.net; keydata= xsFNBFqKX7EBEACzXlTUAPlNEDZG/nzwwR09tfRr92BhrjUjAyzhmAuMMHCliwQGlWgP8rlL /n6NTpgKvQKWWOEsmm9PwQcJuXuR0G67SbCmIAFquLvd65zM03ZfD/WnQQfhnI5hwpLkfwDZ edRMfemoDNavDQeN48iXK4S2Y9aWD3S7lMB/8L+00yQ+KOhw3KGlAtuE0+R+yn41pPIieg3F OfX81kgdMZ0sL3Pn+faRdPkqSRmuy3d1mM7eeLCUf2n+su0GAbVVLtAUgZ3CumaOKLGF62Sx Teaa5gAHgyv1JHZQ2/lkuXZOiPj5zYolvucTUsqdsotQ1Y7IickMrIHsvj0hKAmNQHmCFUbn NhkMVwHjInl2lvJ0BtrVagSxYCL4bYImcY6LM3WLt/V5TCVydQBMGwH8q1zzSb3RMrX2fJM2 nMd+l9lmGFpoPadYcrVNmOGLOrRBpVMgfuEbsoAUASQXLMbPWY0RBfSoAAVB+4z3VbWWmvAE 1OXfKHcRXS4lED8csFvPqTstKkPpQidh+Jq3hS9ZwzOE/qHXYc7ECKck9LPEduorXAxnzItT EycBe11Xe7foBT1lptdt9iEe8VXc5rMMRGCyDlZ3Ll8//lmeIs7IySsctyfV0iD1iaPO4Bus PweX1mH0eenbH3Di5g2clrkTi2BX1loEwoXTspoGMPpGGrhSVwARAQABzSJKdWxpZSBNYXJj aGFudCA8b25wb240QHJpc2V1cC5uZXQ+wsF5BBMBAgAjAhsjBwsJCAcDAgEGFQgCCQoLBBYC AwECHgECF4AFAlt1vccACgkQ5tCEZmsTjkXL3g/+NFBj31LdEB1gta74whlbeT8gmc1CIt+6 7RIna+hcUCRQ1puoTBJZIkeIB/fxM3BmBre9+0hD+tdnl929Ez57ByOxZJPv3UJgtbNq2vLE TMPio8umAt35+8Gw+J+ccTQPiqqWSXPtVMQLbGl+wrmVjQB3zRXk8HzaVbi58I215OFLzzN0 ajeAZRTonMiUCmqbTglvTBf4cCYCrpFuH+H57oWH0SifTSlrd3zbD6NaUZX6JhXu0SxT5khm Fnj52b3sCXULXGpdE3Jw8m4MG7xwU1KKcIDzWl3UmvHlOEh9seBBUo1tGKH2lOnMd+1dcS+Y GT6NsLgpAv/7Omk/yiuwVa1fEqjwVoB3RE4qpg6HPtyBhE5Yjks3ldEguEdU7tALfiAA3oHl GItx5XfHadd+atTmYNaEnbwrHHS0Lq6w04Q159R9bJm6FBP9HFV5T988U4jBR7n/LmI7UGOk 9sOGWYt6HZHsnlfgPij1wVIYi6slj1DZz5DgQr5ftJxaOlqXbVb2t3Cb9SKYV2+R5UG6DJrR 8NeIJXEtq3l51G4iWaG0WQq33mkgun/LyInZ0me/CIdeUQfbxc0Auvqn6zpuqQaMekKuV1ZD buUeXNJKFvUYIj8QqhyjnYLBDTaQPyHP14B/sejOd1I+hticMAov/azvnG5nXyWK6LVVvI8Q 6gLOwU0EWopfsQEQALCxJPtcNTQgG5ls2+api4DX2Lb6c92xCEU656QonCgdE8NRIY/8uWe1 I82BDe3gLW7ZQ0ZrcAnV3WmOEA5WIiovZOFZu6VNMfTqaL/xHaIsl68dyhmq0SxszIYx8K1M Fs69fjsoaM4GRTPTNv5VlUaYFGV+G4D4ZDSXtVRzNqcZfhrpNBMR6gfEC4u9ZZUy5nGIADAh wa5pB2i48rHLHwqU4sysC8ucYzZDGT3F6VbYYVabtKWj5VQPzfjzNFIxGumbmsvUsx0hggPr 35fRKU3GEfkD61/tsrrMqgFQFPE+4As4+MZuDZPsBvI/cyNUxIYA6mnCJoGo1PsrIfMRFEfb vxKV9aETdM0/WIK2lcjt3FfamfAL6QrpSVI79pWK454W3bi6Zvdlod+oK5zoNBJ8/xpO6F3n /JhmXnWUE74KhuK3QpvgZCEwcoJ9RfHBEogH+Dw1y/MtvPG8I0+o/NpGbMA6X6GzxqO1/vRD EkfI4twGj+wD+Bn/1bTHmw7/JhgnY4DDHo/7IkPNHj+QXpJDkk3NTKIXFCWkC+LOT+Zy7VXN 3tYKIkHVGiNJLY8aKn/85mlbY8hwBJjPR6l6Ch/twSeXhsqoZ5ASiKrCFcBUAAn5YA/I37i/ nZy2vw6N/yxM/WrIHC6l47Qfbf3rZSAdIWN8/WxqTyU1qfsEDjjRABEBAAHCwV8EGAECAAkC GwwFAlt1vccACgkQ5tCEZmsTjkXvNQ/+Pok9GgdCZIab3ZmMBC+JHDbv451aUHohmUD9Hl3f FMu9v+ug7nvJSoPhfFDZoT8O5LePR8sFJa47Yo6DiUjM3VFCeGNVMMhpEamsylAxFVYcLHD6 xNWkCLYInYF9FNN0OsDoK79y0zSRqgMAdrp5dqZhJKlWny7Kb9F1vUoNU0fsiXB+819SHz4F fyIlDPpOAQx3Fx5ZlctulWvwALTZV7pdNryIpi6CsAW5PIqcs53+mcXWEPgocvWDW4Fnld8F NL05lWNIutBwjK8YEuhvqZdVBhp5Av2SHGSfQG4YidCCQIokmKMLd09Pg0PiYWbK4pdjYSog dm72CuX8D0dwvYtxVJslmVq0cjnxHfrKZCKpaEznszAXS/xWD02boW4G+4euPCZFvdV8B7ry NTbY1OhFVnlT25hcdGeKlGewaChZgY2tfQ6JhiBb8ppnYbe3NWtzNb8U//me5iAXwzlWJeC2 1LQ3HaESpGEoNFodBq0CjXLJ54hJZLYS5dLaIw2j599Ni1K9EaUI9t8VbUtu0yZlR3gBs8G3 ov9FNBpKVdjJC2hbe9tZEkKda/ocMnOIcoTYKVhjdLzMWBwWgxhUpa75CNxBr/5TIEDEZxOJ L7UkLklTFPDdW4Uw9UorjyzbSWWaVDcOloJmG+nlJ27/pCKy/yHdx0OBkAJC20XnVnQ= Message-ID: <29af2ef2-0f37-8728-51c9-b861fef4bbc8@riseup.net> Date: Mon, 4 Feb 2019 07:26:59 -0500 MIME-Version: 1.0 In-Reply-To: <20190203235204.63970587@parabola> Content-Type: text/plain; charset=utf-8 Content-Language: en-CA Content-Transfer-Encoding: 7bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 X-Mailman-Approved-At: Mon, 04 Feb 2019 10:34:39 -0500 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) On 02/03/2019 11:52 PM, bill-auger wrote: > re: https://lists.gnu.org/archive/html/guix-devel/2019-02/msg00009.html > > i would like to remind readers of the guix-devel list that it was > discussed some months ago, why no FSDG distros currently distribute > chromium[1] - it appeared at that time, that most people in that > discussion were in agreement that chromium should not be included in > guix; and marius was instead hosting it in a private repo, as not to > taint the main guix repos with dubious software - has there been a > notable break-through since then? > > what is the evidence for this claim that this guix package is "free > software only"? - what does "Marks beautiful computed-origin-method" do > toward that end? - if a procedure for liberating any chromium-derived > software has been discovered, this would be a marvelous accomplishment > and very good news indeed, of which people outside of the guix dev team > would also be interested to learn > > if the guix team has discovered some new information or has concocted a > viable liberation recipe for chromium or any of it's offspring, then i > hope that, for the benefit of all fellow Fosstopians, someone would > present that information to the FSDG mailing list for review and > discussion - it would be extra neighborly if that happened *before* > offering this program to guix users, while fully knowing that the other > FSDG distros are still intentionally suppressing it in solidarity > > again, i am totally indifferent as to whether anyone uses chromium or > not - my only interest in this is that i would like to strengthen the > FSDG by convincing FSDG distros to communicate and collaborate with each > other, and to achieve consensus about common issues such as this, that > clearly affect all distros equally; so that no one is compelled to ask > "why does guixsd endorse that popular program if other FSDG distros > reject it on principal?" - it is difficult enough to explain to users > why these programs are rejected in the first place; but at least the > way things are now, we can say that all FSDG distros are in agreement to > err on the conservative side until a satisfactory liberation procedure > is found and documented - currently, the documented liberation > procedure is: "Remove program/package. Use GNU IceCat, or > equivalent"[2] - if there is a better candidate procedure now, let us > get it onto the table for discussion > > i would like to consider all FSDG distros as being part of a larger > federation, sharing the same primary goals; but we cant all be reading > all of the dev lists - let us communicate whenever applicable, in the > common venue that exists for that purpose[3] - i tried enticing the > folks on the guix team to do that previously - if there is indeed > something new to announce regarding chromium's dubious FSDG status, > please elect someone from guix to do so now - this would be very > interesting news to the readers of that list, and your effort and/or > accomplishment would be sincerely applauded - other FSDG distros would > be happy (and some quite eager) to re-instate any of these > chromium-derived packages if a consensus could be reached that any of > them could be distributed 100% freely; but if all distros are to decide > for themselves what is freely distributable and what is not, without > evidence and without discussing it with the other FSDG distros nor the > FSF, then the FSDG loses its teeth, and we all look wishy-washy and > flakey on that, the main, central FSDG concern: which programs are > freely distributable and which are not > > > [1]: https://lists.gnu.org/archive/html/guix-devel/2018-09/msg00264.html > [2]: > https://libreplanet.org/wiki/List_of_software_that_does_not_respect_the_Free_System_Distribution_Guidelines#chromium-browser > [3]: https://lists.nongnu.org/mailman/listinfo/gnu-linux-libre Sorry, I didn't notice that this thread was on multiple lists, so when I hit "Reply List" it only went to the GNU-linux-libre list. Sending a copy to the other lists; sorry for the messiness. I'm not sure if I've mentioned it on the GNU-linux-libre list before, but I have never seen any actual evidence of the current version of Chromium containing proprietary components. It's an unreasonable standard to demand proof that programs are libre. That's an impossible thing to prove. If someone points out, as I have many times, "I have looked through Chromium's code and not found a single proprietary program," someone can simply say that they didn't look hard enough. That LibrePlanet page, by the way, is not evidence of Chromium containing proprietary components. It claims such, but the only evidence provided is a copyright file that clearly indicates a libre license, and a bug report about not passing a license checking script, which I might add is also not proof of any program being proprietary. Not to mention, this is from over eight years ago. Should distro maintainers also take the outdated recommendation to remove Project: Starfighter from that page at face value, despite the fact that I released a completely libre version almost four years ago? The point is, that's a wiki page sporadically maintained by volunteers. It's a possible starting point (though to be honest I'm not so sure it's even useful for that), but not an indication of the GNU FSDG gold standard, so to speak. -- Julie Marchant http://onpon4.github.io Encrypt your emails with GnuPG: https://emailselfdefense.fsf.org From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 04 17:34:53 2019 Received: (at 28004) by debbugs.gnu.org; 4 Feb 2019 22:34:53 +0000 Received: from localhost ([127.0.0.1]:59826 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqmpI-00029N-5W for submit@debbugs.gnu.org; Mon, 04 Feb 2019 17:34:53 -0500 Received: from hera.aquilenet.fr ([185.233.100.1]:41736) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqmpF-00029D-MW for 28004@debbugs.gnu.org; Mon, 04 Feb 2019 17:34:50 -0500 Received: from localhost (localhost [127.0.0.1]) by hera.aquilenet.fr (Postfix) with ESMTP id 22135BAFE; Mon, 4 Feb 2019 23:34:48 +0100 (CET) X-Virus-Scanned: Debian amavisd-new at aquilenet.fr Received: from hera.aquilenet.fr ([127.0.0.1]) by localhost (hera.aquilenet.fr [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id FUNQmDCYkHDJ; Mon, 4 Feb 2019 23:34:47 +0100 (CET) Received: from ribbon (unknown [IPv6:2a01:e0a:1d:7270:af76:b9b:ca24:c465]) by hera.aquilenet.fr (Postfix) with ESMTPSA id C0096449B; Mon, 4 Feb 2019 23:34:46 +0100 (CET) From: =?utf-8?Q?Ludovic_Court=C3=A8s?= To: bill-auger Subject: Re: [PATCH] gnu: Add ungoogled-chromium. References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> X-URL: http://www.fdn.fr/~lcourtes/ X-Revolutionary-Date: 16 =?utf-8?Q?Pluvi=C3=B4se?= an 227 de la =?utf-8?Q?R=C3=A9volution?= X-PGP-Key-ID: 0x090B11993D9AEBB5 X-PGP-Key: http://www.fdn.fr/~lcourtes/ludovic.asc X-PGP-Fingerprint: 3CE4 6455 8A84 FDC6 9DB4 0CFB 090B 1199 3D9A EBB5 X-OS: x86_64-pc-linux-gnu Date: Mon, 04 Feb 2019 23:34:45 +0100 In-Reply-To: <20190203235204.63970587@parabola> (bill-auger's message of "Sun, 3 Feb 2019 23:52:04 -0500") Message-ID: <87sgx3mbcq.fsf@gnu.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.1 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: 1.0 (+) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org, gnu-linux-libre@nongnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -0.0 (/) Hi bill-auger, bill-auger skribis: > re: https://lists.gnu.org/archive/html/guix-devel/2019-02/msg00009.html > > i would like to remind readers of the guix-devel list that it was > discussed some months ago, why no FSDG distros currently distribute > chromium[1] - it appeared at that time, that most people in that > discussion were in agreement that chromium should not be included in > guix; and marius was instead hosting it in a private repo, as not to > taint the main guix repos with dubious software - has there been a > notable break-through since then? It=E2=80=99s not entirely clear to me what the problems are, to be honest. Marius listed specific issues that were addressed by the patches; others then pointed out at additional issues that ungoogled-chromium fixes, which Marius took into account; what=E2=80=99s left now? I understand you=E2=80=99re skeptical about Chromium, but we cannot base decisions based on vague skepticism. If you know of issues that are still unaddressed, please do list them. I=E2=80=99d also like to stress that, if Chromium is eventually included in Guix, we are committed to fixing it or removing it should someone later discover that it does not comply with the FSDG (that=E2=80=99s the =E2=80= =9CCommitment to Correct Mistakes=E2=80=9D section of FSDG.) > i would like to consider all FSDG distros as being part of a larger > federation, sharing the same primary goals; As you know, several of us have occasionally asked for advice on the gnu-linux-libre list regarding concrete issues that we encountered (a recent example was Inferno, which we ended up not adding to the distro due to unresolved issues.) I believe Marius and others here made a real effort in understanding and addressing the ways in which Chromium would not comply with the FSDG. If you=E2=80=99re aware of issues that are unaddressed, please share! Thank you, Ludo=E2=80=99. From debbugs-submit-bounces@debbugs.gnu.org Tue Feb 05 00:23:08 2019 Received: (at 28004) by debbugs.gnu.org; 5 Feb 2019 05:23:08 +0000 Received: from localhost ([127.0.0.1]:59970 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqtCB-0005r3-6i for submit@debbugs.gnu.org; Tue, 05 Feb 2019 00:23:08 -0500 Received: from mx1.riseup.net ([198.252.153.129]:41392) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gqtC6-0005qr-40 for 28004@debbugs.gnu.org; Tue, 05 Feb 2019 00:22:53 -0500 Received: from capuchin.riseup.net (capuchin-pn.riseup.net [10.0.1.176]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "COMODO RSA Domain Validation Secure Server CA" (verified OK)) by mx1.riseup.net (Postfix) with ESMTPS id AFF5A1A04C8; Mon, 4 Feb 2019 21:22:48 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1549344169; bh=g2n8iSB10x/70O5UCHrtyLddNEtg0FzugkSt/xclHtI=; h=Date:In-Reply-To:References:Subject:To:CC:From:From; b=a9TCct6OTsWhd75X/0/rnJVUF66E4ghYTG8kVoAf2gZtMvUcT8cUd9EqVdOaYWPGf jc6MnUhf6G/V/zDi8S+yKewx/NzSGR/MvgKd0OMr7Ob08Mezw5tR7TAVV4/k9gAGK5 osh0J7XVDRu1QqTv9HoJFu0yyMSPxt4ElkaI0f58= X-Riseup-User-ID: 1C284C11D398438519862293EC41F9EA1497E0168EBB6EDFC44AAF0B5A8DA850 Received: from [127.0.0.1] (localhost [127.0.0.1]) by capuchin.riseup.net (Postfix) with ESMTPSA id 5A132120469; Mon, 4 Feb 2019 21:22:47 -0800 (PST) Date: Tue, 05 Feb 2019 06:22:44 +0100 In-Reply-To: <20190202192023.22087-1-mbakke@fastmail.com> References: <87y3qvb15k.fsf@fastmail.com> <20190202192023.22087-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----OLEBV8UXLOH3TYKFR6Q74PQLQ3834I" Content-Transfer-Encoding: 7bit Subject: Re: [bug#28004] [PATCH] gnu: Add ungoogled-chromium. To: guix-patches@gnu.org, Marius Bakke , guix-devel@gnu.org From: swedebugia Message-ID: <0D2635DB-4B93-4285-A7C2-4BC699EA4D4D@riseup.net> X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) ------OLEBV8UXLOH3TYKFR6Q74PQLQ3834I Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Marius Bakke skrev: (2 februari 2019 20:20:23 CET) >Thanks to Marks beautiful "computed-origin-method", Ungoogled-Chromium >is finally ready for inclusion in Guix=2E > >Features: >* Chromium 72=2E >* No unsolicited network traffic=2E >* Free software only=2E >* No DRM=2E >* Not an April Fools joke=2E > >It's currently using my trivial "fork" of Ungoogled-Chromium[0], which >will be upstreamed once the upstream reorganization[1] is done=2E > >Comments appreciated! > >[0]: >https://github=2Ecom/mbakke/ungoogled-chromium/commit/f9b9074c322a67b04ba= f0982797cd7b7e09614b5 >[1]: https://github=2Ecom/Eloston/ungoogled-chromium/issues/651 > >* gnu/packages/aux-files/chromium/master-preferences=2Ejson, >gnu/packages/chromium=2Escm: New files=2E >* gnu/local=2Emk (GNU_SYSTEM_MODULES): Adjust accordingly=2E >--- > gnu/local=2Emk | 1 + > =2E=2E=2E/chromium/master-preferences=2Ejson | 26 + > gnu/packages/chromium=2Escm | 741 ++++++++++++++++++ > 3 files changed, 768 insertions(+) >create mode 100644 >gnu/packages/aux-files/chromium/master-preferences=2Ejson > create mode 100644 gnu/packages/chromium=2Escm > >diff --git a/gnu/local=2Emk b/gnu/local=2Emk >index 82db1488d6=2E=2Eb5e937cdd7 100644 >--- a/gnu/local=2Emk >+++ b/gnu/local=2Emk >@@ -100,6 +100,7 @@ GNU_SYSTEM_MODULES =3D \ > %D%/packages/check=2Escm \ > %D%/packages/chemistry=2Escm \ > %D%/packages/chez=2Escm \ >+ %D%/packages/chromium=2Escm \ > %D%/packages/ci=2Escm \ > %D%/packages/cinnamon=2Escm \ > %D%/packages/clojure=2Escm \ >diff --git a/gnu/packages/aux-files/chromium/master-preferences=2Ejson >b/gnu/packages/aux-files/chromium/master-preferences=2Ejson >new file mode 100644 >index 0000000000=2E=2E0caa7cc4cd >--- /dev/null >+++ b/gnu/packages/aux-files/chromium/master-preferences=2Ejson >@@ -0,0 +1,26 @@ >+{ >+ "distribution": { >+ "import_bookmarks": false, >+ "make_chrome_default": false, >+ "make_chrome_default_for_user": false, >+ "verbose_logging": true, >+ "skip_first_run_ui": true, >+ "suppress_first_run_default_browser_prompt": true >+ }, >+ "browser": { >+ "has_seen_welcome_page" : true, >+ "check_default_browser" : false >+ }, >+ "dns_prefetching": { >+ "enabled": false >+ }, >+ "alternate_error_pages": { >+ "enabled": false >+ }, >+ "hardware": { >+ "audio_capture_enabled": false >+ }, >+ "default_apps": "noinstall", >+ "hide_web_store_icon": true, >+ "homepage": "https://www=2Egnu=2Eorg/software/guix" >+} >diff --git a/gnu/packages/chromium=2Escm b/gnu/packages/chromium=2Escm >new file mode 100644 >index 0000000000=2E=2Eeb404246d3 >--- /dev/null >+++ b/gnu/packages/chromium=2Escm >@@ -0,0 +1,741 @@ >+;;; GNU Guix --- Functional package management for GNU >+;;; Copyright =C2=A9 2019 Marius Bakke >+;;; >+;;; GNU Guix is free software; you can redistribute it and/or modify >it >+;;; under the terms of the GNU General Public License as published by >+;;; the Free Software Foundation; either version 3 of the License, or >(at >+;;; your option) any later version=2E >+;;; >+;;; GNU Guix is distributed in the hope that it will be useful, but >+;;; WITHOUT ANY WARRANTY; without even the implied warranty of >+;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE=2E See the >+;;; GNU General Public License for more details=2E >+;;; >+;;; You should have received a copy of the GNU General Public License >+;;; along with GNU Guix=2E If not, see =2E >+ >+(define-module (gnu packages chromium) >+ #:use-module ((guix licenses) #:prefix license:) >+ #:use-module (guix packages) >+ #:use-module (guix gexp) >+ #:use-module (guix store) >+ #:use-module (guix monads) >+ #:use-module (guix download) >+ #:use-module (guix git-download) >+ #:use-module (guix utils) >+ #:use-module (guix build-system gnu) >+ #:use-module (gnu packages) >+ #:use-module (gnu packages assembly) >+ #:use-module (gnu packages base) >+ #:use-module (gnu packages bison) >+ #:use-module (gnu packages build-tools) >+ #:use-module (gnu packages compression) >+ #:use-module (gnu packages cups) >+ #:use-module (gnu packages curl) >+ #:use-module (gnu packages fontutils) >+ #:use-module (gnu packages gcc) >+ #:use-module (gnu packages ghostscript) >+ #:use-module (gnu packages gl) >+ #:use-module (gnu packages glib) >+ #:use-module (gnu packages gnome) >+ #:use-module (gnu packages gnuzilla) >+ #:use-module (gnu packages gperf) >+ #:use-module (gnu packages gtk) >+ #:use-module (gnu packages icu4c) >+ #:use-module (gnu packages image) >+ #:use-module (gnu packages libevent) >+ #:use-module (gnu packages libffi) >+ #:use-module (gnu packages linux) >+ #:use-module (gnu packages kerberos) >+ #:use-module (gnu packages ninja) >+ #:use-module (gnu packages node) >+ #:use-module (gnu packages pciutils) >+ #:use-module (gnu packages pkg-config) >+ #:use-module (gnu packages pulseaudio) >+ #:use-module (gnu packages python) >+ #:use-module (gnu packages python-web) >+ #:use-module (gnu packages python-xyz) >+ #:use-module (gnu packages regex) >+ #:use-module (gnu packages serialization) >+ #:use-module (gnu packages speech) >+ #:use-module (gnu packages tls) >+ #:use-module (gnu packages valgrind) >+ #:use-module (gnu packages vulkan) >+ #:use-module (gnu packages video) >+ #:use-module (gnu packages xiph) >+ #:use-module (gnu packages xml) >+ #:use-module (gnu packages xdisorg) >+ #:use-module (gnu packages xorg)) >+ >+(define %preserved-third-party-files >+ '("base/third_party/dmg_fp" ;X11-style >+ "base/third_party/dynamic_annotations" ;BSD-2 >+ "base/third_party/icu" ;Unicode, X11-style >+ "base/third_party/superfasthash" ;BSD-3 >+ "base/third_party/symbolize" ;BSD-3 >+ "base/third_party/xdg_mime" ;LGPL2=2E1+ or Academic 2=2E0 >+ "base/third_party/xdg_user_dirs" ;Expat >+ "chrome/third_party/mozilla_security_manager" >;MPL-1=2E1/GPL2+/LGPL2=2E1+ >+ "courgette/third_party/bsdiff" ;BSD-2, BSD protection license >+ "courgette/third_party/divsufsort" ;Expat >+ "net/third_party/http2" ;BSD-3 >+ "net/third_party/mozilla_security_manager" ;MPL-1=2E1/GPL2+/LGPL2=2E= 1+ >+ "net/third_party/nss" ;MPL-2=2E0 >+ "net/third_party/quic" ;BSD-3 >+ "net/third_party/spdy" ;BSD-3 >+ "net/third_party/uri_template" ;ASL2=2E0 >+ "third_party/abseil-cpp" ;ASL2=2E0 >+ "third_party/adobe/flash/flapper_version=2Eh" ;no license, trivial >+ "third_party/angle" ;BSD-3 >+ "third_party/angle/src/common/third_party/base" ;BSD-3 >+ "third_party/angle/src/common/third_party/smhasher" ;Public domain >+ "third_party/angle/src/common/third_party/xxhash" ;BSD-2 >+ "third_party/angle/src/third_party/compiler" ;BSD-2 >+ "third_party/angle/src/third_party/libXNVCtrl" ;Expat >+ "third_party/angle/src/third_party/trace_event" ;BSD-3 >+ "third_party/angle/third_party/glslang" ;BSD-3 >+ "third_party/angle/third_party/spirv-headers" ;Expat >+ "third_party/angle/third_party/spirv-tools" ;Expat >+ "third_party/angle/third_party/vulkan-headers" ;ASL2=2E0 >+ "third_party/angle/third_party/vulkan-loader" ;ASL2=2E0 >+ "third_party/angle/third_party/vulkan-tools" ;ASL2=2E0 >+ "third_party/angle/third_party/vulkan-validation-layers" ;ASL2=2E0 >+ "third_party/apple_apsl" ;APSL2=2E0 >+ "third_party/blink" ;BSD-3 >+ "third_party/boringssl" ;OpenSSL/ISC (Google additions are ISC) >+ "third_party/boringssl/src/third_party/fiat" ;Expat >+ "third_party/breakpad" ;BSD-3 >+ "third_party/brotli" ;Expat >+ "third_party/cacheinvalidation" ;ASL2=2E0 >+ "third_party/catapult" ;BSD-3 >+ "third_party/catapult/common/py_vulcanize/third_party/rcssmin" >;ASL2=2E0 >+ "third_party/catapult/common/py_vulcanize/third_party/rjsmin" >;ASL2=2E0 >+ "third_party/catapult/third_party/polymer" ;BSD-3 >+ "third_party/catapult/tracing/third_party/d3" ;BSD-3 >+ "third_party/catapult/tracing/third_party/gl-matrix" ;Expat >+ "third_party/catapult/tracing/third_party/jszip" ;Expat or GPL3 >+ "third_party/catapult/tracing/third_party/mannwhitneyu" ;Expat >+ "third_party/catapult/tracing/third_party/oboe" ;BSD-2 >+ "third_party/catapult/tracing/third_party/pako" ;Expat >+ "third_party/ced" ;BSD-3 >+ "third_party/cld_3" ;ASL2=2E0 >+ "third_party/closure_compiler" ;ASL2=2E0 >+ "third_party/crashpad" ;ASL2=2E0 >+ "third_party/crashpad/crashpad/third_party/zlib/zlib_crashpad=2Eh" >;Zlib >+ "third_party/crc32c" ;BSD-3 >+ "third_party/cros_system_api" ;BSD-3 >+ "third_party/dom_distiller_js" ;BSD-3 >+ "third_party/fips181" ;BSD-3 >+ "third_party/flatbuffers" ;ASL2=2E0 >+ "third_party/google_input_tools" ;ASL2=2E0 >+ "third_party/google_input_tools/third_party/closure_library" >;ASL2=2E0 >+ =20 >"third_party/google_input_tools/third_party/closure_library/third_party/c= losure" >;Expat >+ "third_party/googletest" ;BSD-3 >+ "third_party/hunspell" ;MPL1=2E1/GPL2+/LGPL2=2E1+ >+ "third_party/iccjpeg" ;IJG >+ "third_party/inspector_protocol" ;BSD-3 >+ "third_party/jinja2" ;BSD-3 >+ "third_party/jstemplate" ;ASL2=2E0 >+ "third_party/khronos" ;Expat, SGI >+ "third_party/leveldatabase" ;BSD-3 >+ "third_party/libXNVCtrl" ;Expat >+ "third_party/libaddressinput" ;ASL2=2E0 >+ "third_party/libaom" ;BSD-2 or "Alliance for Open Media Patent >License 1=2E0" >+ "third_party/libaom/source/libaom/third_party/vector" ;Expat >+ "third_party/libaom/source/libaom/third_party/x86inc" ;ISC >+ "third_party/libjingle_xmpp" ;BSD-3 >+ "third_party/libphonenumber" ;ASL2=2E0 >+ "third_party/libsecret" ;LGPL2=2E1+ >+ "third_party/libsrtp" ;BSD-3 >+ "third_party/libsync" ;ASL2=2E0 >+ "third_party/libudev" ;LGPL2=2E1+ >+ "third_party/libwebm" ;BSD-3 >+ "third_party/libxml/chromium" ;BSD-3 >+ "third_party/libyuv" ;BSD-3 >+ "third_party/lss" ;BSD-3 >+ "third_party/markupsafe" ;BSD-3 >+ "third_party/mesa_headers" ;Expat, SGI >+ "third_party/metrics_proto" ;BSD-3 >+ "third_party/modp_b64" ;BSD-3 >+ "third_party/nasm" ;BSD-2 >+ "third_party/node" ;Expat >+ =20 >"third_party/node/node_modules/polymer-bundler/lib/third_party/UglifyJS2" >;BSD-2 >+ "third_party/ots" ;BSD-3 >+ "third_party/pdfium" ;BSD-3 >+ "third_party/pdfium/third_party/agg23" ;Expat >+ "third_party/pdfium/third_party/base" ;BSD-3 >+ "third_party/pdfium/third_party/bigint" ;Public domain, BSD-3 >+ "third_party/pdfium/third_party/skia_shared" ;BSD-3 >+ "third_party/pdfium/third_party/freetype/include/pstables=2Eh" >;FreeType >+ "third_party/ply" ;BSD-3 >+ "third_party/polymer" ;BSD-3 >+ "third_party/protobuf" ;BSD-3 >+ "third_party/protobuf/third_party/six" ;Expat >+ "third_party/pyjson5" ;ASL2=2E0 >+ "third_party/qcms" ;Expat >+ "third_party/rnnoise" ;BSD-3 >+ "third_party/s2cellid" ;ASL2=2E0 >+ "third_party/sfntly" ;ASL2=2E0 >+ "third_party/skia" ;BSD-3 >+ "third_party/skia/third_party/gif" ;MPL1=2E1/GPL2+/LGPL2=2E1+ >+ "third_party/skia/third_party/skcms" ;BSD-3 >+ "third_party/skia/third_party/vulkan" ;BSD-3 >+ "third_party/smhasher" ;Expat, public domain >+ "third_party/speech-dispatcher" ;GPL2+ >+ "third_party/spirv-headers" ;ASL2=2E0 >+ "third_party/SPIRV-Tools" ;ASL2=2E0 >+ "third_party/sqlite" ;Public domain >+ "third_party/ungoogled" ;BSD-3 >+ "third_party/usb_ids" ;BSD-3 >+ "third_party/usrsctp" ;BSD-2 >+ "third_party/web-animations-js" ;ASL2=2E0 >+ "third_party/webdriver" ;ASL2=2E0 >+ "third_party/webrtc" ;BSD-3 >+ "third_party/webrtc/common_audio/third_party/fft4g" ;Non-copyleft >+ "third_party/webrtc/common_audio/third_party/spl_sqrt_floor" >;Public domain >+ "third_party/webrtc/modules/third_party/fft" ;Non-copyleft >+ "third_party/webrtc/modules/third_party/g711" ;Public domain >+ "third_party/webrtc/modules/third_party/g722" ;Public domain >+ "third_party/webrtc/rtc_base/third_party/base64" ;Non-copyleft >+ "third_party/webrtc/rtc_base/third_party/sigslot" ;Public domain >+ "third_party/widevine/cdm/widevine_cdm_version=2Eh" ;BSD-3 >+ "third_party/widevine/cdm/widevine_cdm_common=2Eh" ;BSD-3 >+ "third_party/woff2" ;ASL2=2E0 >+ "third_party/xdg-utils" ;Expat >+ "third_party/yasm/run_yasm=2Epy" ;BSD-2 or BSD-3 >+ "third_party/zlib/google" ;BSD-3 >+ "url/third_party/mozilla" ;BSD-3, MPL1=2E1/GPL2+/LGPL2=2E1+ >+ "v8/src/third_party/utf8-decoder" ;Expat >+ "v8/src/third_party/valgrind" ;BSD-4 >+ "v8/third_party/inspector_protocol" ;BSD-3 >+ "v8/third_party/v8/builtins")) ;PSFL >+ >+(define* (computed-origin-method gexp-promise hash-algo hash >+ #:optional (name "source") >+ #:key (system (%current-system)) >+ (guile (default-guile))) >+ "Return a derivation that executes the G-expression that results >+from forcing GEXP-PROMISE=2E" >+ (mlet %store-monad ((guile (package->derivation guile system))) >+ (gexp->derivation (or name "computed-origin") >+ (force gexp-promise) >+ #:system system >+ #:guile-for-build guile))) >+ >+(define %chromium-version "72=2E0=2E3626=2E81") >+(define %ungoogled-revision >"f9b9074c322a67b04baf0982797cd7b7e09614b5") >+ >+;; This is a computed origin that does the following: >+;; 1) Runs the Ungoogled scripts on a pristine Chromium tarball=2E >+;; 2) Prunes all third_party folders that are not explicitly >preserved=2E >+;; 3) Adjusts "GN" build files such that system libraries are >preferred=2E >+(define ungoogled-chromium-source >+ (let* ((chromium-source >+ (origin >+ (method url-fetch) >+ (uri (string-append >"https://commondatastorage=2Egoogleapis=2Ecom" >+ "/chromium-browser-official/chromium-" >+ %chromium-version "=2Etar=2Exz")) >+ (sha256 >+ (base32 >+ =20 >"01l0vlvcckpag376mjld7qprv63l0z8li689k0h6v3h0i7irzs6z")))) >+ (ungoogled-source >+ (origin >+ (method git-fetch) >+ (uri (git-reference (url >"https://github=2Ecom/mbakke/ungoogled-chromium") >+ (commit %ungoogled-revision))) >+ (file-name (git-file-name "ungoogled-chromium" >+ (string-take %ungoogled-revision >7))) >+ (sha256 >+ (base32 >+ =20 >"0gmk1n3i7lbm7rw8zl4df171yhvrlimj8ksj096bf2dlfhbd44rb"))))) >+ >+ (origin >+ (method computed-origin-method) >+ (file-name (string-append "ungoogled-chromium-" >%chromium-version "=2Etar=2Exz")) >+ (sha256 #f) >+ (uri >+ (delay >+ (with-imported-modules '((guix build utils)) >+ #~(begin >+ (use-modules (guix build utils)) >+ (let ((chromium-dir (string-append "chromium-" >#$%chromium-version)) >+ (preserved-files (list >#$@%preserved-third-party-files))) >+ >+ (mkdir "/tmp/bin") >+ (set-path-environment-variable >+ "PATH" '("bin") >+ (list "/tmp" >+ #+(canonical-package patch) >+ #+(canonical-package xz) >+ #+(canonical-package tar) >+ #+python-2 >+ #+python)) >+ >+ (copy-recursively #+ungoogled-source >"/tmp/ungoogled") >+ >+ (with-directory-excursion "/tmp/ungoogled" >+ >+ (format #t "Unpacking chromium tarball=2E=2E=2E~%") >+ (force-output) >+ (invoke "tar" "xf" #+chromium-source) >+ >+ (format #t "Ungooglifying=2E=2E=2E~%") >+ (force-output) >+ (invoke "python3" "run_buildkit_cli=2Epy" "prune" >+ "-b" "config_bundles/guix" chromium-dir) >+ (invoke "python3" "run_buildkit_cli=2Epy" "patches" >"apply" >+ "-b" "config_bundles/guix" chromium-dir) >+ (invoke "python3" "run_buildkit_cli=2Epy" "domains" >"apply" >+ "-b" "config_bundles/linux_rooted" >+ "-c" "/tmp/domainscache=2Etar=2Egz" >chromium-dir) >+ >+ (with-directory-excursion chromium-dir >+ (format #t "Pruning third party files=2E=2E=2E~%") >+ (force-output) >+ (apply invoke "python" >+ =20 >"build/linux/unbundle/remove_bundled_libraries=2Epy" >+ "--do-remove" preserved-files) >+ >+ (format #t "Replacing GN files=2E=2E=2E~%") >+ (force-output) >+ (invoke "python3" >"build/linux/unbundle/replace_gn_files=2Epy" >+ "--system-libraries" "ffmpeg" "flac" >"fontconfig" >+ "freetype" "harfbuzz-ng" "icu" "libdrm" >"libevent" >+ "libjpeg" "libpng" "libvpx" "libwebp" >"libxml" >+ "libxslt" "openh264" "opus" "re2" >"snappy" "yasm" >+ "zlib")) >+ >+ (format #t (string-append "Packing new Ungoogled >tarball =2E=2E=2E~%")) >+ (force-output) >+ (invoke "tar" "cvfa" #$output >+ ;; Avoid non-determinism in the archive=2E >+ "--mtime=3D@0" >+ "--owner=3Droot:0" >+ "--group=3Droot:0" >+ "--sort=3Dname" >+ chromium-dir) >+ >+ #t))))))))) >+ >+(define opus+custom >+ (package/inherit opus >+ (name "opus+custom") >+ (arguments >+ (substitute-keyword-arguments (package-arguments opus) >+ ((#:configure-flags flags ''()) >+ ;; Opus Custom is an optional extension of the Opus >+ ;; specification that allows for unsupported frame >+ ;; sizes=2E Chromium requires that this is enabled=2E >+ `(cons "--enable-custom-modes" >+ ,flags)))))) >+ >+(define libvpx/chromium >+ ;; Chromium 66 and later requires an unreleased libvpx, so we take >the >+ ;; commit from "third_party/libvpx/README=2Echromium" in the tarball= =2E >+ (let ((version (package-version libvpx)) >+ (commit "e188b5435de71bcd602c378f1ac0441111f0f915") >+ (revision "0")) >+ (package/inherit libvpx >+ (name "libvpx-chromium") >+ (version (git-version version revision commit)) >+ (source (origin >+ (method git-fetch) >+ (uri (git-reference >+ (url >"https://chromium=2Egooglesource=2Ecom/webm/libvpx") >+ (commit commit))) >+ (file-name (git-file-name name version)) >+ (sha256 >+ (base32 >+ =20 >"0v7lzvgy45zh7zwzmmzkvbcqmhs4xa97z0h97hd3j6myrxcfz1n9"))))))) >+ >+;; Transitional package until HarfBuzz 2=2E2 is available in Guix master >branch=2E >+(define harfbuzz/chromium >+ (package/inherit harfbuzz >+ (version "2=2E2=2E0") >+ (source (origin >+ (inherit (package-source harfbuzz)) >+ (uri (string-append >"https://www=2Efreedesktop=2Eorg/software/harfbuzz" >+ "/release/harfbuzz-" version >"=2Etar=2Ebz2")) >+ (sha256 >+ (base32 >+ =20 >"047q63jr513azf3g1y7f5xn60b4jdjs9zsmrx04sfw5rasyzrk5p")))))) >+ >+(define-public ungoogled-chromium >+ (package >+ (name "ungoogled-chromium") >+ (version %chromium-version) >+ (synopsis "Graphical web browser") >+ (source ungoogled-chromium-source) >+ (build-system gnu-build-system) >+ (arguments >+ `(#:tests? #f >+ ;; FIXME: There is a "gn" option specifically for setting >-rpath, but >+ ;; it overrides the RUNPATH set by the linker=2E >+ #:validate-runpath? #f >+ #:modules ((guix build gnu-build-system) >+ (guix build utils) >+ (ice-9 ftw) >+ (ice-9 regex) >+ (srfi srfi-26)) >+ #:configure-flags >+ ;; See tools/gn/docs/cookbook=2Emd and >+ ;; https://www=2Echromium=2Eorg/developers/gn-build-configuration >+ ;; for usage=2E Run "=2E/gn args =2E --list" in the Release >+ ;; directory for an exhaustive list of supported flags=2E >+ ;; (Note: The 'configure' phase will do that for you=2E) >+ (list "is_debug=3Dfalse" >+ "use_gold=3Dfalse" >+ "use_lld=3Dfalse" >+ "linux_use_bundled_binutils=3Dfalse" >+ "use_custom_libcxx=3Dfalse" >+ "use_sysroot=3Dfalse" >+ "enable_precompiled_headers=3Dfalse" >+ "goma_dir=3D\"\"" >+ "enable_nacl=3Dfalse" >+ "enable_nacl_nonsfi=3Dfalse" >+ "use_allocator=3D\"none\"" ;don't use tcmalloc >+ "use_unofficial_version_number=3Dfalse" >+ >+ ;; Define a custom toolchain that simply looks up CC, AR >and >+ ;; friends from the environment=2E >+ =20 >"custom_toolchain=3D\"//build/toolchain/linux/unbundle:default\"" >+ =20 >"host_toolchain=3D\"//build/toolchain/linux/unbundle:default\"" >+ >+ ;; Don't assume it's clang=2E >+ "is_clang=3Dfalse" >+ >+ ;; Optimize for building everything at once, as opposed >to >+ ;; incrementally for development=2E See "docs/jumbo=2Emd"= =2E >+ "use_jumbo_build=3Dtrue" >+ >+ ;; Disable type-checking for the Web UI to avoid a Java >dependency=2E >+ "closure_compile=3Dfalse" >+ >+ ;; Disable debugging features to save space=2E >+ "blink_symbol_level=3D0" >+ "enable_iterator_debugging=3Dfalse" >+ >+ ;; Some of the unbundled libraries throws deprecation >+ ;; warnings, etc=2E Ignore it=2E >+ "treat_warnings_as_errors=3Dfalse" >+ >+ ;; Don't add any API keys=2E End users can set them in the >+ ;; environment if desired=2E See >+ ;; >=2E >+ "use_official_google_api_keys=3Dfalse" >+ >+ ;; Disable "safe browsing", which pulls in a dependency >on >+ ;; the nonfree "unrar" program (as of m66)=2E >+ "safe_browsing_mode=3D0" >+ >+ ;; Disable "field trials"=2E >+ "fieldtrial_testing_like_official_build=3Dtrue" >+ >+ ;; Ungoogled components=2E >+ "enable_mdns=3Dfalse" >+ "enable_one_click_signin=3Dfalse" >+ "enable_reading_list=3Dfalse" >+ "enable_remoting=3Dfalse" >+ "enable_reporting=3Dfalse" >+ "enable_service_discovery=3Dfalse" >+ "enable_swiftshader=3Dfalse" >+ "use_vaapi=3Dtrue" >+ >+ ;; Use system libraries where possible=2E >+ "use_system_freetype=3Dtrue" >+ "use_system_harfbuzz=3Dtrue" >+ "use_system_lcms2=3Dtrue" >+ "use_system_libdrm=3Dtrue" >+ "use_system_libjpeg=3Dtrue" >+ "use_system_libpng=3Dtrue" >+ ;;"use_system_libsync=3Dtrue" >+ "use_system_zlib=3Dtrue" >+ >+ "use_gnome_keyring=3Dfalse" ;deprecated by libsecret >+ "use_openh264=3Dtrue" >+ "use_pulseaudio=3Dtrue" >+ "link_pulseaudio=3Dtrue" >+ >+ ;; Don't arbitrarily restrict formats supported by system >ffmpeg=2E >+ "proprietary_codecs=3Dtrue" >+ "ffmpeg_branding=3D\"Chrome\"" >+ >+ ;; WebRTC stuff=2E >+ "rtc_use_h264=3Dtrue" >+ ;; Don't use bundled sources=2E >+ "rtc_build_json=3Dfalse" >+ "rtc_build_libevent=3Dfalse" >+ "rtc_build_libvpx=3Dfalse" >+ "rtc_build_opus=3Dfalse" >+ "rtc_build_ssl=3Dfalse" >+ >+ "rtc_build_libsrtp=3Dtrue" ;FIXME: fails to find headers >+ "rtc_build_usrsctp=3Dtrue" ;TODO: package this >+ (string-append "rtc_jsoncpp_root=3D\"" >+ (assoc-ref %build-inputs "jsoncpp") >+ "/include/jsoncpp/json\"") >+ (string-append "rtc_ssl_root=3D\"" >+ (assoc-ref %build-inputs "openssl") >+ "/include/openssl\"")) >+ #:phases >+ (modify-phases %standard-phases >+ (add-after 'unpack 'patch-stuff >+ (lambda* (#:key inputs #:allow-other-keys) >+ (substitute* "printing/cups_config_helper=2Epy" >+ (("cups_config =3D=2E*") >+ (string-append "cups_config =3D '" (assoc-ref inputs >"cups") >+ "/bin/cups-config'\n"))) >+ >+ (substitute* >+ '("base/process/launch_posix=2Ecc" >+ =20 >"base/third_party/dynamic_annotations/dynamic_annotations=2Ec" >+ "sandbox/linux/seccomp-bpf/sandbox_bpf=2Ecc" >+ "sandbox/linux/services/credentials=2Ecc" >+ "sandbox/linux/services/namespace_utils=2Ecc" >+ "sandbox/linux/services/syscall_wrappers=2Ecc" >+ "sandbox/linux/syscall_broker/broker_host=2Ecc") >+ (("include \"base/third_party/valgrind/") "include >\"valgrind/")) >+ >+ (for-each (lambda (file) >+ (substitute* file >+ ;; Fix opus include path=2E >+ ;; Do not substitute opus_private=2Eh=2E >+ (("#include \"opus\\=2Eh\"") >+ "#include \"opus/opus=2Eh\"") >+ (("#include \"opus_custom\\=2Eh\"") >+ "#include \"opus/opus_custom=2Eh\"") >+ (("#include \"opus_defines\\=2Eh\"") >+ "#include \"opus/opus_defines=2Eh\"") >+ (("#include \"opus_multistream\\=2Eh\"") >+ "#include \"opus/opus_multistream=2Eh\"") >+ (("#include \"opus_types\\=2Eh\"") >+ "#include \"opus/opus_types=2Eh\""))) >+ (find-files (string-append >"third_party/webrtc/modules" >+ =20 >"/audio_coding/codecs/opus"))) >+ >+ (substitute* "chrome/common/chrome_paths=2Ecc" >+ (("/usr/share/chromium/extensions") >+ ;; TODO: Add ~/=2Eguix-profile=2E >+ =20 >"/run/current-system/profile/share/chromium/extensions")) >+ >+ ;; XXX: Should be unnecessary when use_system_lcms2=3Dtrue= =2E >+ (substitute* >"third_party/pdfium/core/fxcodec/codec/ccodec_iccmodule=2Eh" >+ (("include \"third_party/lcms/include/lcms2\\=2Eh\"") >+ "include \"lcms2=2Eh\"")) >+ >+ (substitute* >+ =20 >"third_party/breakpad/breakpad/src/common/linux/libcurl_wrapper=2Eh" >+ (("include \"third_party/curl") "include \"curl")) >+ >+ (substitute* "third_party/webrtc/rtc_base/strings/json=2Eh" >+ (("#include \"third_party/jsoncpp/") "#include >\"json/")) >+ >+ (substitute* "media/base/decode_capabilities=2Ecc" >+ (("third_party/libvpx/source/libvpx/") "")) >+ >+ (substitute* "ui/gfx/skia_util=2Eh" >+ (("third_party/vulkan/include/") "")) >+ >+ ;; Building chromedriver embeds some files using the ZIP >+ ;; format which doesn't support timestamps before >+ ;; 1980=2E Therefore, advance the timestamps of the files >+ ;; which are included so that building chromedriver >+ ;; works=2E >+ (let ((circa-1980 (* 10 366 24 60 60))) >+ (for-each (lambda (file) >+ (utime file circa-1980 circa-1980)) >+ =20 >'("chrome/test/chromedriver/extension/background=2Ejs" >+ =20 >"chrome/test/chromedriver/extension/manifest=2Ejson"))) >+ >+ #t)) >+ (add-before 'configure 'prepare-build-environment >+ (lambda* (#:key inputs #:allow-other-keys) >+ >+ ;; Make sure the right build tools are used=2E >+ (setenv "AR" "ar") (setenv "NM" "nm") >+ (setenv "CC" "gcc") (setenv "CXX" "g++") >+ >+ ;; Work around =2E >+ (unsetenv "C_INCLUDE_PATH") >+ (unsetenv "CPLUS_INCLUDE_PATH") >+ >+ ;; TODO: pre-compile instead=2E Avoids a race condition=2E >+ (setenv "PYTHONDONTWRITEBYTECODE" "1") >+ >+ ;; XXX: How portable is this=2E >+ (mkdir-p "third_party/node/linux/node-linux-x64") >+ (symlink (string-append (assoc-ref inputs "node") "/bin") >+ "third_party/node/linux/node-linux-x64/bin") >+ >+ #t)) >+ (replace 'configure >+ (lambda* (#:key configure-flags #:allow-other-keys) >+ (let ((args (string-join configure-flags " "))) >+ ;; Generate ninja build files=2E >+ (invoke "gn" "gen" "out/Release" >+ (string-append "--args=3D" args)) >+ >+ ;; Print the full list of supported arguments as well >as >+ ;; their current status for convenience=2E >+ (format #t "Dumping configure flags=2E=2E=2E\n") >+ (invoke "gn" "args" "out/Release" "--list")))) >+ (replace 'build >+ (lambda* (#:key outputs #:allow-other-keys) >+ (invoke "ninja" "-C" "out/Release" >+ "-j" (number->string (parallel-job-count)) >+ "chrome" >+ "chromedriver"))) >+ (replace 'install >+ (lambda* (#:key inputs outputs #:allow-other-keys) >+ (let* ((out (assoc-ref outputs "out")) >+ (bin (string-append out "/bin")) >+ (exe (string-append bin "/chromium")) >+ (lib (string-append out "/lib")) >+ (man (string-append out >"/share/man/man1")) >+ (applications (string-append out >"/share/applications")) >+ (install-regexp (make-regexp "\\=2E(bin|pak)$")) >+ (locales (string-append lib "/locales")) >+ (resources (string-append lib "/resources")) >+ (preferences (assoc-ref inputs >"master-preferences")) >+ (gtk+ (assoc-ref inputs "gtk+")) >+ (mesa (assoc-ref inputs "mesa")) >+ (nss (assoc-ref inputs "nss")) >+ (udev (assoc-ref inputs "udev")) >+ (sh (which "sh"))) >+ >+ (substitute* '("chrome/app/resources/manpage=2E1=2Ein" >+ =20 >"chrome/installer/linux/common/desktop=2Etemplate") >+ (("@@MENUNAME@@") "Chromium") >+ (("@@PACKAGE@@") "chromium") >+ (("/usr/bin/@@USR_BIN_SYMLINK_NAME@@") exe)) >+ >+ (mkdir-p man) >+ (copy-file "chrome/app/resources/manpage=2E1=2Ein" >+ (string-append man "/chromium=2E1")) >+ >+ (mkdir-p applications) >+ (copy-file >"chrome/installer/linux/common/desktop=2Etemplate" >+ (string-append applications >"/chromium=2Edesktop")) >+ >+ (mkdir-p lib) >+ (copy-file preferences (string-append lib >"/master_preferences")) >+ >+ (with-directory-excursion "out/Release" >+ (for-each (lambda (file) >+ (install-file file lib)) >+ (scandir "=2E" (cut regexp-exec >install-regexp <>))) >+ (copy-file "chrome" (string-append lib "/chromium")) >+ >+ ;; TODO: Install icons from "=2E=2E/=2E=2E/chrome/app/t= hemes" >into >+ ;; "out/share/icons/hicolor/$size"=2E >+ (install-file >+ "product_logo_48=2Epng" >+ (string-append out >"/share/icons/48x48/chromium=2Epng")) >+ >+ (copy-recursively "locales" locales) >+ (copy-recursively "resources" resources) >+ >+ (mkdir-p bin) >+ (symlink "=2E=2E/lib/chromium" exe) >+ (install-file "chromedriver" bin) >+ >+ (wrap-program exe >+ ;; TODO: Get these in RUNPATH=2E >+ `("LD_LIBRARY_PATH" ":" prefix >+ (,(string-append lib ":" nss "/lib/nss:" gtk+ >"/lib:" >+ mesa "/lib:" udev "/lib"))) >+ ;; Avoid file manager crash=2E See >=2E >+ `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ >"/share")))) >+ #t))))))) >+ (native-inputs >+ `(("bison" ,bison) >+ ("gcc" ,gcc-8) >+ ("gn" ,gn) >+ ("gperf" ,gperf) >+ ("ninja" ,ninja) >+ ("node" ,node) >+ ("pkg-config" ,pkg-config) >+ ("which" ,which) >+ ("yasm" ,yasm) >+ >+ ;; This file contains defaults for new user profiles=2E >+ ("master-preferences" ,(local-file >"aux-files/chromium/master-preferences=2Ejson")) >+ >+ ("python-beautifulsoup4" ,python2-beautifulsoup4) >+ ("python-html5lib" ,python2-html5lib) >+ ("python" ,python-2))) >+ (inputs >+ `(("alsa-lib" ,alsa-lib) >+ ("atk" ,atk) >+ ("cups" ,cups) >+ ("curl" ,curl) >+ ("dbus" ,dbus) >+ ("dbus-glib" ,dbus-glib) >+ ("expat" ,expat) >+ ("flac" ,flac) >+ ("ffmpeg" ,ffmpeg) >+ ("fontconfig" ,fontconfig) >+ ("freetype" ,freetype) >+ ("gdk-pixbuf" ,gdk-pixbuf) >+ ("glib" ,glib) >+ ("gtk+" ,gtk+) >+ ("harfbuzz" ,harfbuzz/chromium) >+ ("icu4c" ,icu4c) >+ ("jsoncpp" ,jsoncpp) >+ ("lcms" ,lcms) >+ ("libevent" ,libevent) >+ ("libffi" ,libffi) >+ ("libjpeg-turbo" ,libjpeg-turbo) >+ ("libpng" ,libpng) >+ ("libva" ,libva) >+ ("libvpx" ,libvpx/chromium) >+ ("libwebp" ,libwebp) >+ ("libx11" ,libx11) >+ ("libxcb" ,libxcb) >+ ("libxcomposite" ,libxcomposite) >+ ("libxcursor" ,libxcursor) >+ ("libxdamage" ,libxdamage) >+ ("libxext" ,libxext) >+ ("libxfixes" ,libxfixes) >+ ("libxi" ,libxi) >+ ("libxml2" ,libxml2) >+ ("libxrandr" ,libxrandr) >+ ("libxrender" ,libxrender) >+ ("libxscrnsaver" ,libxscrnsaver) >+ ("libxslt" ,libxslt) >+ ("libxtst" ,libxtst) >+ ("mesa" ,mesa) >+ ("minizip" ,minizip) >+ ("mit-krb5" ,mit-krb5) >+ ("nss" ,nss) >+ ("openh264" ,openh264) >+ ("openjpeg" ,openjpeg) ;PDFium only >+ ("openssl" ,openssl) >+ ("opus" ,opus+custom) >+ ("pango" ,pango) >+ ("pciutils" ,pciutils) >+ ("pulseaudio" ,pulseaudio) >+ ("re2" ,re2) >+ ("snappy" ,snappy) >+ ("speech-dispatcher" ,speech-dispatcher) >+ ("udev" ,eudev) >+ ("valgrind" ,valgrind) >+ ("vulkan-headers" ,vulkan-headers))) >+ (home-page "https://www=2Echromium=2Eorg/") >+ (description >+ "Ungoogled-Chromium is the Chromium web browser, sans integration >with >+Google web services=2E") >+ ;; Chromium is developed as BSD-3, but bundles a large number of >third-party >+ ;; components with other licenses=2E For full information, see >chrome://credits=2E >+ (license (list license:bsd-3 >+ license:bsd-2 >+ license:expat >+ license:asl2=2E0 >+ license:mpl1=2E1 >+ license:mpl2=2E0 >+ license:public-domain >+ license:isc >+ (license:non-copyleft "chrome://credits" >+ "See chrome://credits for >more information=2E") >+ license:lgpl2=2E1+)))) >--=20 >2=2E20=2E1 Wow=2E=20 Nice work! =F0=9F=98=83 --=20 Sent from my k-9 mail for Android=2E ------OLEBV8UXLOH3TYKFR6Q74PQLQ3834I Content-Type: text/html; charset=utf-8 Content-Transfer-Encoding: quoted-printable
Marius Bakke <mbakke= @fastmail=2Ecom> skrev: (2 februari 2019 20:20:23 CET)
Thanks to Marks beautiful "computed-origin-method", =
Ungoogled-Chromium
is finally ready for inclusion in Guix=2E

Feat= ures:
* Chromium 72=2E
* No unsolicited network traffic=2E
* Free = software only=2E
* No DRM=2E
* Not an April Fools joke=2E

It's= currently using my trivial "fork" of Ungoogled-Chromium[0], which
will = be upstreamed once the upstream reorganization[1] is done=2E

Comment= s appreciated!

[0]: https://github= =2Ecom/mbakke/ungoogled-chromium/commit/f9b9074c322a67b04baf0982797cd7b7e09= 614b5
[1]: https://github=2Ecom/Eloston/ungoogled-chromium/issues/651

* gnu/packages/aux-files/chromium/master-preferences=2Ejson,
gn= u/packages/chromium=2Escm: New files=2E
* gnu/local=2Emk (GNU_SYSTEM_MOD= ULES): Adjust accordingly=2E
gnu/local=2Emk = | 1 +
=2E=2E=2E/chromium/master-preferences=2Ejson | = 26 +
gnu/packages/chromium=2Escm | 741 ++++++++++++= ++++++
3 files changed, 768 insertions(+)
create mode 100644 gnu/pa= ckages/aux-files/chromium/master-preferences=2Ejson
create mode 100644 = gnu/packages/chromium=2Escm

diff --git a/gnu/local=2Emk b/gnu/local= =2Emk
index 82db1488d6=2E=2Eb5e937cdd7 100644
--- a/gnu/local=2Emk+++ b/gnu/local=2Emk
@@ -100,6 +100,7 @@ GNU_SYSTEM_MODULES =3D \ %D%/packages/check=2Escm \
%D%/packages/chemistry=2Escm \
= %D%/packages/chez=2Escm \
+ %D%/packages/chromium=2Escm \
= %D%/packages/ci=2Escm \
%D%/packages/cinnamon=2Escm \
%D%= /packages/clojure=2Escm \
diff --git a/gnu/packages/aux-files/chromium= /master-preferences=2Ejson b/gnu/packages/aux-files/chromium/master-prefere= nces=2Ejson
new file mode 100644
index 0000000000=2E=2E0caa7cc4cd
= --- /dev/null
+++ b/gnu/packages/aux-files/chromium/master-preferences= =2Ejson
@@ -0,0 +1,26 @@
+{
+ "distribution": {
+ "import_= bookmarks": false,
+ "make_chrome_default": false,
+ "make_ch= rome_default_for_user": false,
+ "verbose_logging": true,
+ "= skip_first_run_ui": true,
+ "suppress_first_run_default_browser_prom= pt": true
+ },
+ "browser": {
+ "has_seen_welcome_page" : tr= ue,
+ "check_default_browser" : false
+ },
+ "dns_prefetchin= g": {
+ "enabled": false
+ },
+ "alternate_error_pages": {+ "enabled": false
+ },
+ "hardware": {
+ "audio_capture_= enabled": false
+ },
+ "default_apps": "noinstall",
+ "hide_web= _store_icon": true,
+ "homepage": "https://www=2Egnu=2Eorg/software/gui= x"
+}
diff --git a/gnu/packages/chromium=2Escm b/gnu/packages/chromiu= m=2Escm
new file mode 100644
index 0000000000=2E=2Eeb404246d3
--- = /dev/null
+++ b/gnu/packages/chromium=2Escm
@@ -0,0 +1,741 @@
+;;;= GNU Guix --- Functional package management for GNU
+;;; Copyright =C2= =A9 2019 Marius Bakke <mbakke@fastmail=2Ecom>
+;;;
+;;; GNU Gui= x is free software; you can redistribute it and/or modify it
+;;; under = the terms of the GNU General Public License as published by
+;;; the Fre= e Software Foundation; either version 3 of the License, or (at
+;;; your= option) any later version=2E
+;;;
+;;; GNU Guix is distributed in th= e hope that it will be useful, but
+;;; WITHOUT ANY WARRANTY; without ev= en the implied warranty of
+;;; MERCHANTABILITY or FITNESS FOR A PARTICU= LAR PURPOSE=2E See the
+;;; GNU General Public License for more details= =2E
+;;;
+;;; You should have received a copy of the GNU General Publ= ic License
+;;; along with GNU Guix=2E If not, see <
http://www=2Egnu=2Eorg/licenses/>=2E+
+(define-module (gnu packages chromium)
+ #:use-module ((guix lic= enses) #:prefix license:)
+ #:use-module (guix packages)
+ #:use-mo= dule (guix gexp)
+ #:use-module (guix store)
+ #:use-module (guix m= onads)
+ #:use-module (guix download)
+ #:use-module (guix git-down= load)
+ #:use-module (guix utils)
+ #:use-module (guix build-system= gnu)
+ #:use-module (gnu packages)
+ #:use-module (gnu packages as= sembly)
+ #:use-module (gnu packages base)
+ #:use-module (gnu pack= ages bison)
+ #:use-module (gnu packages build-tools)
+ #:use-modul= e (gnu packages compression)
+ #:use-module (gnu packages cups)
+ #= :use-module (gnu packages curl)
+ #:use-module (gnu packages fontutils)=
+ #:use-module (gnu packages gcc)
+ #:use-module (gnu packages gho= stscript)
+ #:use-module (gnu packages gl)
+ #:use-module (gnu pack= ages glib)
+ #:use-module (gnu packages gnome)
+ #:use-module (gnu = packages gnuzilla)
+ #:use-module (gnu packages gperf)
+ #:use-modu= le (gnu packages gtk)
+ #:use-module (gnu packages icu4c)
+ #:use-m= odule (gnu packages image)
+ #:use-module (gnu packages libevent)
+ = #:use-module (gnu packages libffi)
+ #:use-module (gnu packages linux)=
+ #:use-module (gnu packages kerberos)
+ #:use-module (gnu package= s ninja)
+ #:use-module (gnu packages node)
+ #:use-module (gnu pac= kages pciutils)
+ #:use-module (gnu packages pkg-config)
+ #:use-mo= dule (gnu packages pulseaudio)
+ #:use-module (gnu packages python)
= + #:use-module (gnu packages python-web)
+ #:use-module (gnu packages = python-xyz)
+ #:use-module (gnu packages regex)
+ #:use-module (gnu= packages serialization)
+ #:use-module (gnu packages speech)
+ #:u= se-module (gnu packages tls)
+ #:use-module (gnu packages valgrind)
= + #:use-module (gnu packages vulkan)
+ #:use-module (gnu packages vide= o)
+ #:use-module (gnu packages xiph)
+ #:use-module (gnu packages = xml)
+ #:use-module (gnu packages xdisorg)
+ #:use-module (gnu pack= ages xorg))
+
+(define %preserved-third-party-files
+ '("base/thi= rd_party/dmg_fp" ;X11-style
+ "base/third_party/dynamic_annotations" = ;BSD-2
+ "base/third_party/icu" ;Unicode, X11-style
+ "base/thi= rd_party/superfasthash" ;BSD-3
+ "base/third_party/symbolize" ;BSD-3<= br>+ "base/third_party/xdg_mime" ;LGPL2=2E1+ or Academic 2=2E0
+ "= base/third_party/xdg_user_dirs" ;Expat
+ "chrome/third_party/mozilla_= security_manager" ;MPL-1=2E1/GPL2+/LGPL2=2E1+
+ "courgette/third_part= y/bsdiff" ;BSD-2, BSD protection license
+ "courgette/third_party/div= sufsort" ;Expat
+ "net/third_party/http2" ;BSD-3
+ "net/third_p= arty/mozilla_security_manager" ;MPL-1=2E1/GPL2+/LGPL2=2E1+
+ "net/thi= rd_party/nss" ;MPL-2=2E0
+ "net/third_party/quic" ;BSD-3
+ "net= /third_party/spdy" ;BSD-3
+ "net/third_party/uri_template" ;ASL2=2E0<= br>+ "third_party/abseil-cpp" ;ASL2=2E0
+ "third_party/adobe/flash= /flapper_version=2Eh" ;no license, trivial
+ "third_party/angle" ;BSD= -3
+ "third_party/angle/src/common/third_party/base" ;BSD-3
+ "= third_party/angle/src/common/third_party/smhasher" ;Public domain
+ "= third_party/angle/src/common/third_party/xxhash" ;BSD-2
+ "third_part= y/angle/src/third_party/compiler" ;BSD-2
+ "third_party/angle/src/thi= rd_party/libXNVCtrl" ;Expat
+ "third_party/angle/src/third_party/trac= e_event" ;BSD-3
+ "third_party/angle/third_party/glslang" ;BSD-3
+= "third_party/angle/third_party/spirv-headers" ;Expat
+ "third_par= ty/angle/third_party/spirv-tools" ;Expat
+ "third_party/angle/third_p= arty/vulkan-headers" ;ASL2=2E0
+ "third_party/angle/third_party/vulka= n-loader" ;ASL2=2E0
+ "third_party/angle/third_party/vulkan-tools" ;A= SL2=2E0
+ "third_party/angle/third_party/vulkan-validation-layers" ;A= SL2=2E0
+ "third_party/apple_apsl" ;APSL2=2E0
+ "third_party/bl= ink" ;BSD-3
+ "third_party/boringssl" ;OpenSSL/ISC (Google additions = are ISC)
+ "third_party/boringssl/src/third_party/fiat" ;Expat
+ = "third_party/breakpad" ;BSD-3
+ "third_party/brotli" ;Expat
+ = "third_party/cacheinvalidation" ;ASL2=2E0
+ "third_party/catapult" ;= BSD-3
+ "third_party/catapult/common/py_vulcanize/third_party/rcssmin= " ;ASL2=2E0
+ "third_party/catapult/common/py_vulcanize/third_party/r= jsmin" ;ASL2=2E0
+ "third_party/catapult/third_party/polymer" ;BSD-3<= br>+ "third_party/catapult/tracing/third_party/d3" ;BSD-3
+ "third= _party/catapult/tracing/third_party/gl-matrix" ;Expat
+ "third_party/= catapult/tracing/third_party/jszip" ;Expat or GPL3
+ "third_party/cat= apult/tracing/third_party/mannwhitneyu" ;Expat
+ "third_party/catapul= t/tracing/third_party/oboe" ;BSD-2
+ "third_party/catapult/tracing/th= ird_party/pako" ;Expat
+ "third_party/ced" ;BSD-3
+ "third_part= y/cld_3" ;ASL2=2E0
+ "third_party/closure_compiler" ;ASL2=2E0
+ = "third_party/crashpad" ;ASL2=2E0
+ "third_party/crashpad/crashpad/th= ird_party/zlib/zlib_crashpad=2Eh" ;Zlib
+ "third_party/crc32c" ;BSD-3=
+ "third_party/cros_system_api" ;BSD-3
+ "third_party/dom_dist= iller_js" ;BSD-3
+ "third_party/fips181" ;BSD-3
+ "third_party/= flatbuffers" ;ASL2=2E0
+ "third_party/google_input_tools" ;ASL2=2E0+ "third_party/google_input_tools/third_party/closure_library" ;ASL2= =2E0
+ "third_party/google_input_tools/third_party/closure_library/th= ird_party/closure" ;Expat
+ "third_party/googletest" ;BSD-3
+ "= third_party/hunspell" ;MPL1=2E1/GPL2+/LGPL2=2E1+
+ "third_party/iccjp= eg" ;IJG
+ "third_party/inspector_protocol" ;BSD-3
+ "third_par= ty/jinja2" ;BSD-3
+ "third_party/jstemplate" ;ASL2=2E0
+ "third= _party/khronos" ;Expat, SGI
+ "third_party/leveldatabase" ;BSD-3
+= "third_party/libXNVCtrl" ;Expat
+ "third_party/libaddressinput" ;= ASL2=2E0
+ "third_party/libaom" ;BSD-2 or "Alliance for Open Media Pa= tent License 1=2E0"
+ "third_party/libaom/source/libaom/third_party/v= ector" ;Expat
+ "third_party/libaom/source/libaom/third_party/x86inc"= ;ISC
+ "third_party/libjingle_xmpp" ;BSD-3
+ "third_party/libp= honenumber" ;ASL2=2E0
+ "third_party/libsecret" ;LGPL2=2E1+
+ "= third_party/libsrtp" ;BSD-3
+ "third_party/libsync" ;ASL2=2E0
+ = "third_party/libudev" ;LGPL2=2E1+
+ "third_party/libwebm" ;BSD-3
= + "third_party/libxml/chromium" ;BSD-3
+ "third_party/libyuv" ;BSD= -3
+ "third_party/lss" ;BSD-3
+ "third_party/markupsafe" ;BSD-3=
+ "third_party/mesa_headers" ;Expat, SGI
+ "third_party/metric= s_proto" ;BSD-3
+ "third_party/modp_b64" ;BSD-3
+ "third_party/= nasm" ;BSD-2
+ "third_party/node" ;Expat
+ "third_party/node/no= de_modules/polymer-bundler/lib/third_party/UglifyJS2" ;BSD-2
+ "third= _party/ots" ;BSD-3
+ "third_party/pdfium" ;BSD-3
+ "third_party= /pdfium/third_party/agg23" ;Expat
+ "third_party/pdfium/third_party/b= ase" ;BSD-3
+ "third_party/pdfium/third_party/bigint" ;Public domain,= BSD-3
+ "third_party/pdfium/third_party/skia_shared" ;BSD-3
+ = "third_party/pdfium/third_party/freetype/include/pstables=2Eh" ;FreeType+ "third_party/ply" ;BSD-3
+ "third_party/polymer" ;BSD-3
+ = "third_party/protobuf" ;BSD-3
+ "third_party/protobuf/third_party/si= x" ;Expat
+ "third_party/pyjson5" ;ASL2=2E0
+ "third_party/qcms= " ;Expat
+ "third_party/rnnoise" ;BSD-3
+ "third_party/s2cellid= " ;ASL2=2E0
+ "third_party/sfntly" ;ASL2=2E0
+ "third_party/ski= a" ;BSD-3
+ "third_party/skia/third_party/gif" ;MPL1=2E1/GPL2+/LGPL2= =2E1+
+ "third_party/skia/third_party/skcms" ;BSD-3
+ "third_pa= rty/skia/third_party/vulkan" ;BSD-3
+ "third_party/smhasher" ;Expat, = public domain
+ "third_party/speech-dispatcher" ;GPL2+
+ "third= _party/spirv-headers" ;ASL2=2E0
+ "third_party/SPIRV-Tools" ;ASL2=2E0=
+ "third_party/sqlite" ;Public domain
+ "third_party/ungoogled= " ;BSD-3
+ "third_party/usb_ids" ;BSD-3
+ "third_party/usrsctp"= ;BSD-2
+ "third_party/web-animations-js" ;ASL2=2E0
+ "third_pa= rty/webdriver" ;ASL2=2E0
+ "third_party/webrtc" ;BSD-3
+ "third= _party/webrtc/common_audio/third_party/fft4g" ;Non-copyleft
+ "third_= party/webrtc/common_audio/third_party/spl_sqrt_floor" ;Public domain
+ = "third_party/webrtc/modules/third_party/fft" ;Non-copyleft
+ "third= _party/webrtc/modules/third_party/g711" ;Public domain
+ "third_party= /webrtc/modules/third_party/g722" ;Public domain
+ "third_party/webrt= c/rtc_base/third_party/base64" ;Non-copyleft
+ "third_party/webrtc/rt= c_base/third_party/sigslot" ;Public domain
+ "third_party/widevine/cd= m/widevine_cdm_version=2Eh" ;BSD-3
+ "third_party/widevine/cdm/widevi= ne_cdm_common=2Eh" ;BSD-3
+ "third_party/woff2" ;ASL2=2E0
+ "th= ird_party/xdg-utils" ;Expat
+ "third_party/yasm/run_yasm=2Epy" ;BSD-2= or BSD-3
+ "third_party/zlib/google" ;BSD-3
+ "url/third_party= /mozilla" ;BSD-3, MPL1=2E1/GPL2+/LGPL2=2E1+
+ "v8/src/third_party/utf= 8-decoder" ;Expat
+ "v8/src/third_party/valgrind" ;BSD-4
+ "v8/= third_party/inspector_protocol" ;BSD-3
+ "v8/third_party/v8/builtins"= )) ;PSFL
+
+(define* (computed-origin-method gexp-promise hash-algo h= ash
+ #:optional (name "source")
+ = #:key (system (%current-system))
+ = (guile (default-guile)))
+ "Return a derivatio= n that executes the G-expression that results
+from forcing GEXP-PROMISE= =2E"
+ (mlet %store-monad ((guile (package->derivation guile system)= ))
+ (gexp->derivation (or name "computed-origin")
+ = (force gexp-promise)
+ #:system system+ #:guile-for-build guile)))
+
+(define %chrom= ium-version "72=2E0=2E3626=2E81")
+(define %ungoogled-revision "f9b9074c= 322a67b04baf0982797cd7b7e09614b5")
+
+;; This is a computed origin th= at does the following:
+;; 1) Runs the Ungoogled scripts on a pristine C= hromium tarball=2E
+;; 2) Prunes all third_party folders that are not ex= plicitly preserved=2E
+;; 3) Adjusts "GN" build files such that system l= ibraries are preferred=2E
+(define ungoogled-chromium-source
+ (let*= ((chromium-source
+ (origin
+ (method url-fetch)=
+ (uri (string-append "https://commondatastorage=2Egoogleapi= s=2Ecom"
+ "/chromium-browser-official/ch= romium-"
+ %chromium-version "=2Etar=2Exz= "))
+ (sha256
+ (base32
+ "01l= 0vlvcckpag376mjld7qprv63l0z8li689k0h6v3h0i7irzs6z"))))
+ (ungoog= led-source
+ (origin
+ (method git-fetch)
+ = (uri (git-reference (url "https://github=2Ecom/mbakke/ungoogled-ch= romium")
+ (commit %ungoogled-revision)))=
+ (file-name (git-file-name "ungoogled-chromium"
+ = (string-take %ungoogled-revision 7)))
+ = (sha256
+ (base32
+ "0gmk1n3i7lbm7= rw8zl4df171yhvrlimj8ksj096bf2dlfhbd44rb")))))
+
+ (origin
+ = (method computed-origin-method)
+ (file-name (string-append "ungo= ogled-chromium-" %chromium-version "=2Etar=2Exz"))
+ (sha256 #f)+ (uri
+ (delay
+ (with-imported-modules '((guix = build utils))
+ #~(begin
+ (use-modules (guix= build utils))
+ (let ((chromium-dir (string-append "ch= romium-" #$%chromium-version))
+ (preserved-files (l= ist #$@%preserved-third-party-files)))
+
+ (mkdir "/t= mp/bin")
+ (set-path-environment-variable
+ = "PATH" '("bin")
+ (list "/tmp"
+ = #+(canonical-package patch)
+ #+(cano= nical-package xz)
+ #+(canonical-package tar)
= + #+python-2
+ #+python))<= br>+
+ (copy-recursively #+ungoogled-source "/tmp/ungoog= led")
+
+ (with-directory-excursion "/tmp/ungoogled"<= br>+
+ (format #t "Unpacking chromium tarball=2E=2E=2E= ~%")
+ (force-output)
+ (invoke "= tar" "xf" #+chromium-source)
+
+ (format #t "Ungoog= lifying=2E=2E=2E~%")
+ (force-output)
+ = (invoke "python3" "run_buildkit_cli=2Epy" "prune"
+ = "-b" "config_bundles/guix" chromium-dir)
+ = (invoke "python3" "run_buildkit_cli=2Epy" "patches" "apply"
+ = "-b" "config_bundles/guix" chromium-dir)
+ = (invoke "python3" "run_buildkit_cli=2Epy" "domains" "apply"
+ = "-b" "config_bundles/linux_rooted"
+ = "-c" "/tmp/domainscache=2Etar=2Egz" chromium-dir)
+
+ = (with-directory-excursion chromium-dir
+ = (format #t "Pruning third party files=2E=2E=2E~%")
+ = (force-output)
+ (apply invoke "python"
+ = "build/linux/unbundle/remove_bundled_libraries= =2Epy"
+ "--do-remove" preserved-files)
+=
+ (format #t "Replacing GN files=2E=2E=2E~%")
+ = (force-output)
+ (invoke "python= 3" "build/linux/unbundle/replace_gn_files=2Epy"
+ = "--system-libraries" "ffmpeg" "flac" "fontconfig"
+ = "freetype" "harfbuzz-ng" "icu" "libdrm" "libevent"
+ = "libjpeg" "libpng" "libvpx" "libwebp" "libxml"
+ = "libxslt" "openh264" "opus" "re2" "snappy" "yas= m"
+ "zlib"))
+
+ (f= ormat #t (string-append "Packing new Ungoogled tarball =2E=2E=2E~%"))
+ = (force-output)
+ (invoke "tar" "cvfa= " #$output
+ ;; Avoid non-determinism in the a= rchive=2E
+ "--mtime=3D@0"
+ = "--owner=3Droot:0"
+ "--group=3Dro= ot:0"
+ "--sort=3Dname"
+ = chromium-dir)
+
+ #t)))))))))
+
+(de= fine opus+custom
+ (package/inherit opus
+ (name "opus+custom")+ (arguments
+ (substitute-keyword-arguments (package-arguments= opus)
+ ((#:configure-flags flags ''())
+ ;; Opus Custo= m is an optional extension of the Opus
+ ;; specification that al= lows for unsupported frame
+ ;; sizes=2E Chromium requires that = this is enabled=2E
+ `(cons "--enable-custom-modes"
+ = ,flags))))))
+
+(define libvpx/chromium
+ ;; Chromium 66 an= d later requires an unreleased libvpx, so we take the
+ ;; commit from = "third_party/libvpx/README=2Echromium" in the tarball=2E
+ (let ((versi= on (package-version libvpx))
+ (commit "e188b5435de71bcd602c378f1= ac0441111f0f915")
+ (revision "0"))
+ (package/inherit libv= px
+ (name "libvpx-chromium")
+ (version (git-version versi= on revision commit))
+ (source (origin
+ (method = git-fetch)
+ (uri (git-reference
+ = (url "https://chromium=2Egooglesource=2Ecom/webm/libvpx")
+ = (commit commit)))
+ (file-name (git-file-name = name version))
+ (sha256
+ (base32
= + "0v7lzvgy45zh7zwzmmzkvbcqmhs4xa97z0h97hd3j6myrxcfz1n9"))= )))))
+
+;; Transitional package until HarfBuzz 2=2E2 is available in= Guix master branch=2E
+(define harfbuzz/chromium
+ (package/inherit= harfbuzz
+ (version "2=2E2=2E0")
+ (source (origin
+ = (inherit (package-source harfbuzz))
+ (uri (string-a= ppend "https://www=2Efreedesktop=2Eorg/software/harfbuzz"
+ = "/release/harfbuzz-" version "=2Etar=2Ebz2"))
+ = (sha256
+ (base32
+ "047q63jr5= 13azf3g1y7f5xn60b4jdjs9zsmrx04sfw5rasyzrk5p"))))))
+
+(define-public = ungoogled-chromium
+ (package
+ (name "ungoogled-chromium")
+ = (version %chromium-version)
+ (synopsis "Graphical web browser")+ (source ungoogled-chromium-source)
+ (build-system gnu-build-s= ystem)
+ (arguments
+ `(#:tests? #f
+ ;; FIXME: There= is a "gn" option specifically for setting -rpath, but
+ ;; it ove= rrides the RUNPATH set by the linker=2E
+ #:validate-runpath? #f+ #:modules ((guix build gnu-build-system)
+ (g= uix build utils)
+ (ice-9 ftw)
+ (i= ce-9 regex)
+ (srfi srfi-26))
+ #:configure-fl= ags
+ ;; See tools/gn/docs/cookbook=2Emd and
+ ;; https:/= /www=2Echromium=2Eorg/developers/gn-build-configuration
+ ;; f= or usage=2E Run "=2E/gn args =2E --list" in the Release
+ ;; dire= ctory for an exhaustive list of supported flags=2E
+ ;; (Note: The= 'configure' phase will do that for you=2E)
+ (list "is_debug=3Dfa= lse"
+ "use_gold=3Dfalse"
+ "use_lld=3Dfalse"=
+ "linux_use_bundled_binutils=3Dfalse"
+ "us= e_custom_libcxx=3Dfalse"
+ "use_sysroot=3Dfalse"
+ = "enable_precompiled_headers=3Dfalse"
+ "goma_dir=3D\"\= ""
+ "enable_nacl=3Dfalse"
+ "enable_nacl_non= sfi=3Dfalse"
+ "use_allocator=3D\"none\"" ;don't use tcmal= loc
+ "use_unofficial_version_number=3Dfalse"
+
+ = ;; Define a custom toolchain that simply looks up CC, AR and
+ = ;; friends from the environment=2E
+ "custom_tool= chain=3D\"//build/toolchain/linux/unbundle:default\""
+ "hos= t_toolchain=3D\"//build/toolchain/linux/unbundle:default\""
+
+ = ;; Don't assume it's clang=2E
+ "is_clang=3Dfalse"+
+ ;; Optimize for building everything at once, as opposed= to
+ ;; incrementally for development=2E See "docs/jumbo= =2Emd"=2E
+ "use_jumbo_build=3Dtrue"
+
+ ;= ; Disable type-checking for the Web UI to avoid a Java dependency=2E
+ = "closure_compile=3Dfalse"
+
+ ;; Disable debug= ging features to save space=2E
+ "blink_symbol_level=3D0"+ "enable_iterator_debugging=3Dfalse"
+
+ ;;= Some of the unbundled libraries throws deprecation
+ ;; war= nings, etc=2E Ignore it=2E
+ "treat_warnings_as_errors=3Dfa= lse"
+
+ ;; Don't add any API keys=2E End users can set = them in the
+ ;; environment if desired=2E See
+ = ;; <https://www=2Echromium=2Eorg/developers/how-tos/api-keys>=2E+ "use_official_google_api_keys=3Dfalse"
+
+ = ;; Disable "safe browsing", which pulls in a dependency on
+ = ;; the nonfree "unrar" program (as of m66)=2E
+ "safe_bro= wsing_mode=3D0"
+
+ ;; Disable "field trials"=2E
+ = "fieldtrial_testing_like_official_build=3Dtrue"
+
+ = ;; Ungoogled components=2E
+ "enable_mdns=3Dfalse"
+ = "enable_one_click_signin=3Dfalse"
+ "enable_read= ing_list=3Dfalse"
+ "enable_remoting=3Dfalse"
+ = "enable_reporting=3Dfalse"
+ "enable_service_discovery=3D= false"
+ "enable_swiftshader=3Dfalse"
+ "use_= vaapi=3Dtrue"
+
+ ;; Use system libraries where possible= =2E
+ "use_system_freetype=3Dtrue"
+ "use_sys= tem_harfbuzz=3Dtrue"
+ "use_system_lcms2=3Dtrue"
+ = "use_system_libdrm=3Dtrue"
+ "use_system_libjpeg=3Dtru= e"
+ "use_system_libpng=3Dtrue"
+ ;;"use_syst= em_libsync=3Dtrue"
+ "use_system_zlib=3Dtrue"
+
+ = "use_gnome_keyring=3Dfalse" ;deprecated by libsecret
+ = "use_openh264=3Dtrue"
+ "use_pulseaudio=3Dtrue"
+ = "link_pulseaudio=3Dtrue"
+
+ ;; Don't arbitraril= y restrict formats supported by system ffmpeg=2E
+ "propriet= ary_codecs=3Dtrue"
+ "ffmpeg_branding=3D\"Chrome\""
+
= + ;; WebRTC stuff=2E
+ "rtc_use_h264=3Dtrue"
= + ;; Don't use bundled sources=2E
+ "rtc_build_j= son=3Dfalse"
+ "rtc_build_libevent=3Dfalse"
+ = "rtc_build_libvpx=3Dfalse"
+ "rtc_build_opus=3Dfalse"
+ = "rtc_build_ssl=3Dfalse"
+
+ "rtc_build_libsrt= p=3Dtrue" ;FIXME: fails to find headers
+ "rtc_build_usrsc= tp=3Dtrue" ;TODO: package this
+ (string-append "rtc_jsonc= pp_root=3D\""
+ (assoc-ref %build-inputs "jso= ncpp")
+ "/include/jsoncpp/json\"")
+ = (string-append "rtc_ssl_root=3D\""
+ = (assoc-ref %build-inputs "openssl")
+ "/inclu= de/openssl\""))
+ #:phases
+ (modify-phases %standard-pha= ses
+ (add-after 'unpack 'patch-stuff
+ (lambda* (#= :key inputs #:allow-other-keys)
+ (substitute* "printing/cup= s_config_helper=2Epy"
+ (("cups_config =3D=2E*")
+ = (string-append "cups_config =3D '" (assoc-ref inputs "cups")
= + "/bin/cups-config'\n")))
+
+ = (substitute*
+ '("base/process/launch_posix=2Ecc"+ "base/third_party/dynamic_annotations/dynamic_annotati= ons=2Ec"
+ "sandbox/linux/seccomp-bpf/sandbox_bpf=2Ecc= "
+ "sandbox/linux/services/credentials=2Ecc"
+ = "sandbox/linux/services/namespace_utils=2Ecc"
+ = "sandbox/linux/services/syscall_wrappers=2Ecc"
+ = "sandbox/linux/syscall_broker/broker_host=2Ecc")
+ (("= include \"base/third_party/valgrind/") "include \"valgrind/"))
+
+ = (for-each (lambda (file)
+ (substitute= * file
+ ;; Fix opus include path=2E
+ = ;; Do not substitute opus_private=2Eh=2E
+ = (("#include \"opus\\=2Eh\"")
+ = "#include \"opus/opus=2Eh\"")
+ (("#inclu= de \"opus_custom\\=2Eh\"")
+ "#include \"opus= /opus_custom=2Eh\"")
+ (("#include \"opus_defi= nes\\=2Eh\"")
+ "#include \"opus/opus_defines= =2Eh\"")
+ (("#include \"opus_multistream\\=2E= h\"")
+ "#include \"opus/opus_multistream=2Eh= \"")
+ (("#include \"opus_types\\=2Eh\"")
+= "#include \"opus/opus_types=2Eh\"")))
+ = (find-files (string-append "third_party/webrtc/modules"+ "/audio_coding/codecs/= opus")))
+
+ (substitute* "chrome/common/chrome_paths=2Ec= c"
+ (("/usr/share/chromium/extensions")
+ = ;; TODO: Add ~/=2Eguix-profile=2E
+ "/run/current-syst= em/profile/share/chromium/extensions"))
+
+ ;; XXX: Shoul= d be unnecessary when use_system_lcms2=3Dtrue=2E
+ (substitu= te* "third_party/pdfium/core/fxcodec/codec/ccodec_iccmodule=2Eh"
+ = (("include \"third_party/lcms/include/lcms2\\=2Eh\"")
+ = "include \"lcms2=2Eh\""))
+
+ (substitute*
+ = "third_party/breakpad/breakpad/src/common/linux/libcurl_wrap= per=2Eh"
+ (("include \"third_party/curl") "include \"curl= "))
+
+ (substitute* "third_party/webrtc/rtc_base/strings= /json=2Eh"
+ (("#include \"third_party/jsoncpp/") "#includ= e \"json/"))
+
+ (substitute* "media/base/decode_capabili= ties=2Ecc"
+ (("third_party/libvpx/source/libvpx/") ""))+
+ (substitute* "ui/gfx/skia_util=2Eh"
+ = (("third_party/vulkan/include/") ""))
+
+ ;; Building ch= romedriver embeds some files using the ZIP
+ ;; format which= doesn't support timestamps before
+ ;; 1980=2E Therefore, a= dvance the timestamps of the files
+ ;; which are included s= o that building chromedriver
+ ;; works=2E
+ = (let ((circa-1980 (* 10 366 24 60 60)))
+ (for-each (lambd= a (file)
+ (utime file circa-1980 circa-1980))=
+ '("chrome/test/chromedriver/extension/backgro= und=2Ejs"
+ "chrome/test/chromedriver/extensio= n/manifest=2Ejson")))
+
+ #t))
+ (add-before '= configure 'prepare-build-environment
+ (lambda* (#:key inputs = #:allow-other-keys)
+
+ ;; Make sure the right build tool= s are used=2E
+ (setenv "AR" "ar") (setenv "NM" "nm")
+ = (setenv "CC" "gcc") (setenv "CXX" "g++")
+
+ ;= ; Work around <https://bugs= =2Egnu=2Eorg/30756>=2E
+ (unsetenv "C_INCLUDE_PATH")<= br>+ (unsetenv "CPLUS_INCLUDE_PATH")
+
+ ;; T= ODO: pre-compile instead=2E Avoids a race condition=2E
+ (se= tenv "PYTHONDONTWRITEBYTECODE" "1")
+
+ ;; XXX: How porta= ble is this=2E
+ (mkdir-p "third_party/node/linux/node-linux= -x64")
+ (symlink (string-append (assoc-ref inputs "node") "= /bin")
+ "third_party/node/linux/node-linux-x64/bin= ")
+
+ #t))
+ (replace 'configure
+ = (lambda* (#:key configure-flags #:allow-other-keys)
+ (le= t ((args (string-join configure-flags " ")))
+ ;; Generate= ninja build files=2E
+ (invoke "gn" "gen" "out/Release"+ (string-append "--args=3D" args))
+
+ = ;; Print the full list of supported arguments as well as
+ = ;; their current status for convenience=2E
+ (fo= rmat #t "Dumping configure flags=2E=2E=2E\n")
+ (invoke "g= n" "args" "out/Release" "--list"))))
+ (replace 'build
+ = (lambda* (#:key outputs #:allow-other-keys)
+ (invoke = "ninja" "-C" "out/Release"
+ "-j" (number->string= (parallel-job-count))
+ "chrome"
+ = "chromedriver")))
+ (replace 'install
+ (lam= bda* (#:key inputs outputs #:allow-other-keys)
+ (let* ((out= (assoc-ref outputs "out"))
+ (bin = (string-append out "/bin"))
+ (exe (st= ring-append bin "/chromium"))
+ (lib (stri= ng-append out "/lib"))
+ (man (string-appe= nd out "/share/man/man1"))
+ (applications (string-= append out "/share/applications"))
+ (install-regexp = (make-regexp "\\=2E(bin|pak)$"))
+ (locales (s= tring-append lib "/locales"))
+ (resources (stri= ng-append lib "/resources"))
+ (preferences (assoc= -ref inputs "master-preferences"))
+ (gtk+ = (assoc-ref inputs "gtk+"))
+ (mesa (assoc-r= ef inputs "mesa"))
+ (nss (assoc-ref input= s "nss"))
+ (udev (assoc-ref inputs "udev")= )
+ (sh (which "sh")))
+
+ = (substitute* '("chrome/app/resources/manpage=2E1=2Ein"
+ = "chrome/installer/linux/common/desktop=2Etemplate")
= + (("@@MENUNAME@@") "Chromium")
+ (("@@P= ACKAGE@@") "chromium")
+ (("/usr/bin/@@USR_BIN_SYMLINK_N= AME@@") exe))
+
+ (mkdir-p man)
+ (cop= y-file "chrome/app/resources/manpage=2E1=2Ein"
+ = (string-append man "/chromium=2E1"))
+
+ (mkdir-p app= lications)
+ (copy-file "chrome/installer/linux/common/des= ktop=2Etemplate"
+ (string-append applications = "/chromium=2Edesktop"))
+
+ (mkdir-p lib)
+ = (copy-file preferences (string-append lib "/master_preferences"))
= +
+ (with-directory-excursion "out/Release"
+ = (for-each (lambda (file)
+ (install-f= ile file lib))
+ (scandir "=2E" (cut regexp-ex= ec install-regexp <>)))
+ (copy-file "chrome" (str= ing-append lib "/chromium"))
+
+ ;; TODO: Install ico= ns from "=2E=2E/=2E=2E/chrome/app/themes" into
+ ;; "out= /share/icons/hicolor/$size"=2E
+ (install-file
+ = "product_logo_48=2Epng"
+ (string-append o= ut "/share/icons/48x48/chromium=2Epng"))
+
+ (copy-re= cursively "locales" locales)
+ (copy-recursively "resour= ces" resources)
+
+ (mkdir-p bin)
+ = (symlink "=2E=2E/lib/chromium" exe)
+ (install-file "c= hromedriver" bin)
+
+ (wrap-program exe
+ = ;; TODO: Get these in RUNPATH=2E
+ `("LD_LIB= RARY_PATH" ":" prefix
+ (,(string-append lib ":" nss= "/lib/nss:" gtk+ "/lib:"
+ mesa "/= lib:" udev "/lib")))
+ ;; Avoid file manager crash=2E = See <https://bugs=2Egnu=2Eor= g/26593>=2E
+ `("XDG_DATA_DIRS" ":" prefix (,(s= tring-append gtk+ "/share"))))
+ #t)))))))
+ (nati= ve-inputs
+ `(("bison" ,bison)
+ ("gcc" ,gcc-8)
+ = ("gn" ,gn)
+ ("gperf" ,gperf)
+ ("ninja" ,ninja)
+ = ("node" ,node)
+ ("pkg-config" ,pkg-config)
+ ("which"= ,which)
+ ("yasm" ,yasm)
+
+ ;; This file contains de= faults for new user profiles=2E
+ ("master-preferences" ,(local-fi= le "aux-files/chromium/master-preferences=2Ejson"))
+
+ ("pytho= n-beautifulsoup4" ,python2-beautifulsoup4)
+ ("python-html5lib" ,p= ython2-html5lib)
+ ("python" ,python-2)))
+ (inputs
+ = `(("alsa-lib" ,alsa-lib)
+ ("atk" ,atk)
+ ("cups" ,cups)=
+ ("curl" ,curl)
+ ("dbus" ,dbus)
+ ("dbus-glib= " ,dbus-glib)
+ ("expat" ,expat)
+ ("flac" ,flac)
+ = ("ffmpeg" ,ffmpeg)
+ ("fontconfig" ,fontconfig)
+ ("f= reetype" ,freetype)
+ ("gdk-pixbuf" ,gdk-pixbuf)
+ ("glib= " ,glib)
+ ("gtk+" ,gtk+)
+ ("harfbuzz" ,harfbuzz/chromiu= m)
+ ("icu4c" ,icu4c)
+ ("jsoncpp" ,jsoncpp)
+ (= "lcms" ,lcms)
+ ("libevent" ,libevent)
+ ("libffi" ,libff= i)
+ ("libjpeg-turbo" ,libjpeg-turbo)
+ ("libpng" ,libpng= )
+ ("libva" ,libva)
+ ("libvpx" ,libvpx/chromium)
+ = ("libwebp" ,libwebp)
+ ("libx11" ,libx11)
+ ("libxcb= " ,libxcb)
+ ("libxcomposite" ,libxcomposite)
+ ("libxcur= sor" ,libxcursor)
+ ("libxdamage" ,libxdamage)
+ ("libxex= t" ,libxext)
+ ("libxfixes" ,libxfixes)
+ ("libxi" ,libxi= )
+ ("libxml2" ,libxml2)
+ ("libxrandr" ,libxrandr)
+ = ("libxrender" ,libxrender)
+ ("libxscrnsaver" ,libxscrnsaver= )
+ ("libxslt" ,libxslt)
+ ("libxtst" ,libxtst)
+ = ("mesa" ,mesa)
+ ("minizip" ,minizip)
+ ("mit-krb5" ,mi= t-krb5)
+ ("nss" ,nss)
+ ("openh264" ,openh264)
+ = ("openjpeg" ,openjpeg) ;PDFium only
+ (= "openssl" ,openssl)
+ ("opus" ,opus+custom)
+ ("pango" ,p= ango)
+ ("pciutils" ,pciutils)
+ ("pulseaudio" ,pulseaudi= o)
+ ("re2" ,re2)
+ ("snappy" ,snappy)
+ ("speec= h-dispatcher" ,speech-dispatcher)
+ ("udev" ,eudev)
+ ("v= algrind" ,valgrind)
+ ("vulkan-headers" ,vulkan-headers)))
+ = (home-page "https://www=2Echromium=2Eorg/")
+ (description
+ = "Ungoogled-Chromium is the Chromium web browser, sans integration with
+= Google web services=2E")
+ ;; Chromium is developed as BSD-3, but bun= dles a large number of third-party
+ ;; components with other license= s=2E For full information, see chrome://credits=2E
+ (license (list = license:bsd-3
+ license:bsd-2
+ l= icense:expat
+ license:asl2=2E0
+ = license:mpl1=2E1
+ license:mpl2=2E0
+ = license:public-domain
+ license:isc
+ = (license:non-copyleft "chrome://credits"
+ = "See chrome://credits for more information=2E")
+ = license:lgpl2=2E1+))))

Wow=2E
Nice work! =F0=9F=98=83
--
Sent from my k-9 mail= for Android=2E
------OLEBV8UXLOH3TYKFR6Q74PQLQ3834I-- From debbugs-submit-bounces@debbugs.gnu.org Wed Feb 06 16:05:14 2019 Received: (at 28004) by debbugs.gnu.org; 6 Feb 2019 21:05:14 +0000 Received: from localhost ([127.0.0.1]:36221 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1grUNd-0008Do-Tk for submit@debbugs.gnu.org; Wed, 06 Feb 2019 16:05:14 -0500 Received: from wout2-smtp.messagingengine.com ([64.147.123.25]:32945) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1grUNb-0008DU-0N for 28004@debbugs.gnu.org; Wed, 06 Feb 2019 16:05:11 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.west.internal (Postfix) with ESMTP id 0D9102FA2; Wed, 6 Feb 2019 16:05:04 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Wed, 06 Feb 2019 16:05:05 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=ypPJd8oxxVPuXO1VYZudC8HnEe 0BufhDQv89Kxgw95Q=; b=uPgqDV0wcHtnPzDEddQpdZgiqo0ROw3HR6VAopo2zB GW0NX6xWjaGWuc+NlfFeUe3aDlj9Wm6yRRDVSlQBeCdWQauXV1AYi/I0Z3x46S57 dFUWDiu0prlPNpeikG6wCCmduQ0vT6fcWwO60piV/FApwSVSK80KUGjrA5+a5VuW LfMo4yDAGUWuAIKNZtCtY0o4POxiRnLchZ8CL76B+UJ23OZzAaqL536Vj7x6/D29 /+wnQS79F+1pdQZNgavfPWTsCTrqfV96DzuYjnO9y8Akb0RsmHjEP5wrcmMFh2zL X7ppsYb0voZez8Owe2gjkOnm9v6lUa+cyOxcaICT+f/g== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; bh=ypPJd8 oxxVPuXO1VYZudC8HnEe0BufhDQv89Kxgw95Q=; b=KrWoX+B2xWr/ydxuqoYcNU jTrBW9xdWjdq6G67/ocSaROlUMMaAslgGSgW8OtMKjDdLZBhHUWUW8EzH8qQKzQ4 1IZprOFU+vgID01i5Z7mSc0MJy86xiVodByjXRFR65pkyb/DLCLXr2stlAFOQnMU oFZDc3VmlB1W6ViZw4zT8ZFui6y/a/7edSLALUyo5KxJ20akq4wWwoS0tZO1tIpj yiSs0fOg9iW5kmEMEJFRVT0s4zJV9ahuB2kt5OwzOeL04SvDe1cWY0fYe4F+wQjq Hz17xpct4Gg4ZMDPqIPApBrI4y53myILUPGG8YsFx0H+s+Sca252SM37BEq3VU2Q == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtledrkeekgddugeekucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvffujghffg ffkfggtgesghdtreertderjeenucfhrhhomhepofgrrhhiuhhsuceurghkkhgvuceomhgs rghkkhgvsehfrghsthhmrghilhdrtghomheqnecuffhomhgrihhnpehgnhhurdhorhhgne cukfhppeeivddrudeirddvvdeirddugedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehm sggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmnecuvehluhhsthgvrhfuihiivgeptd X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id DB203E412B; Wed, 6 Feb 2019 16:05:01 -0500 (EST) From: Marius Bakke To: Ludovic =?utf-8?Q?Court=C3=A8s?= , bill-auger Subject: Re: [GNU-linux-libre] [PATCH] gnu: Add ungoogled-chromium. In-Reply-To: <87sgx3mbcq.fsf@gnu.org> References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> <87sgx3mbcq.fsf@gnu.org> User-Agent: Notmuch/0.28 (https://notmuchmail.org) Emacs/26.1 (x86_64-pc-linux-gnu) Date: Wed, 06 Feb 2019 22:04:59 +0100 Message-ID: <87y36socg4.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org, gnu-linux-libre@nongnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Ludovic Court=C3=A8s writes: > Hi bill-auger, > > bill-auger skribis: > >> re: https://lists.gnu.org/archive/html/guix-devel/2019-02/msg00009.html >> >> i would like to remind readers of the guix-devel list that it was >> discussed some months ago, why no FSDG distros currently distribute >> chromium[1] - it appeared at that time, that most people in that >> discussion were in agreement that chromium should not be included in >> guix; and marius was instead hosting it in a private repo, as not to >> taint the main guix repos with dubious software - has there been a >> notable break-through since then? > > It=E2=80=99s not entirely clear to me what the problems are, to be honest. > Marius listed specific issues that were addressed by the patches; others > then pointed out at additional issues that ungoogled-chromium fixes, > which Marius took into account; what=E2=80=99s left now? Indeed, the only real breakthrough is that we now have a script to create an Ungooglified source tarball with all unnecessary third_party components removed. The compressed tarball is smaller than that of IceCat and takes up around 2.1 GiB uncompressed, roughly 1GiB of which is third_party stuff. That leaves "just" over 1GiB of source code to audit (assuming my third_party audit is correct). I haven't been able to find any proprietary parts in first party code, and am convinced that the remaining third_party components are free, hence this patch. I am of course happy to help other FSDG distributions liberate their Chromium too. --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlxbS/sACgkQoqBt8qM6 VPocZgf+Pkn1O48620Eeq+46cW1UWmD9rO+sc2Mnm25TJZVneFWgnEel+cFVgp8c FH1lvkScAkMi28WcI93nQCq7OqVJOZ7h9gvMmAhEZEvyoWFn/cylIFM39iNdU3pE 6sC5nWR5cEt6mNbjiddoV1OxftsgyVVyVizr/tCGHhLW/xtFaYHZ/zN+h3I1oZk2 aNqa33DaYf8A3ZbYsXmKqtQQIsuAPs10dTppt1mmEe9xnOndu8KO6n9Spa4f0IUR RHoU05cz4uCAXmAbB5Lam6lbZmM2xlvZExTcvzmM51jvDHSQ5dE7yk4s1ZLCgAKT VlaeQRdSI6GUe4wiFzhk3my2dkcDFg== =yfJH -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Thu Feb 07 18:52:06 2019 Received: (at 28004) by debbugs.gnu.org; 7 Feb 2019 23:52:06 +0000 Received: from localhost ([127.0.0.1]:38695 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1grtSf-0008Sz-NB for submit@debbugs.gnu.org; Thu, 07 Feb 2019 18:52:05 -0500 Received: from dustycloud.org ([50.116.34.160]:55516) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1grtSd-0008Sq-QN for 28004@debbugs.gnu.org; Thu, 07 Feb 2019 18:52:04 -0500 Received: from jasmine (localhost [127.0.0.1]) by dustycloud.org (Postfix) with ESMTPS id 6250C2666A; Thu, 7 Feb 2019 18:52:02 -0500 (EST) References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> <87sgx3mbcq.fsf@gnu.org> User-agent: mu4e 1.0; emacs 26.1 From: Christopher Lemmer Webber To: Ludovic =?utf-8?Q?Court=C3=A8s?= Subject: Re: [PATCH] gnu: Add ungoogled-chromium. In-reply-to: <87sgx3mbcq.fsf@gnu.org> Date: Thu, 07 Feb 2019 18:52:02 -0500 Message-ID: <87tvhf5f8d.fsf@dustycloud.org> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: bill-auger , guix-devel@gnu.org, gnu-linux-libre@nongnu.org, 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Ludovic Court=C3=A8s writes: > Hi bill-auger, > > bill-auger skribis: > >> re: https://lists.gnu.org/archive/html/guix-devel/2019-02/msg00009.html >> >> i would like to remind readers of the guix-devel list that it was >> discussed some months ago, why no FSDG distros currently distribute >> chromium[1] - it appeared at that time, that most people in that >> discussion were in agreement that chromium should not be included in >> guix; and marius was instead hosting it in a private repo, as not to >> taint the main guix repos with dubious software - has there been a >> notable break-through since then? > > It=E2=80=99s not entirely clear to me what the problems are, to be honest. > Marius listed specific issues that were addressed by the patches; others > then pointed out at additional issues that ungoogled-chromium fixes, > which Marius took into account; what=E2=80=99s left now? > > I understand you=E2=80=99re skeptical about Chromium, but we cannot base > decisions based on vague skepticism. If you know of issues that are > still unaddressed, please do list them. > > I=E2=80=99d also like to stress that, if Chromium is eventually included = in > Guix, we are committed to fixing it or removing it should someone later > discover that it does not comply with the FSDG (that=E2=80=99s the =E2=80= =9CCommitment > to Correct Mistakes=E2=80=9D section of FSDG.) +1 ... If concrete problems are found, by all means those should be raised and addressed. Otherwise I really think we ought to merge this work. From debbugs-submit-bounces@debbugs.gnu.org Thu Feb 07 18:59:09 2019 Received: (at 28004) by debbugs.gnu.org; 7 Feb 2019 23:59:09 +0000 Received: from localhost ([127.0.0.1]:38699 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1grtZV-0000CK-HC for submit@debbugs.gnu.org; Thu, 07 Feb 2019 18:59:09 -0500 Received: from mx1.riseup.net ([198.252.153.129]:36422) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1grtZS-0000CA-Ie for 28004@debbugs.gnu.org; Thu, 07 Feb 2019 18:59:07 -0500 Received: from capuchin.riseup.net (capuchin-pn.riseup.net [10.0.1.176]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "COMODO RSA Domain Validation Secure Server CA" (verified OK)) by mx1.riseup.net (Postfix) with ESMTPS id 847E91A0488; Thu, 7 Feb 2019 15:59:05 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1549583945; bh=tBuAEPk5haX8DSxN9rgKmKcxBggQCV500zU3egz0gEs=; h=Subject:To:Cc:References:From:Date:In-Reply-To:From; b=lErf1OMVf6Iwwp/MTA8ntmJWbjln/1THUJe6pQiRLCLGbzfCySliEc+7vf2OBt4uT Vrb3lWSSDdHX+tEbc+riGOs4Fzp3mmTNcz7ovjnAYALON58oXeyXqoxDlWIH4+a1B/ g2ONGasKujVAB0dQWrze757eU4kOoaD8Wa7zv4Kk= X-Riseup-User-ID: AAFD575CB0E61901C4622E10D46FF6343F64CDF3F31173DD8402450CD56E78A5 Received: from [127.0.0.1] (localhost [127.0.0.1]) by capuchin.riseup.net (Postfix) with ESMTPSA id A23AC120469; Thu, 7 Feb 2019 15:59:04 -0800 (PST) Subject: Re: [GNU-linux-libre] [PATCH] gnu: Add ungoogled-chromium. To: Workgroup for fully free GNU/Linux distributions , Christopher Lemmer Webber , =?UTF-8?Q?Ludovic_Court=c3=a8s?= References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> <87sgx3mbcq.fsf@gnu.org> <87tvhf5f8d.fsf@dustycloud.org> From: Julie Marchant Openpgp: preference=signencrypt Autocrypt: addr=onpon4@riseup.net; keydata= xsFNBFqKX7EBEACzXlTUAPlNEDZG/nzwwR09tfRr92BhrjUjAyzhmAuMMHCliwQGlWgP8rlL /n6NTpgKvQKWWOEsmm9PwQcJuXuR0G67SbCmIAFquLvd65zM03ZfD/WnQQfhnI5hwpLkfwDZ edRMfemoDNavDQeN48iXK4S2Y9aWD3S7lMB/8L+00yQ+KOhw3KGlAtuE0+R+yn41pPIieg3F OfX81kgdMZ0sL3Pn+faRdPkqSRmuy3d1mM7eeLCUf2n+su0GAbVVLtAUgZ3CumaOKLGF62Sx Teaa5gAHgyv1JHZQ2/lkuXZOiPj5zYolvucTUsqdsotQ1Y7IickMrIHsvj0hKAmNQHmCFUbn NhkMVwHjInl2lvJ0BtrVagSxYCL4bYImcY6LM3WLt/V5TCVydQBMGwH8q1zzSb3RMrX2fJM2 nMd+l9lmGFpoPadYcrVNmOGLOrRBpVMgfuEbsoAUASQXLMbPWY0RBfSoAAVB+4z3VbWWmvAE 1OXfKHcRXS4lED8csFvPqTstKkPpQidh+Jq3hS9ZwzOE/qHXYc7ECKck9LPEduorXAxnzItT EycBe11Xe7foBT1lptdt9iEe8VXc5rMMRGCyDlZ3Ll8//lmeIs7IySsctyfV0iD1iaPO4Bus PweX1mH0eenbH3Di5g2clrkTi2BX1loEwoXTspoGMPpGGrhSVwARAQABzSJKdWxpZSBNYXJj aGFudCA8b25wb240QHJpc2V1cC5uZXQ+wsF5BBMBAgAjAhsjBwsJCAcDAgEGFQgCCQoLBBYC AwECHgECF4AFAlt1vccACgkQ5tCEZmsTjkXL3g/+NFBj31LdEB1gta74whlbeT8gmc1CIt+6 7RIna+hcUCRQ1puoTBJZIkeIB/fxM3BmBre9+0hD+tdnl929Ez57ByOxZJPv3UJgtbNq2vLE TMPio8umAt35+8Gw+J+ccTQPiqqWSXPtVMQLbGl+wrmVjQB3zRXk8HzaVbi58I215OFLzzN0 ajeAZRTonMiUCmqbTglvTBf4cCYCrpFuH+H57oWH0SifTSlrd3zbD6NaUZX6JhXu0SxT5khm Fnj52b3sCXULXGpdE3Jw8m4MG7xwU1KKcIDzWl3UmvHlOEh9seBBUo1tGKH2lOnMd+1dcS+Y GT6NsLgpAv/7Omk/yiuwVa1fEqjwVoB3RE4qpg6HPtyBhE5Yjks3ldEguEdU7tALfiAA3oHl GItx5XfHadd+atTmYNaEnbwrHHS0Lq6w04Q159R9bJm6FBP9HFV5T988U4jBR7n/LmI7UGOk 9sOGWYt6HZHsnlfgPij1wVIYi6slj1DZz5DgQr5ftJxaOlqXbVb2t3Cb9SKYV2+R5UG6DJrR 8NeIJXEtq3l51G4iWaG0WQq33mkgun/LyInZ0me/CIdeUQfbxc0Auvqn6zpuqQaMekKuV1ZD buUeXNJKFvUYIj8QqhyjnYLBDTaQPyHP14B/sejOd1I+hticMAov/azvnG5nXyWK6LVVvI8Q 6gLOwU0EWopfsQEQALCxJPtcNTQgG5ls2+api4DX2Lb6c92xCEU656QonCgdE8NRIY/8uWe1 I82BDe3gLW7ZQ0ZrcAnV3WmOEA5WIiovZOFZu6VNMfTqaL/xHaIsl68dyhmq0SxszIYx8K1M Fs69fjsoaM4GRTPTNv5VlUaYFGV+G4D4ZDSXtVRzNqcZfhrpNBMR6gfEC4u9ZZUy5nGIADAh wa5pB2i48rHLHwqU4sysC8ucYzZDGT3F6VbYYVabtKWj5VQPzfjzNFIxGumbmsvUsx0hggPr 35fRKU3GEfkD61/tsrrMqgFQFPE+4As4+MZuDZPsBvI/cyNUxIYA6mnCJoGo1PsrIfMRFEfb vxKV9aETdM0/WIK2lcjt3FfamfAL6QrpSVI79pWK454W3bi6Zvdlod+oK5zoNBJ8/xpO6F3n /JhmXnWUE74KhuK3QpvgZCEwcoJ9RfHBEogH+Dw1y/MtvPG8I0+o/NpGbMA6X6GzxqO1/vRD EkfI4twGj+wD+Bn/1bTHmw7/JhgnY4DDHo/7IkPNHj+QXpJDkk3NTKIXFCWkC+LOT+Zy7VXN 3tYKIkHVGiNJLY8aKn/85mlbY8hwBJjPR6l6Ch/twSeXhsqoZ5ASiKrCFcBUAAn5YA/I37i/ nZy2vw6N/yxM/WrIHC6l47Qfbf3rZSAdIWN8/WxqTyU1qfsEDjjRABEBAAHCwV8EGAECAAkC GwwFAlt1vccACgkQ5tCEZmsTjkXvNQ/+Pok9GgdCZIab3ZmMBC+JHDbv451aUHohmUD9Hl3f FMu9v+ug7nvJSoPhfFDZoT8O5LePR8sFJa47Yo6DiUjM3VFCeGNVMMhpEamsylAxFVYcLHD6 xNWkCLYInYF9FNN0OsDoK79y0zSRqgMAdrp5dqZhJKlWny7Kb9F1vUoNU0fsiXB+819SHz4F fyIlDPpOAQx3Fx5ZlctulWvwALTZV7pdNryIpi6CsAW5PIqcs53+mcXWEPgocvWDW4Fnld8F NL05lWNIutBwjK8YEuhvqZdVBhp5Av2SHGSfQG4YidCCQIokmKMLd09Pg0PiYWbK4pdjYSog dm72CuX8D0dwvYtxVJslmVq0cjnxHfrKZCKpaEznszAXS/xWD02boW4G+4euPCZFvdV8B7ry NTbY1OhFVnlT25hcdGeKlGewaChZgY2tfQ6JhiBb8ppnYbe3NWtzNb8U//me5iAXwzlWJeC2 1LQ3HaESpGEoNFodBq0CjXLJ54hJZLYS5dLaIw2j599Ni1K9EaUI9t8VbUtu0yZlR3gBs8G3 ov9FNBpKVdjJC2hbe9tZEkKda/ocMnOIcoTYKVhjdLzMWBwWgxhUpa75CNxBr/5TIEDEZxOJ L7UkLklTFPDdW4Uw9UorjyzbSWWaVDcOloJmG+nlJ27/pCKy/yHdx0OBkAJC20XnVnQ= Message-ID: <794ccf8b-cee1-5588-976f-085d37a0bc2a@riseup.net> Date: Thu, 7 Feb 2019 18:59:02 -0500 MIME-Version: 1.0 In-Reply-To: <87tvhf5f8d.fsf@dustycloud.org> Content-Type: text/plain; charset=utf-8 Content-Language: en-CA Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) On 02/07/2019 06:52 PM, Christopher Lemmer Webber wrote: > Ludovic Courtès writes: > >> Hi bill-auger, >> >> bill-auger skribis: >> >>> re: https://lists.gnu.org/archive/html/guix-devel/2019-02/msg00009.html >>> >>> i would like to remind readers of the guix-devel list that it was >>> discussed some months ago, why no FSDG distros currently distribute >>> chromium[1] - it appeared at that time, that most people in that >>> discussion were in agreement that chromium should not be included in >>> guix; and marius was instead hosting it in a private repo, as not to >>> taint the main guix repos with dubious software - has there been a >>> notable break-through since then? >> >> It’s not entirely clear to me what the problems are, to be honest. >> Marius listed specific issues that were addressed by the patches; others >> then pointed out at additional issues that ungoogled-chromium fixes, >> which Marius took into account; what’s left now? >> >> I understand you’re skeptical about Chromium, but we cannot base >> decisions based on vague skepticism. If you know of issues that are >> still unaddressed, please do list them. >> >> I’d also like to stress that, if Chromium is eventually included in >> Guix, we are committed to fixing it or removing it should someone later >> discover that it does not comply with the FSDG (that’s the “Commitment >> to Correct Mistakes” section of FSDG.) > > +1 ... If concrete problems are found, by all means those should be > raised and addressed. Otherwise I really think we ought to merge this > work. Yes, exactly. -- Julie Marchant http://onpon4.github.io Encrypt your emails with GnuPG: https://emailselfdefense.fsf.org From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 09 09:04:46 2019 Received: (at 28004) by debbugs.gnu.org; 9 Feb 2019 14:04:46 +0000 Received: from localhost ([127.0.0.1]:40606 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gsTFN-00029F-Ko for submit@debbugs.gnu.org; Sat, 09 Feb 2019 09:04:45 -0500 Received: from relay12.mail.gandi.net ([217.70.178.232]:38751) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gsTFK-000295-My for 28004@debbugs.gnu.org; Sat, 09 Feb 2019 09:04:43 -0500 Received: from [192.168.1.100] (unknown [181.221.142.124]) (Authenticated sender: adfeno@hyperbola.info) by relay12.mail.gandi.net (Postfix) with ESMTPSA id EEF96200002; Sat, 9 Feb 2019 14:04:37 +0000 (UTC) Subject: Re: [GNU-linux-libre] [PATCH] gnu: Add ungoogled-chromium. To: Workgroup for fully free GNU/Linux distributions , guix-devel@gnu.org References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> From: Adonay Felipe Nogueira Openpgp: preference=signencrypt Autocrypt: addr=adfeno@hyperbola.info; prefer-encrypt=mutual; keydata= xsPuBFSdo9IRDACmvQCvDZOHZ33gwVtn//XtEmnlcl1yR6j06qvh2E22aK3bmom1y6HfgAVq l+3R16sL27Y0cEeM12Xl2h1HrFiT3Hd/LGWNVC/osPAKrrs6bMRh3uUdOVWeVuM/7c6n5hvx PAkZ6s70w1+y1ilG19aEpezFybAb9oE7+qBLjKAZPgceHeOxUthdfqDDqc/oenCGVEQNvPzK jQVzE+NnB3KdbGNQKFjTuWutxHjMY61H06a824vMd4SU5ReHlDnhCfasJUYcT6ykijf5xeCU icLvLowZl3rCjzjxFxKGnfh/vT6LqMNlfLfTKMR8zmXKHXC+KJjQG3Ohl++7BTGxIrxZtAr6 MKeNczQng0xJtGI/gSus+8Rt9GycMJ/TZh+CrMsRiWmleONsl2fYO5pd4P+hDcttVOmdI/dj H3yycUt5nzgezid+O2NzsjJNNAgDy9uxOLa01aBpaSR94IsYPCxaHh9rBo27v5L8lm2DZTmy CdTdJ/g7OETOSKGmrGywwmsBAO9f4sVideYrDJbEUcXkFSH19ctJYCgLHscWzpypGsQNC/9X iq7fMCS5kAkK/ZcsPeaI4VIDkFJAF22oJyCvJwLWpaQKXBLAFYcAltEHfjdgrrYlexlgQ7SX yX136hD8HJTe1oc2qHN/CXa+LDvxhhNLIgagKP13IIt8AS7U+3YsrCSgu1fjDpxoEP2+xXTS jjcDmnJIWv1oDjIp57OfpKokvHtEsMgXrZI4Ft3ftpzN6o/YWVQeJ7VBdVeKPkzukMfHu04q 1O6TcfSVGLSjrSdTD8/0LcRmwEwgxRBbhp3kxmnUqV+/C/Cj1G2LurKBdqC/rGTSgR1TeQji rTDvV4aReZ8swQS8dGoO4CoxG3ZVz0nsLs7Nl/wRoIMXVo/yMd03LIySSJuATWD6+0LOL5PT gsIRYpBw3jcLTAwPsQd8M8CH9b07qGJ4roVkhEj3R09WeDmSSCLcyQERTzA3EskuaDF8qrRj q68/6kZwhsmssBzAH1PWnFpBAqEaoyQZUisoCffbQwM31oYt04Ng7JXqKHVE+ZchcujtijK5 bPz9ARgL/11E5yq9Z9x+OIxVx1lhMadwH/ze2CrTUIMTo9ZAp8tBqDvXOr43FHPTYio0wycl /anW2D6+4Q49/gK8GQS4xWo/jZnCjOaVIPRbH+y/HE4eXBwKA9UKHpYdZuL2z1zFLYvZd/LT rX66q/+8YMETsu86e4J76lE0WhljWdseM4RFmKlPepSttgCS6iRcWZeuhpknqpOILBwNUtFA Dnqbe9y5ZQ8xETy4/nDMIeWmiHIhQ5bzm+dzOVwtqOpDpTvMzZbU3buBCsZFVrzxuXa66sJu W3fhc//cJ6GTlKz404tAuJrVr9q+uB4OOlkjoUYOIYnwwmKhZaqaUQDTpvK67QhWCZiDHJ/J bvuMCv/XCVh/1IdTbe518jVzfcYjlyxcSHFq8TxiGhJYaBFF4vPC9+vf7l2fQVhDzzpBqMVH 5k9nGJXJ9M0mDO9e8O4CkV55YXzVQFVipiaGyd9DBKcWHAyprxj20MBkP0npXfGErkADCUEp 1MpKt0p3U3BJkoi2Ms0uQWRvbmF5IEZlbGlwZSBOb2d1ZWlyYSA8YWRmZW5vQGh5cGVyYm9s YS5pbmZvPsJ6BBMRCAAiBQJZkFYUAhsDBgsJCAcDAgYVCAIJCgsEFgIDAQIeAQIXgAAKCRDI 1uFSAe6docKxAQCAKQxT1MlVJyXdFC7sGFH00jlHeybp6qgOVfJvpqLPGgD+ITwpdjy3RD2c kuENzAKzvom8pnDrNW+oIIIYUaE5gMTOw00EVJ2j0hAQAPcu3bLnt0CqcF49mN0m7z13Fiqv wLRxJe2sEeduZl146rqyNdv4XmaCSdsbgThfw7sW60/J4Gyianv2uzm9E4DpnSh/Ie4LGqXC UALnIYhxeILOo8CvFW1hkF/AgZp0CNoXrP786Nh0rksHfwps0B7b6Vy/E0blioaijvUS2z3/ DKY6CXb7D8wRi64qTMarLaifRzIR/pbX29uBB2McOeoswSFob/McMA7AHp3p+lttR5J8eLc3 Ckj7OuJCY74XIAGq2B64RPmn617BD9ym83M3fcbEXgDBQtvLjznfKNzeMXOLXN/7/qKm1Sza 5NpeAGDg0YvXg6qIi0iyJw4RVzdCiqacO+G3Am/Ge2XDKsuBgsEf1YjlENINGS/ZmqfZd0sH jCJHb/YOlEzVw8HVMzeES8aUOBDh+d2aWhYx30jXuFbMqvuOh4t7JZjBy8TQVuvVhIps0Qyu /YnNxKzZ2F9keaN854KRtcGxaD/wOGpgoAOlyhH+pXVTTl3GCMCHonJ6Sn+jNGa6+oX7HF8h wSevwzQ11WThTPmUTlPU96jN5kqE6qLKBo2msu2MxVQRo1kLlHCRfjvbNGf2iZXRKI+RARgv a+7NZPtYDs1Sg/zw7HgUowImT6JGcN0ZgAMqw/V2nALvW+Caq03GCNiWR2elB/jmhHR+3Brj 18fsc25HAAMFEADViuPfdUqFHzmKgVdRH5A8NIZNTT/MMrYCqv5PAkEhnsXLXeHHV7a0cbfx 3yf86Pv8XMtBItShUVQ9UPVvmFW3ew5cqCCUF5MzrbOXrrso+78yflYjbh55Sf1HelG11eBT xs2auCgMWVsxRjgk9sbzh0j+R9MCMXHw0H/x63BS+due6Z0PYlsgXxbtWxB0P7kiYekXn6xo MeJco9CbWufnWdK4J5WylILQPNwI8uwrj56TUmh3PFnC2UmUa+KQ9m5gWHOIybWYZf4TTXBi N6gvhUqN9IpGFaNG26sWWiOpEWAiVTwPE/lSB+yibouSfE3XLw1Q+FH7TqwmtVS6Kj+yC4Z7 GlDcmqlQxJhBdXTEpTk0rA1Bs4okjqVoQRpLPYUFkhVA15jJGrewUJuUhL128gL2Ek0A14FW +zmi0Wi3tIrUQXovGy7eorIgq7M3/ri0ibbrS5jE4yfIZG/8nb1S/RX5JEwEaoe7izi+1GIi GkCRkzGT3VqG78ppH2166Bq9qDwGf3T/CmLMDNpxsc1qt857nz7RFBMM+dNs5h/Bh0t++i01 JJd/ykqdfUL8nHRwDO1Fkz/R5wugeJ/dB0TcqpnArjtTc+KVN/lRYfltEc5j0DqvFRwk3Ztd 5KocWrWD/MBAvZVYKzJ9Bov9FGRUIGDDTJyo5VVCSe1IeSYa9sJhBBgRCgAJBQJUnaPSAhsM AAoJEMjW4VIB7p2h7ewBAMBCaE8lh2MyK8PBZ2rOSEYIQNjxADPt9Mri7CLnZxtPAQCwCO+a x4WXJV0T1ZOOFa/esCB72RkEVZ7ArkTKQDnVng== Message-ID: <1af79bfb-57f9-da16-8aea-ba6d33bb7eca@hyperbola.info> Date: Sat, 9 Feb 2019 12:04:04 -0200 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:52.0) Gecko/20100101 Icedove/52.9.1 MIME-Version: 1.0 In-Reply-To: <20190203235204.63970587@parabola> Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="fv07DOV16rq8z5Rwk05RIQlTM2c7yK1pF" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --fv07DOV16rq8z5Rwk05RIQlTM2c7yK1pF Content-Type: multipart/mixed; boundary="XhxPwm5zC00njXLOgKKWbCtxwcjnxbngP"; protected-headers="v1" From: Adonay Felipe Nogueira To: Workgroup for fully free GNU/Linux distributions , guix-devel@gnu.org Cc: 28004@debbugs.gnu.org Message-ID: <1af79bfb-57f9-da16-8aea-ba6d33bb7eca@hyperbola.info> Subject: Re: [GNU-linux-libre] [PATCH] gnu: Add ungoogled-chromium. References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> In-Reply-To: <20190203235204.63970587@parabola> --XhxPwm5zC00njXLOgKKWbCtxwcjnxbngP Content-Type: text/plain; charset=utf-8 Content-Language: en-US Content-Transfer-Encoding: quoted-printable Em 04/02/2019 02:52, bill-auger escreveu: > re: https://lists.gnu.org/archive/html/guix-devel/2019-02/msg00009.html= >=20 > i would like to remind readers of the guix-devel list that it was > discussed some months ago, why no FSDG distros currently distribute > chromium[1] - it appeared at that time, that most people in that > discussion were in agreement that chromium should not be included in > guix; and marius was instead hosting it in a private repo, as not to > taint the main guix repos with dubious software - has there been a > notable break-through since then? >=20 > what is the evidence for this claim that this guix package is "free > software only"? - what does "Marks beautiful computed-origin-method" do= > toward that end? - if a procedure for liberating any chromium-derived > software has been discovered, this would be a marvelous accomplishment > and very good news indeed, of which people outside of the guix dev team= > would also be interested to learn On this matter, I think this discussion and also the review should be tracked either in a bug report or in the Free Software Directory wiki talk page about Chromium package/entry[1], this one also has a partial review still to be finished. Besides, the last time I read the FSD's entry inclusion requirements (about June, 2018) I was informed also in IRC that they have plans to make the FSD mimic the requirements of the GNU FSDG so that free/libre system distributions would have an easier time getting a list of reviewed packages for inclusion. That means that the FSD would also have the requirements from the GNU FSDG regarding not including malware and not steering towards non-free functional data. There are optional things to consider, for which the Antifeature Project Team is working on drafting[2], although these are not requirements for inclusion in the FSD. Regarding the review results in the page referenced by [1], please keep in mind that the torrents have no trackers, so please share/seed with DHT and PEX enabled so others can discover the shares too. Another alternative is of course to ditch Chromium and Ungoogled-Chromium and focus on Iridium Browser[3]. Anyways, if you do want to see progress in the Chromium review, please contribute by downloading, seeding and also actually reviewing parts of the reports generated. The last stop is marked with "Continue.". I did start the review, but I'm not the most experienced person in regards to all of legal, security and privacy matters. Just remember to remake a torrent with the modified report and change the old hash in the page to the new one you're seeding if you do make changes to the report, and mark/save the change as major so that other people get notified. Lastly, bill-auger's question of which should be the "assumed value" for the GNU FSDG compliance status of a unreviewed package, based on various proofs related to the dangers of non-free software (well, gnu.org has a page with these reports/news[4]) and also on the reasoning given by Richard Stallman in his talks[5], the unreviewed entries should be considered non-free. [1] https://directory.fsf.org/wiki/Talk:Chromium [2] https://directory.fsf.org/wiki/Free_Software_Directory:Antifeatures [3] https://directory.fsf.org/wiki/Iridium_Browser [4] https://www.gnu.org/proprietary/proprietary.html [5] http://audio-video.gnu.org/video/2015-10-24--rms--free-software-and-your-= freedom--seagl--speech.ogv --XhxPwm5zC00njXLOgKKWbCtxwcjnxbngP-- --fv07DOV16rq8z5Rwk05RIQlTM2c7yK1pF Content-Type: application/pgp-signature; name="signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="signature.asc" -----BEGIN PGP SIGNATURE----- Version: GnuPG v2 iF4EAREIAAYFAlxe3ekACgkQyNbhUgHunaHVMgD/VOrTN6R1GtfuIy4Dpa6Vz4Ri C/sT4razWvFci3gj008BANmGgsKd7ZH8kabZh3Ru5jLvQC22fRFw80wGkWR59Y7m =+SvO -----END PGP SIGNATURE----- --fv07DOV16rq8z5Rwk05RIQlTM2c7yK1pF-- From debbugs-submit-bounces@debbugs.gnu.org Tue Feb 12 10:58:42 2019 Received: (at 28004) by debbugs.gnu.org; 12 Feb 2019 15:58:42 +0000 Received: from localhost ([127.0.0.1]:45053 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gtaS5-0005Cg-II for submit@debbugs.gnu.org; Tue, 12 Feb 2019 10:58:42 -0500 Received: from out2-smtp.messagingengine.com ([66.111.4.26]:42931) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gtaRz-0005CP-O8 for 28004@debbugs.gnu.org; Tue, 12 Feb 2019 10:58:25 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id 6990C226C0; Tue, 12 Feb 2019 10:58:18 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute5.internal (MEProxy); Tue, 12 Feb 2019 10:58:18 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:date:message-id:in-reply-to:references :mime-version:content-type:content-transfer-encoding; s=fm2; bh= FTWIwa8KxfUYE3HezGvfT42avpRBR19sq4hxUfC/6Yc=; b=icRUHuPYjAo3X9yi c3eDn6SYLougVnR6uCr/qEcG12Hc2AMhP25/mTm0nmmx4GsVTLzhmyTl/Oh+iCiH rhVIF7mwM7ODHIE4Y+Dyjgq8nQoMGY3iNxweYSWye9qQbd2NO/Hk5oIe5gLnziF5 Myl8o8zamSv7egnojmw0dyD7F2qW4kEf+FvaJVxRdvnrR3YEcIuaiN/0zkmOnUts lyNrY8ApgkXe5l73xV9wrVtdJ/31ikmrYU7h/Qn2wYnJEfEl4veZvidiMM2+sY4M EGFTgLy0H0Bxl+s8/uxVa5j6MOm9izYQNkxWWrJhXckr6uGxvG3MWYM5HexGJ2NU k91SeA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-transfer-encoding:content-type :date:from:in-reply-to:message-id:mime-version:references :subject:to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender :x-sasl-enc; s=fm2; bh=FTWIwa8KxfUYE3HezGvfT42avpRBR19sq4hxUfC/6 Yc=; b=f7MPP+nRASisadWjGAHywHQwLoA74v9mCCUDhkfSkc7iXTFAishwN4QhA /VDZixMV5nmnghbAhiO5dIAff3q0k5nwYH4BkMgFLQrasRwWhhq321L+1mPK53uw mG7q2ySV3oUwDA61yvSMb+ZypQq9gRKTRPRciNewImJl4RZzuYbUuIuLKRV7WeTm wYH//WOjnsVuLAp4wzofqidk+L5tL2TvjoiHE2uXxMg/1b14Nykp11l7qF/uIsyo Aqew7tAc6/Xxhz/7XoroN1sXSz79WqVTvgZiF3Nnn5S3liJkR3gnbDpeYxeTgx9C K4mTN8xUsVcD43tfP18FRJDeOrQnw== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedtledruddtuddgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhhtnecuuegrihhlohhuthemucef tddtnecunecujfgurhephffvufffkffojghfgggtgfesthekredtredtjeenucfhrhhomh epofgrrhhiuhhsuceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheq necuffhomhgrihhnpegthhhrohhmihhumhdrohhrghdpghhuihigqdhprhhofhhilhgvrd hruhhnpdhgihhthhhusgdrtghomhdpghhoohhglhgvrghpihhsrdgtohhmpdhgnhhurdho rhhgnecukfhppeeivddrudeirddvvdeirddugedtnecurfgrrhgrmhepmhgrihhlfhhroh hmpehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmnecuvehluhhsthgvrhfuihiivgep td X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 79A98E4046; Tue, 12 Feb 2019 10:58:16 -0500 (EST) From: Marius Bakke To: guix-devel@gnu.org Subject: [PATCH v2] gnu: Add ungoogled-chromium. Date: Tue, 12 Feb 2019 16:58:15 +0100 Message-Id: <20190212155815.23817-1-mbakke@fastmail.com> X-Mailer: git-send-email 2.20.1 In-Reply-To: <20190202192023.22087-1-mbakke@fastmail.com> References: <20190202192023.22087-1-mbakke@fastmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) Changes in this version: * New upstream release. * No longer using a fork of Ungoogled-Chromium. * The special HarfBuzz and libvpx variants have been removed due to obsolesence. Enjoy (or despair)! Comments appreciated. * gnu/packages/aux-files/chromium/master-preferences.json, gnu/packages/chromium.scm: New files. * gnu/local.mk (GNU_SYSTEM_MODULES): Adjust accordingly. --- gnu/local.mk | 1 + .../chromium/master-preferences.json | 26 + gnu/packages/chromium.scm | 726 ++++++++++++++++++ 3 files changed, 753 insertions(+) create mode 100644 gnu/packages/aux-files/chromium/master-preferences.json create mode 100644 gnu/packages/chromium.scm diff --git a/gnu/local.mk b/gnu/local.mk index 154b03313a..1496bae066 100644 --- a/gnu/local.mk +++ b/gnu/local.mk @@ -100,6 +100,7 @@ GNU_SYSTEM_MODULES = \ %D%/packages/check.scm \ %D%/packages/chemistry.scm \ %D%/packages/chez.scm \ + %D%/packages/chromium.scm \ %D%/packages/ci.scm \ %D%/packages/cinnamon.scm \ %D%/packages/clojure.scm \ diff --git a/gnu/packages/aux-files/chromium/master-preferences.json b/gnu/packages/aux-files/chromium/master-preferences.json new file mode 100644 index 0000000000..5a2049fa72 --- /dev/null +++ b/gnu/packages/aux-files/chromium/master-preferences.json @@ -0,0 +1,26 @@ +{ + "distribution": { + "import_bookmarks": false, + "make_chrome_default": false, + "make_chrome_default_for_user": false, + "verbose_logging": true, + "skip_first_run_ui": true, + "suppress_first_run_default_browser_prompt": true + }, + "browser": { + "has_seen_welcome_page" : true, + "check_default_browser" : false + }, + "dns_prefetching": { + "enabled": false + }, + "alternate_error_pages": { + "enabled": false + }, + "hardware": { + "audio_capture_enabled": false + }, + "default_apps": "noinstall", + "hide_web_store_icon": true, + "homepage": "https://www.gnu.org/software/guix/" +} diff --git a/gnu/packages/chromium.scm b/gnu/packages/chromium.scm new file mode 100644 index 0000000000..85e96131e3 --- /dev/null +++ b/gnu/packages/chromium.scm @@ -0,0 +1,726 @@ +;;; GNU Guix --- Functional package management for GNU +;;; Copyright © 2019 Marius Bakke +;;; +;;; This file is part of GNU Guix. +;;; +;;; GNU Guix is free software; you can redistribute it and/or modify it +;;; under the terms of the GNU General Public License as published by +;;; the Free Software Foundation; either version 3 of the License, or (at +;;; your option) any later version. +;;; +;;; GNU Guix is distributed in the hope that it will be useful, but +;;; WITHOUT ANY WARRANTY; without even the implied warranty of +;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +;;; GNU General Public License for more details. +;;; +;;; You should have received a copy of the GNU General Public License +;;; along with GNU Guix. If not, see . + +(define-module (gnu packages chromium) + #:use-module ((guix licenses) #:prefix license:) + #:use-module (guix packages) + #:use-module (guix gexp) + #:use-module (guix store) + #:use-module (guix monads) + #:use-module (guix download) + #:use-module (guix git-download) + #:use-module (guix utils) + #:use-module (guix build-system gnu) + #:use-module (gnu packages) + #:use-module (gnu packages assembly) + #:use-module (gnu packages base) + #:use-module (gnu packages bison) + #:use-module (gnu packages build-tools) + #:use-module (gnu packages compression) + #:use-module (gnu packages cups) + #:use-module (gnu packages curl) + #:use-module (gnu packages fontutils) + #:use-module (gnu packages gcc) + #:use-module (gnu packages ghostscript) + #:use-module (gnu packages gl) + #:use-module (gnu packages glib) + #:use-module (gnu packages gnome) + #:use-module (gnu packages gnuzilla) + #:use-module (gnu packages gperf) + #:use-module (gnu packages gtk) + #:use-module (gnu packages icu4c) + #:use-module (gnu packages image) + #:use-module (gnu packages libevent) + #:use-module (gnu packages libffi) + #:use-module (gnu packages linux) + #:use-module (gnu packages kerberos) + #:use-module (gnu packages ninja) + #:use-module (gnu packages node) + #:use-module (gnu packages pciutils) + #:use-module (gnu packages pkg-config) + #:use-module (gnu packages pulseaudio) + #:use-module (gnu packages python) + #:use-module (gnu packages python-web) + #:use-module (gnu packages python-xyz) + #:use-module (gnu packages regex) + #:use-module (gnu packages serialization) + #:use-module (gnu packages speech) + #:use-module (gnu packages tls) + #:use-module (gnu packages valgrind) + #:use-module (gnu packages vulkan) + #:use-module (gnu packages video) + #:use-module (gnu packages xiph) + #:use-module (gnu packages xml) + #:use-module (gnu packages xdisorg) + #:use-module (gnu packages xorg)) + +(define %preserved-third-party-files + '("base/third_party/dmg_fp" ;X11-style + "base/third_party/dynamic_annotations" ;BSD-2 + "base/third_party/icu" ;Unicode, X11-style + "base/third_party/superfasthash" ;BSD-3 + "base/third_party/symbolize" ;BSD-3 + "base/third_party/xdg_mime" ;LGPL2.1+ or Academic 2.0 + "base/third_party/xdg_user_dirs" ;Expat + "chrome/third_party/mozilla_security_manager" ;MPL-1.1/GPL2+/LGPL2.1+ + "courgette/third_party/bsdiff" ;BSD-2, BSD protection license + "courgette/third_party/divsufsort" ;Expat + "net/third_party/http2" ;BSD-3 + "net/third_party/mozilla_security_manager" ;MPL-1.1/GPL2+/LGPL2.1+ + "net/third_party/nss" ;MPL-2.0 + "net/third_party/quic" ;BSD-3 + "net/third_party/spdy" ;BSD-3 + "net/third_party/uri_template" ;ASL2.0 + "third_party/abseil-cpp" ;ASL2.0 + "third_party/adobe/flash/flapper_version.h" ;no license, trivial + "third_party/angle" ;BSD-3 + "third_party/angle/src/common/third_party/base" ;BSD-3 + "third_party/angle/src/common/third_party/smhasher" ;Public domain + "third_party/angle/src/common/third_party/xxhash" ;BSD-2 + "third_party/angle/src/third_party/compiler" ;BSD-2 + "third_party/angle/src/third_party/libXNVCtrl" ;Expat + "third_party/angle/src/third_party/trace_event" ;BSD-3 + "third_party/angle/third_party/glslang" ;BSD-3 + "third_party/angle/third_party/spirv-headers" ;Expat + "third_party/angle/third_party/spirv-tools" ;Expat + "third_party/angle/third_party/vulkan-headers" ;ASL2.0 + "third_party/angle/third_party/vulkan-loader" ;ASL2.0 + "third_party/angle/third_party/vulkan-tools" ;ASL2.0 + "third_party/angle/third_party/vulkan-validation-layers" ;ASL2.0 + "third_party/apple_apsl" ;APSL2.0 + "third_party/blink" ;BSD-3 + "third_party/boringssl" ;OpenSSL/ISC (Google additions are ISC) + "third_party/boringssl/src/third_party/fiat" ;Expat + "third_party/breakpad" ;BSD-3 + "third_party/brotli" ;Expat + "third_party/cacheinvalidation" ;ASL2.0 + "third_party/catapult" ;BSD-3 + "third_party/catapult/common/py_vulcanize/third_party/rcssmin" ;ASL2.0 + "third_party/catapult/common/py_vulcanize/third_party/rjsmin" ;ASL2.0 + "third_party/catapult/third_party/polymer" ;BSD-3 + "third_party/catapult/tracing/third_party/d3" ;BSD-3 + "third_party/catapult/tracing/third_party/gl-matrix" ;Expat + "third_party/catapult/tracing/third_party/jszip" ;Expat or GPL3 + "third_party/catapult/tracing/third_party/mannwhitneyu" ;Expat + "third_party/catapult/tracing/third_party/oboe" ;BSD-2 + "third_party/catapult/tracing/third_party/pako" ;Expat + "third_party/ced" ;BSD-3 + "third_party/cld_3" ;ASL2.0 + "third_party/crashpad" ;ASL2.0 + "third_party/crashpad/crashpad/third_party/zlib/zlib_crashpad.h" ;Zlib + "third_party/crc32c" ;BSD-3 + "third_party/cros_system_api" ;BSD-3 + "third_party/dom_distiller_js" ;BSD-3 + "third_party/fips181" ;BSD-3 + "third_party/flatbuffers" ;ASL2.0 + "third_party/google_input_tools" ;ASL2.0 + "third_party/google_input_tools/third_party/closure_library" ;ASL2.0 + "third_party/google_input_tools/third_party/closure_library/third_party/closure" ;Expat + "third_party/googletest" ;BSD-3 + "third_party/hunspell" ;MPL1.1/GPL2+/LGPL2.1+ + "third_party/iccjpeg" ;IJG + "third_party/inspector_protocol" ;BSD-3 + "third_party/jinja2" ;BSD-3 + "third_party/jstemplate" ;ASL2.0 + "third_party/khronos" ;Expat, SGI + "third_party/leveldatabase" ;BSD-3 + "third_party/libXNVCtrl" ;Expat + "third_party/libaddressinput" ;ASL2.0 + "third_party/libaom" ;BSD-2 or "Alliance for Open Media Patent License 1.0" + "third_party/libaom/source/libaom/third_party/vector" ;Expat + "third_party/libaom/source/libaom/third_party/x86inc" ;ISC + "third_party/libjingle_xmpp" ;BSD-3 + "third_party/libphonenumber" ;ASL2.0 + "third_party/libsecret" ;LGPL2.1+ + "third_party/libsrtp" ;BSD-3 + "third_party/libsync" ;ASL2.0 + "third_party/libudev" ;LGPL2.1+ + "third_party/libwebm" ;BSD-3 + "third_party/libxml/chromium" ;BSD-3 + "third_party/libyuv" ;BSD-3 + "third_party/lss" ;BSD-3 + "third_party/markupsafe" ;BSD-3 + "third_party/mesa_headers" ;Expat, SGI + "third_party/metrics_proto" ;BSD-3 + "third_party/modp_b64" ;BSD-3 + "third_party/nasm" ;BSD-2 + "third_party/node" ;Expat + "third_party/node/node_modules/polymer-bundler/lib/third_party/UglifyJS2" ;BSD-2 + "third_party/ots" ;BSD-3 + "third_party/pdfium" ;BSD-3 + "third_party/pdfium/third_party/agg23" ;Expat + "third_party/pdfium/third_party/base" ;BSD-3 + "third_party/pdfium/third_party/bigint" ;Public domain, BSD-3 + "third_party/pdfium/third_party/skia_shared" ;BSD-3 + "third_party/pdfium/third_party/freetype/include/pstables.h" ;FreeType + "third_party/ply" ;BSD-3 + "third_party/polymer" ;BSD-3 + "third_party/protobuf" ;BSD-3 + "third_party/protobuf/third_party/six" ;Expat + "third_party/pyjson5" ;ASL2.0 + "third_party/qcms" ;Expat + "third_party/rnnoise" ;BSD-3 + "third_party/s2cellid" ;ASL2.0 + "third_party/sfntly" ;ASL2.0 + "third_party/skia" ;BSD-3 + "third_party/skia/third_party/gif" ;MPL1.1/GPL2+/LGPL2.1+ + "third_party/skia/third_party/skcms" ;BSD-3 + "third_party/skia/third_party/vulkan" ;BSD-3 + "third_party/smhasher" ;Expat, public domain + "third_party/speech-dispatcher" ;GPL2+ + "third_party/spirv-headers" ;ASL2.0 + "third_party/SPIRV-Tools" ;ASL2.0 + "third_party/sqlite" ;Public domain + "third_party/ungoogled" ;BSD-3 + "third_party/usb_ids" ;BSD-3 + "third_party/usrsctp" ;BSD-2 + "third_party/web-animations-js" ;ASL2.0 + "third_party/webdriver" ;ASL2.0 + "third_party/webrtc" ;BSD-3 + "third_party/webrtc/common_audio/third_party/fft4g" ;Non-copyleft + "third_party/webrtc/common_audio/third_party/spl_sqrt_floor" ;Public domain + "third_party/webrtc/modules/third_party/fft" ;Non-copyleft + "third_party/webrtc/modules/third_party/g711" ;Public domain + "third_party/webrtc/modules/third_party/g722" ;Public domain + "third_party/webrtc/rtc_base/third_party/base64" ;Non-copyleft + "third_party/webrtc/rtc_base/third_party/sigslot" ;Public domain + "third_party/widevine/cdm/widevine_cdm_version.h" ;BSD-3 + "third_party/widevine/cdm/widevine_cdm_common.h" ;BSD-3 + "third_party/woff2" ;ASL2.0 + "third_party/xdg-utils" ;Expat + "third_party/yasm/run_yasm.py" ;BSD-2 or BSD-3 + "third_party/zlib/google" ;BSD-3 + "url/third_party/mozilla" ;BSD-3, MPL1.1/GPL2+/LGPL2.1+ + "v8/src/third_party/utf8-decoder" ;Expat + "v8/src/third_party/valgrind" ;BSD-4 + "v8/third_party/inspector_protocol" ;BSD-3 + "v8/third_party/v8/builtins")) ;PSFL + +(define* (computed-origin-method gexp-promise hash-algo hash + #:optional (name "source") + #:key (system (%current-system)) + (guile (default-guile))) + "Return a derivation that executes the G-expression that results +from forcing GEXP-PROMISE." + (mlet %store-monad ((guile (package->derivation guile system))) + (gexp->derivation (or name "computed-origin") + (force gexp-promise) + #:system system + #:guile-for-build guile))) + +(define %chromium-version "72.0.3626.96") +(define %ungoogled-revision "82b1194615a6542c28edfc5505d357c9dfca88c7") + +;; This is a "computed" origin that does the following: +;; 1) Runs the Ungoogled scripts on a pristine Chromium tarball. +;; 2) Prunes all third_party folders that are not explicitly preserved. +;; 3) Adjusts "GN" build files such that system libraries are preferred. +(define ungoogled-chromium-source + (let* ((chromium-source + (origin + (method url-fetch) + (uri (string-append "https://commondatastorage.googleapis.com" + "/chromium-browser-official/chromium-" + %chromium-version ".tar.xz")) + (sha256 + (base32 + "0fxavi4nwfiyb15lqm02vlq6kb8i4ipxnd7hp45bm7jdmhmgbnmj")))) + (ungoogled-source + (origin + (method git-fetch) + (uri (git-reference (url "https://github.com/Eloston/ungoogled-chromium") + (commit %ungoogled-revision))) + (file-name (git-file-name "ungoogled-chromium" + (string-take %ungoogled-revision 7))) + (sha256 + (base32 + "067bccrv67wh8p0vak0n38gc8mvb9hvx2pz83r0y1iiqkhrglnp3"))))) + + (origin + (method computed-origin-method) + (file-name (string-append "ungoogled-chromium-" %chromium-version ".tar.xz")) + (sha256 #f) + (uri + (delay + (with-imported-modules '((guix build utils)) + #~(begin + (use-modules (guix build utils)) + (let ((chromium-dir (string-append "chromium-" #$%chromium-version)) + (preserved-files (list #$@%preserved-third-party-files))) + + (mkdir "/tmp/bin") + (set-path-environment-variable + "PATH" '("bin") + (list "/tmp" + #+(canonical-package patch) + #+(canonical-package xz) + #+(canonical-package tar) + #+python-2 + #+python)) + + (copy-recursively #+ungoogled-source "/tmp/ungoogled") + + (with-directory-excursion "/tmp/ungoogled" + + ;; Create a custom "bundle" that inherits from linux_rooted + ;; and adds an additional patch. + (format #t "Creating Guix config bundle...~%") + (force-output) + (mkdir-p "config_bundles/guix") + (call-with-output-file "config_bundles/guix/bundlemeta.ini" + (lambda (port) + (format port + "[bundle] +display_name = GNU Guix +depends = linux_rooted\n"))) + (call-with-output-file "config_bundles/guix/patch_order.list" + (lambda (port) + (format port "debian_buster/system/openjpeg.patch\n"))) + + (format #t "Unpacking chromium tarball...~%") + (force-output) + (invoke "tar" "xf" #+chromium-source) + + (format #t "Ungooglifying...~%") + (force-output) + (invoke "python3" "run_buildkit_cli.py" "prune" + "-b" "config_bundles/guix" chromium-dir) + (invoke "python3" "run_buildkit_cli.py" "patches" "apply" + "-b" "config_bundles/guix" chromium-dir) + (invoke "python3" "run_buildkit_cli.py" "domains" "apply" + "-b" "config_bundles/linux_rooted" + "-c" "/tmp/domainscache.tar.gz" chromium-dir) + + (with-directory-excursion chromium-dir + (format #t "Pruning third party files...~%") + (force-output) + (apply invoke "python" + "build/linux/unbundle/remove_bundled_libraries.py" + "--do-remove" preserved-files) + + (format #t "Replacing GN files...~%") + (force-output) + (invoke "python3" "build/linux/unbundle/replace_gn_files.py" + "--system-libraries" "ffmpeg" "flac" "fontconfig" + "freetype" "harfbuzz-ng" "icu" "libdrm" "libevent" + "libjpeg" "libpng" "libvpx" "libwebp" "libxml" + "libxslt" "openh264" "opus" "re2" "snappy" "yasm" + "zlib")) + + (format #t (string-append "Packing new Ungoogled tarball ...~%")) + (force-output) + (invoke "tar" "cvfa" #$output + ;; Avoid non-determinism in the archive. + "--mtime=@0" + "--owner=root:0" + "--group=root:0" + "--sort=name" + chromium-dir) + + #t))))))))) + +(define opus+custom + (package/inherit opus + (name "opus+custom") + (arguments + (substitute-keyword-arguments (package-arguments opus) + ((#:configure-flags flags ''()) + ;; Opus Custom is an optional extension of the Opus + ;; specification that allows for unsupported frame + ;; sizes. Chromium requires that this is enabled. + `(cons "--enable-custom-modes" + ,flags)))))) + +(define-public ungoogled-chromium + (package + (name "ungoogled-chromium") + (version %chromium-version) + (synopsis "Graphical web browser") + (source ungoogled-chromium-source) + (build-system gnu-build-system) + (arguments + `(#:tests? #f + ;; FIXME: There is a "gn" option specifically for setting -rpath, but + ;; it overrides the RUNPATH set by the linker. + #:validate-runpath? #f + #:modules ((guix build gnu-build-system) + (guix build utils) + (ice-9 ftw) + (ice-9 regex) + (srfi srfi-26)) + #:configure-flags + ;; See tools/gn/docs/cookbook.md and + ;; https://www.chromium.org/developers/gn-build-configuration + ;; for usage. Run "./gn args . --list" in the Release + ;; directory for an exhaustive list of supported flags. + ;; (Note: The 'configure' phase will do that for you.) + (list "is_debug=false" + "use_gold=false" + "use_lld=false" + "linux_use_bundled_binutils=false" + "use_custom_libcxx=false" + "use_sysroot=false" + "enable_precompiled_headers=false" + "goma_dir=\"\"" + "enable_nacl=false" + "enable_nacl_nonsfi=false" + "use_allocator=\"none\"" ;don't use tcmalloc + "use_unofficial_version_number=false" + + ;; Define a custom toolchain that simply looks up CC, AR and + ;; friends from the environment. + "custom_toolchain=\"//build/toolchain/linux/unbundle:default\"" + "host_toolchain=\"//build/toolchain/linux/unbundle:default\"" + + ;; Don't assume it's clang. + "is_clang=false" + + ;; Optimize for building everything at once, as opposed to + ;; incrementally for development. See "docs/jumbo.md". + "use_jumbo_build=true" + + ;; Disable type-checking for the Web UI to avoid a Java dependency. + "closure_compile=false" + + ;; Disable debugging features to save space. + "blink_symbol_level=0" + "enable_iterator_debugging=false" + + ;; Some of the unbundled libraries throws deprecation + ;; warnings, etc. Ignore it. + "treat_warnings_as_errors=false" + + ;; Don't add any API keys. End users can set them in the + ;; environment if desired. See + ;; . + "use_official_google_api_keys=false" + + ;; Disable "safe browsing", which pulls in a dependency on + ;; the nonfree "unrar" program (as of m66). + "safe_browsing_mode=0" + + ;; Disable "field trials". + "fieldtrial_testing_like_official_build=true" + + ;; Ungoogled components. + "enable_mdns=false" + "enable_one_click_signin=false" + "enable_reading_list=false" + "enable_remoting=false" + "enable_reporting=false" + "enable_service_discovery=false" + "enable_swiftshader=false" + "use_vaapi=true" + + ;; Use system libraries where possible. + "use_system_freetype=true" + "use_system_harfbuzz=true" + "use_system_lcms2=true" + "use_system_libdrm=true" + "use_system_libjpeg=true" + "use_system_libpng=true" + ;;"use_system_libsync=true" + "use_system_zlib=true" + + "use_gnome_keyring=false" ;deprecated by libsecret + "use_openh264=true" + "use_pulseaudio=true" + "link_pulseaudio=true" + + ;; Don't arbitrarily restrict formats supported by system ffmpeg. + "proprietary_codecs=true" + "ffmpeg_branding=\"Chrome\"" + + ;; WebRTC stuff. + "rtc_use_h264=true" + ;; Don't use bundled sources. + "rtc_build_json=false" + "rtc_build_libevent=false" + "rtc_build_libvpx=false" + "rtc_build_opus=false" + "rtc_build_ssl=false" + + "rtc_build_libsrtp=true" ;FIXME: fails to find headers + "rtc_build_usrsctp=true" ;TODO: package this + (string-append "rtc_jsoncpp_root=\"" + (assoc-ref %build-inputs "jsoncpp") + "/include/jsoncpp/json\"") + (string-append "rtc_ssl_root=\"" + (assoc-ref %build-inputs "openssl") + "/include/openssl\"")) + #:phases + (modify-phases %standard-phases + (add-after 'unpack 'patch-stuff + (lambda* (#:key inputs #:allow-other-keys) + (substitute* "printing/cups_config_helper.py" + (("cups_config =.*") + (string-append "cups_config = '" (assoc-ref inputs "cups") + "/bin/cups-config'\n"))) + + (substitute* + '("base/process/launch_posix.cc" + "base/third_party/dynamic_annotations/dynamic_annotations.c" + "sandbox/linux/seccomp-bpf/sandbox_bpf.cc" + "sandbox/linux/services/credentials.cc" + "sandbox/linux/services/namespace_utils.cc" + "sandbox/linux/services/syscall_wrappers.cc" + "sandbox/linux/syscall_broker/broker_host.cc") + (("include \"base/third_party/valgrind/") "include \"valgrind/")) + + (for-each (lambda (file) + (substitute* file + ;; Fix opus include path. + ;; Do not substitute opus_private.h. + (("#include \"opus\\.h\"") + "#include \"opus/opus.h\"") + (("#include \"opus_custom\\.h\"") + "#include \"opus/opus_custom.h\"") + (("#include \"opus_defines\\.h\"") + "#include \"opus/opus_defines.h\"") + (("#include \"opus_multistream\\.h\"") + "#include \"opus/opus_multistream.h\"") + (("#include \"opus_types\\.h\"") + "#include \"opus/opus_types.h\""))) + (find-files (string-append "third_party/webrtc/modules" + "/audio_coding/codecs/opus"))) + + (substitute* "chrome/common/chrome_paths.cc" + (("/usr/share/chromium/extensions") + ;; TODO: Add ~/.guix-profile. + "/run/current-system/profile/share/chromium/extensions")) + + ;; XXX: Should be unnecessary when use_system_lcms2=true. + (substitute* "third_party/pdfium/core/fxcodec/codec/ccodec_iccmodule.h" + (("include \"third_party/lcms/include/lcms2\\.h\"") + "include \"lcms2.h\"")) + + (substitute* + "third_party/breakpad/breakpad/src/common/linux/libcurl_wrapper.h" + (("include \"third_party/curl") "include \"curl")) + + (substitute* "third_party/webrtc/rtc_base/strings/json.h" + (("#include \"third_party/jsoncpp/") "#include \"json/")) + + (substitute* "media/base/decode_capabilities.cc" + (("third_party/libvpx/source/libvpx/") "")) + + (substitute* "ui/gfx/skia_util.h" + (("third_party/vulkan/include/") "")) + + ;; Building chromedriver embeds some files using the ZIP + ;; format which doesn't support timestamps before + ;; 1980. Therefore, advance the timestamps of the files + ;; which are included so that building chromedriver + ;; works. + (let ((circa-1980 (* 10 366 24 60 60))) + (for-each (lambda (file) + (utime file circa-1980 circa-1980)) + '("chrome/test/chromedriver/extension/background.js" + "chrome/test/chromedriver/extension/manifest.json"))) + + #t)) + (add-before 'configure 'prepare-build-environment + (lambda* (#:key inputs #:allow-other-keys) + + ;; Make sure the right build tools are used. + (setenv "AR" "ar") (setenv "NM" "nm") + (setenv "CC" "gcc") (setenv "CXX" "g++") + + ;; Work around . + (unsetenv "C_INCLUDE_PATH") + (unsetenv "CPLUS_INCLUDE_PATH") + + ;; TODO: pre-compile instead. Avoids a race condition. + (setenv "PYTHONDONTWRITEBYTECODE" "1") + + ;; XXX: How portable is this. + (mkdir-p "third_party/node/linux/node-linux-x64") + (symlink (string-append (assoc-ref inputs "node") "/bin") + "third_party/node/linux/node-linux-x64/bin") + + #t)) + (replace 'configure + (lambda* (#:key configure-flags #:allow-other-keys) + (let ((args (string-join configure-flags " "))) + ;; Generate ninja build files. + (invoke "gn" "gen" "out/Release" + (string-append "--args=" args)) + + ;; Print the full list of supported arguments as well as + ;; their current status for convenience. + (format #t "Dumping configure flags...\n") + (invoke "gn" "args" "out/Release" "--list")))) + (replace 'build + (lambda* (#:key outputs #:allow-other-keys) + (invoke "ninja" "-C" "out/Release" + "-j" (number->string (parallel-job-count)) + "chrome" + "chromedriver"))) + (replace 'install + (lambda* (#:key inputs outputs #:allow-other-keys) + (let* ((out (assoc-ref outputs "out")) + (bin (string-append out "/bin")) + (exe (string-append bin "/chromium")) + (lib (string-append out "/lib")) + (man (string-append out "/share/man/man1")) + (applications (string-append out "/share/applications")) + (install-regexp (make-regexp "\\.(bin|pak)$")) + (locales (string-append lib "/locales")) + (resources (string-append lib "/resources")) + (preferences (assoc-ref inputs "master-preferences")) + (gtk+ (assoc-ref inputs "gtk+")) + (mesa (assoc-ref inputs "mesa")) + (nss (assoc-ref inputs "nss")) + (udev (assoc-ref inputs "udev")) + (sh (which "sh"))) + + (substitute* '("chrome/app/resources/manpage.1.in" + "chrome/installer/linux/common/desktop.template") + (("@@MENUNAME@@") "Chromium") + (("@@PACKAGE@@") "chromium") + (("/usr/bin/@@USR_BIN_SYMLINK_NAME@@") exe)) + + (mkdir-p man) + (copy-file "chrome/app/resources/manpage.1.in" + (string-append man "/chromium.1")) + + (mkdir-p applications) + (copy-file "chrome/installer/linux/common/desktop.template" + (string-append applications "/chromium.desktop")) + + (mkdir-p lib) + (copy-file preferences (string-append lib "/master_preferences")) + + (with-directory-excursion "out/Release" + (for-each (lambda (file) + (install-file file lib)) + (scandir "." (cut regexp-exec install-regexp <>))) + (copy-file "chrome" (string-append lib "/chromium")) + + ;; TODO: Install icons from "../../chrome/app/themes" into + ;; "out/share/icons/hicolor/$size". + (install-file + "product_logo_48.png" + (string-append out "/share/icons/48x48/chromium.png")) + + (copy-recursively "locales" locales) + (copy-recursively "resources" resources) + + (mkdir-p bin) + (symlink "../lib/chromium" exe) + (install-file "chromedriver" bin) + + (wrap-program exe + ;; TODO: Get these in RUNPATH. + `("LD_LIBRARY_PATH" ":" prefix + (,(string-append lib ":" nss "/lib/nss:" gtk+ "/lib:" + mesa "/lib:" udev "/lib"))) + ;; Avoid file manager crash. See . + `("XDG_DATA_DIRS" ":" prefix (,(string-append gtk+ "/share")))) + #t))))))) + (native-inputs + `(("bison" ,bison) + ("gcc" ,gcc-8) + ("gn" ,gn) + ("gperf" ,gperf) + ("ninja" ,ninja) + ("node" ,node) + ("pkg-config" ,pkg-config) + ("which" ,which) + ("yasm" ,yasm) + + ;; This file contains defaults for new user profiles. + ("master-preferences" ,(local-file "aux-files/chromium/master-preferences.json")) + + ("python-beautifulsoup4" ,python2-beautifulsoup4) + ("python-html5lib" ,python2-html5lib) + ("python" ,python-2))) + (inputs + `(("alsa-lib" ,alsa-lib) + ("atk" ,atk) + ("cups" ,cups) + ("curl" ,curl) + ("dbus" ,dbus) + ("dbus-glib" ,dbus-glib) + ("expat" ,expat) + ("flac" ,flac) + ("ffmpeg" ,ffmpeg) + ("fontconfig" ,fontconfig) + ("freetype" ,freetype) + ("gdk-pixbuf" ,gdk-pixbuf) + ("glib" ,glib) + ("gtk+" ,gtk+) + ("harfbuzz" ,harfbuzz) + ("icu4c" ,icu4c) + ("jsoncpp" ,jsoncpp) + ("lcms" ,lcms) + ("libevent" ,libevent) + ("libffi" ,libffi) + ("libjpeg-turbo" ,libjpeg-turbo) + ("libpng" ,libpng) + ("libva" ,libva) + ("libvpx" ,libvpx) + ("libwebp" ,libwebp) + ("libx11" ,libx11) + ("libxcb" ,libxcb) + ("libxcomposite" ,libxcomposite) + ("libxcursor" ,libxcursor) + ("libxdamage" ,libxdamage) + ("libxext" ,libxext) + ("libxfixes" ,libxfixes) + ("libxi" ,libxi) + ("libxml2" ,libxml2) + ("libxrandr" ,libxrandr) + ("libxrender" ,libxrender) + ("libxscrnsaver" ,libxscrnsaver) + ("libxslt" ,libxslt) + ("libxtst" ,libxtst) + ("mesa" ,mesa) + ("minizip" ,minizip) + ("mit-krb5" ,mit-krb5) + ("nss" ,nss) + ("openh264" ,openh264) + ("openjpeg" ,openjpeg) ;PDFium only + ("openssl" ,openssl) + ("opus" ,opus+custom) + ("pango" ,pango) + ("pciutils" ,pciutils) + ("pulseaudio" ,pulseaudio) + ("re2" ,re2) + ("snappy" ,snappy) + ("speech-dispatcher" ,speech-dispatcher) + ("udev" ,eudev) + ("valgrind" ,valgrind) + ("vulkan-headers" ,vulkan-headers))) + (home-page "https://www.chromium.org/") + (description + "Ungoogled-Chromium is the Chromium web browser, sans integration with +Google web services.") + ;; Chromium is developed as BSD-3, but bundles a large number of third-party + ;; components with other licenses. For full information, see chrome://credits. + (license (list license:bsd-3 + license:bsd-2 + license:expat + license:asl2.0 + license:mpl1.1 + license:mpl2.0 + license:public-domain + license:isc + (license:non-copyleft "chrome://credits" + "See chrome://credits for more information.") + license:lgpl2.1+)))) -- 2.20.1 From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 16 13:57:19 2019 Received: (at 28004) by debbugs.gnu.org; 16 Feb 2019 18:57:19 +0000 Received: from localhost ([127.0.0.1]:50520 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gv59L-0000xh-2k for submit@debbugs.gnu.org; Sat, 16 Feb 2019 13:57:19 -0500 Received: from ns13.heimat.it ([46.4.214.66]:52170) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gv59J-0000xU-8F for 28004@debbugs.gnu.org; Sat, 16 Feb 2019 13:57:18 -0500 Received: from localhost (ip6-localhost [127.0.0.1]) by ns13.heimat.it (Postfix) with ESMTP id 4AF9530068A; Sat, 16 Feb 2019 18:57:11 +0000 (UTC) X-Virus-Scanned: Debian amavisd-new at ns13.heimat.it Received: from ns13.heimat.it ([127.0.0.1]) by localhost (ns13.heimat.it [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id JQbahTYwX3Ct; Sat, 16 Feb 2019 18:56:51 +0000 (UTC) Received: from bourrache.mug.xelera.it (unknown [93.56.161.211]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by ns13.heimat.it (Postfix) with ESMTPSA id 78D42300680; Sat, 16 Feb 2019 18:56:51 +0000 (UTC) Received: from roquette.mug.biscuolo.net (roquette.mug.biscuolo.net [10.38.2.14]) by bourrache.mug.xelera.it (Postfix) with SMTP id 45E13300056; Sat, 16 Feb 2019 19:56:50 +0100 (CET) Received: (nullmailer pid 4952 invoked by uid 1000); Sat, 16 Feb 2019 18:56:49 -0000 From: Giovanni Biscuolo To: bill-auger , guix-devel@gnu.org Subject: Re: [PATCH] gnu: Add ungoogled-chromium. In-Reply-To: <20190216030021.374f4c82@parabola> Organization: Xelera.eu References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> <87sgx3mbcq.fsf@gnu.org> <87tvhf5f8d.fsf@dustycloud.org> <20190216030021.374f4c82@parabola> Date: Sat, 16 Feb 2019 19:56:41 +0100 Message-ID: <878syfblzq.fsf@roquette.mug.biscuolo.net> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: 28004 Cc: 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.0 (-) --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable Hi guix-devel! this is my humble contribution to this discussion... (I'm not a Guix maintainer) first and foremost, IMHO guix-devel is not the place to discuss GNU FSDG criteria; I'm going to subscribe gnu-linux-libre@nongnu.org to send my comments - and I _have_ some - on the FSDG compliance process if you are interested please follow this thread: http://lists.nongnu.org/archive/html/gnu-linux-libre/2019-02/threads.html#0= 0020 :-D bill-auger writes: [...] > about a year ago, the FSDG review process and criteria for endorsement > of new distros was updated the new FSDG criteria checklist for > community review that was adopted includes the following essential > criteria: > > "Programs commonly known to have freedom issues are liberated or > excluded" > > that criteria is a link to the "software that does not respect the > FSDG" wiki page, for reference, this page: https://libreplanet.org/wiki/Template:FSDG_Checklist > which includes an entry for 'chromium-browser' (the > debian package name) with the liberation procedure being specified as: > > "Remove program/package Use GNU IceCat, or equivalent" [...] > it was also agreed upon at that time, that the FSDG criteria should be > applicable to all currently endorsed distros in perpetuity, so ... thank you for the clarification, Bill: you explained us the entire FSDG_Checklist is *mandatory* for a distro to be GNU FSDG compliant; so there's **no discussion** here if Guix System Distribution wants to remain GNU FSDG compliant - as most if not all Guix contributors would like, I suppose - ungoogled-chromium should still not be included in Guix System Distribution so, regarding this bug #28004 the natural resolution should be to *postpone* the inclusion of this package with a statement like this one: "ungoogled-chromium cannot be included in Guix System Distribution since it is listed - as 'chromium-browser' - on the page that is an integral part of the GNU FSDG Guidelines as extended by the FSDG_Checklist via https://libreplanet.org/wiki/Incoming_distros#Endorsem= ent_Process" Happy hacking! :-) Giovanni [1] https://www.gnu.org/distros/free-system-distribution-guidelines.en.html =2D-=20 Giovanni Biscuolo Xelera IT Infrastructures --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAEBCgAdFiEERcxjuFJYydVfNLI5030Op87MORIFAlxoXOkACgkQ030Op87M ORJVQw/+MeT+OL3S9VySebi3rL1GQkiaE8Qs6F3XPfAQUrcwYJNK+oRzpH3mjrbK 3UO7rUAbnzf6G4rojD4i3SaLa5nsw0z5gO3EpHtOQdx7iX/Ay+4TD0ixH92GLohC RlNgvRuR9i8pzzKJzZ7H7zFdRer2iUdCmaWjvCyhBwMrj/8258H25ZHSQZAdjEzy d/0e5PoQo14jrm7rZhMi+ZOuuZIraA4lTjOI4FS07sHR8hhgs0Rq92EmYAOGwk6v Qo2Ycm41vD1o8Uo2aGiUlRtDNNWfDXqEewoQCD1NzM/xmSb9L0QQ51SVXLQ4eF1Y hStfvvWb+bnIP6+nSzxcdK2s/TCdjNaYaTCASONCBCRJRPYo4UnII/9GoLa+LDFx 4YtfMEoyKu7oMI9yH+t6xYzYRydB/WagPLxpV+G5CK58ZkUcN+2vxlOw0SgzaNL3 /x5seVPgYDhWznmPZoZbM4jyI3e3xHIuZivI8jhGINUlc7XJd3pGZaYSa3uP3CzC alCduWa8fk9dzYFreyULG6sQ3XZ1d+ocgRaI2u5oxy8iG4x5IzSIZLVdXPyqdXvn 4BGPHwQ2j1wdH+dhDC7pHWXmAqnIxnmvr8dX6dAZLV1fHZOjRDfPPKIXsT/L9n94 73Ffx4K5C4GT/MYyWVK+j4gF7ZTCp2V9WgN53kzrUWjX0ozZqhQ= =qVmx -----END PGP SIGNATURE----- --=-=-=-- From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 16 14:48:26 2019 Received: (at 28004) by debbugs.gnu.org; 16 Feb 2019 19:48:26 +0000 Received: from localhost ([127.0.0.1]:50545 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gv5wo-0002C9-94 for submit@debbugs.gnu.org; Sat, 16 Feb 2019 14:48:26 -0500 Received: from relay12.mail.gandi.net ([217.70.178.232]:48695) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gv5wl-0002C1-VE for 28004@debbugs.gnu.org; Sat, 16 Feb 2019 14:48:25 -0500 Received: from [192.168.1.100] (unknown [187.181.183.29]) (Authenticated sender: adfeno@hyperbola.info) by relay12.mail.gandi.net (Postfix) with ESMTPSA id AE966200002; Sat, 16 Feb 2019 19:48:19 +0000 (UTC) Subject: Re: [GNU-linux-libre] [PATCH] gnu: Add ungoogled-chromium. To: Workgroup for fully free GNU/Linux distributions , 28004@debbugs.gnu.org References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> <87sgx3mbcq.fsf@gnu.org> <87tvhf5f8d.fsf@dustycloud.org> <20190216030021.374f4c82@parabola> <87va1kav33.fsf@posteo.net> From: Adonay Felipe Nogueira Openpgp: preference=signencrypt Autocrypt: addr=adfeno@hyperbola.info; prefer-encrypt=mutual; keydata= xsPuBFSdo9IRDACmvQCvDZOHZ33gwVtn//XtEmnlcl1yR6j06qvh2E22aK3bmom1y6HfgAVq l+3R16sL27Y0cEeM12Xl2h1HrFiT3Hd/LGWNVC/osPAKrrs6bMRh3uUdOVWeVuM/7c6n5hvx PAkZ6s70w1+y1ilG19aEpezFybAb9oE7+qBLjKAZPgceHeOxUthdfqDDqc/oenCGVEQNvPzK jQVzE+NnB3KdbGNQKFjTuWutxHjMY61H06a824vMd4SU5ReHlDnhCfasJUYcT6ykijf5xeCU icLvLowZl3rCjzjxFxKGnfh/vT6LqMNlfLfTKMR8zmXKHXC+KJjQG3Ohl++7BTGxIrxZtAr6 MKeNczQng0xJtGI/gSus+8Rt9GycMJ/TZh+CrMsRiWmleONsl2fYO5pd4P+hDcttVOmdI/dj H3yycUt5nzgezid+O2NzsjJNNAgDy9uxOLa01aBpaSR94IsYPCxaHh9rBo27v5L8lm2DZTmy CdTdJ/g7OETOSKGmrGywwmsBAO9f4sVideYrDJbEUcXkFSH19ctJYCgLHscWzpypGsQNC/9X iq7fMCS5kAkK/ZcsPeaI4VIDkFJAF22oJyCvJwLWpaQKXBLAFYcAltEHfjdgrrYlexlgQ7SX yX136hD8HJTe1oc2qHN/CXa+LDvxhhNLIgagKP13IIt8AS7U+3YsrCSgu1fjDpxoEP2+xXTS jjcDmnJIWv1oDjIp57OfpKokvHtEsMgXrZI4Ft3ftpzN6o/YWVQeJ7VBdVeKPkzukMfHu04q 1O6TcfSVGLSjrSdTD8/0LcRmwEwgxRBbhp3kxmnUqV+/C/Cj1G2LurKBdqC/rGTSgR1TeQji rTDvV4aReZ8swQS8dGoO4CoxG3ZVz0nsLs7Nl/wRoIMXVo/yMd03LIySSJuATWD6+0LOL5PT gsIRYpBw3jcLTAwPsQd8M8CH9b07qGJ4roVkhEj3R09WeDmSSCLcyQERTzA3EskuaDF8qrRj q68/6kZwhsmssBzAH1PWnFpBAqEaoyQZUisoCffbQwM31oYt04Ng7JXqKHVE+ZchcujtijK5 bPz9ARgL/11E5yq9Z9x+OIxVx1lhMadwH/ze2CrTUIMTo9ZAp8tBqDvXOr43FHPTYio0wycl /anW2D6+4Q49/gK8GQS4xWo/jZnCjOaVIPRbH+y/HE4eXBwKA9UKHpYdZuL2z1zFLYvZd/LT rX66q/+8YMETsu86e4J76lE0WhljWdseM4RFmKlPepSttgCS6iRcWZeuhpknqpOILBwNUtFA Dnqbe9y5ZQ8xETy4/nDMIeWmiHIhQ5bzm+dzOVwtqOpDpTvMzZbU3buBCsZFVrzxuXa66sJu W3fhc//cJ6GTlKz404tAuJrVr9q+uB4OOlkjoUYOIYnwwmKhZaqaUQDTpvK67QhWCZiDHJ/J bvuMCv/XCVh/1IdTbe518jVzfcYjlyxcSHFq8TxiGhJYaBFF4vPC9+vf7l2fQVhDzzpBqMVH 5k9nGJXJ9M0mDO9e8O4CkV55YXzVQFVipiaGyd9DBKcWHAyprxj20MBkP0npXfGErkADCUEp 1MpKt0p3U3BJkoi2Ms0uQWRvbmF5IEZlbGlwZSBOb2d1ZWlyYSA8YWRmZW5vQGh5cGVyYm9s YS5pbmZvPsJ6BBMRCAAiBQJZkFYUAhsDBgsJCAcDAgYVCAIJCgsEFgIDAQIeAQIXgAAKCRDI 1uFSAe6docKxAQCAKQxT1MlVJyXdFC7sGFH00jlHeybp6qgOVfJvpqLPGgD+ITwpdjy3RD2c kuENzAKzvom8pnDrNW+oIIIYUaE5gMTOw00EVJ2j0hAQAPcu3bLnt0CqcF49mN0m7z13Fiqv wLRxJe2sEeduZl146rqyNdv4XmaCSdsbgThfw7sW60/J4Gyianv2uzm9E4DpnSh/Ie4LGqXC UALnIYhxeILOo8CvFW1hkF/AgZp0CNoXrP786Nh0rksHfwps0B7b6Vy/E0blioaijvUS2z3/ DKY6CXb7D8wRi64qTMarLaifRzIR/pbX29uBB2McOeoswSFob/McMA7AHp3p+lttR5J8eLc3 Ckj7OuJCY74XIAGq2B64RPmn617BD9ym83M3fcbEXgDBQtvLjznfKNzeMXOLXN/7/qKm1Sza 5NpeAGDg0YvXg6qIi0iyJw4RVzdCiqacO+G3Am/Ge2XDKsuBgsEf1YjlENINGS/ZmqfZd0sH jCJHb/YOlEzVw8HVMzeES8aUOBDh+d2aWhYx30jXuFbMqvuOh4t7JZjBy8TQVuvVhIps0Qyu /YnNxKzZ2F9keaN854KRtcGxaD/wOGpgoAOlyhH+pXVTTl3GCMCHonJ6Sn+jNGa6+oX7HF8h wSevwzQ11WThTPmUTlPU96jN5kqE6qLKBo2msu2MxVQRo1kLlHCRfjvbNGf2iZXRKI+RARgv a+7NZPtYDs1Sg/zw7HgUowImT6JGcN0ZgAMqw/V2nALvW+Caq03GCNiWR2elB/jmhHR+3Brj 18fsc25HAAMFEADViuPfdUqFHzmKgVdRH5A8NIZNTT/MMrYCqv5PAkEhnsXLXeHHV7a0cbfx 3yf86Pv8XMtBItShUVQ9UPVvmFW3ew5cqCCUF5MzrbOXrrso+78yflYjbh55Sf1HelG11eBT xs2auCgMWVsxRjgk9sbzh0j+R9MCMXHw0H/x63BS+due6Z0PYlsgXxbtWxB0P7kiYekXn6xo MeJco9CbWufnWdK4J5WylILQPNwI8uwrj56TUmh3PFnC2UmUa+KQ9m5gWHOIybWYZf4TTXBi N6gvhUqN9IpGFaNG26sWWiOpEWAiVTwPE/lSB+yibouSfE3XLw1Q+FH7TqwmtVS6Kj+yC4Z7 GlDcmqlQxJhBdXTEpTk0rA1Bs4okjqVoQRpLPYUFkhVA15jJGrewUJuUhL128gL2Ek0A14FW +zmi0Wi3tIrUQXovGy7eorIgq7M3/ri0ibbrS5jE4yfIZG/8nb1S/RX5JEwEaoe7izi+1GIi GkCRkzGT3VqG78ppH2166Bq9qDwGf3T/CmLMDNpxsc1qt857nz7RFBMM+dNs5h/Bh0t++i01 JJd/ykqdfUL8nHRwDO1Fkz/R5wugeJ/dB0TcqpnArjtTc+KVN/lRYfltEc5j0DqvFRwk3Ztd 5KocWrWD/MBAvZVYKzJ9Bov9FGRUIGDDTJyo5VVCSe1IeSYa9sJhBBgRCgAJBQJUnaPSAhsM AAoJEMjW4VIB7p2h7ewBAMBCaE8lh2MyK8PBZ2rOSEYIQNjxADPt9Mri7CLnZxtPAQCwCO+a x4WXJV0T1ZOOFa/esCB72RkEVZ7ArkTKQDnVng== Message-ID: Date: Sat, 16 Feb 2019 17:47:57 -0200 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:52.0) Gecko/20100101 Icedove/52.9.1 MIME-Version: 1.0 In-Reply-To: Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="WkCUhBDs1jw4CTmihBRaGZd5GdZGo4fGh" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --WkCUhBDs1jw4CTmihBRaGZd5GdZGo4fGh Content-Type: multipart/mixed; boundary="ZGoqyXMekURahp4Ltq5jAWl9AN8xH5OIQ"; protected-headers="v1" From: Adonay Felipe Nogueira To: Workgroup for fully free GNU/Linux distributions , 28004@debbugs.gnu.org Cc: guix-devel@gnu.org Message-ID: Subject: Re: [GNU-linux-libre] [PATCH] gnu: Add ungoogled-chromium. References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> <87sgx3mbcq.fsf@gnu.org> <87tvhf5f8d.fsf@dustycloud.org> <20190216030021.374f4c82@parabola> <87va1kav33.fsf@posteo.net> In-Reply-To: --ZGoqyXMekURahp4Ltq5jAWl9AN8xH5OIQ Content-Type: text/plain; charset=utf-8 Content-Language: en-US Content-Transfer-Encoding: quoted-printable Em 16/02/2019 12:18, Julie Marchant escreveu: > libre? The only argument I've seen on the matter is the way copyright > works, but Chromium is under the Modified BSD License according to > documentation I was able to find. If some files are not actually covere= d For what is worth, what I learned with projects that don't follow the Open Source Definition (I know that I shouldn't support this term here, but I had to mention it) is that they mask their non-compliance behind a license. Of course we don't intend to foster open source here, as this project, having the goal to provide a package manager that is under the GNU project, also aims to create a system distribution that follows the GNU FSDG and uses such package manager If the norm would be to only check the licenses, then we would have for example, taken ages to figure out that the kernel source files from upstream of GNU Linux-libre was/is non-free. Having a requirement for a package to be first throughly reviewed eliminates some of the possibility of having non-free functional data or non-distributable non-functional data. It's not a perfect protection (since the package in review might have implemented things from other works that one of the reviewers might not be aware of). As I said in a message to these mailing lists, I already started reviewing Chromium, although this project is big and I might not have the time nor all the skills to do it alone. Since today, I moved the review, which was available at [1], to the appropriate Review namespace at [2]. [1] https://directory.fsf.org/wiki/Talk:Chromium [2] https://directory.fsf.org/wiki/Review:Chromium-REV-ID-1 --ZGoqyXMekURahp4Ltq5jAWl9AN8xH5OIQ-- --WkCUhBDs1jw4CTmihBRaGZd5GdZGo4fGh Content-Type: application/pgp-signature; name="signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="signature.asc" -----BEGIN PGP SIGNATURE----- Version: GnuPG v2 iF4EAREIAAYFAlxoaPcACgkQyNbhUgHunaGC6wEA52vPsGWb/AGW8hNkA6N3t4qw VTBk9J25w3dIITvfsgoA/AxBDiog0W4SxG6L3eU07S2rg9VRD61bCoM+M+L6Hjjq =WjWt -----END PGP SIGNATURE----- --WkCUhBDs1jw4CTmihBRaGZd5GdZGo4fGh-- From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 16 15:01:22 2019 Received: (at 28004) by debbugs.gnu.org; 16 Feb 2019 20:01:22 +0000 Received: from localhost ([127.0.0.1]:50554 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gv69J-0003dk-Mf for submit@debbugs.gnu.org; Sat, 16 Feb 2019 15:01:22 -0500 Received: from mout02.posteo.de ([185.67.36.66]:37371) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gv69G-0003WJ-Uo for 28004@debbugs.gnu.org; Sat, 16 Feb 2019 15:01:20 -0500 Received: from submission (posteo.de [89.146.220.130]) by mout02.posteo.de (Postfix) with ESMTPS id 4AB782400E6 for <28004@debbugs.gnu.org>; Sat, 16 Feb 2019 21:01:12 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=posteo.net; s=2017; t=1550347272; bh=1I02B0P466w0CL6UPHq7ttyGnCHy0RcWKJGcMqavxIg=; h=From:To:Cc:Subject:Date:From; b=FV5V+smpno9owi8hCCv+WMpGatnBKylxxjNeZN4nTrSETFPFtHftokC+z+r+ye8aI k6reL3mjBPSr3s45G52MOxxwwHA9eabEMeO7NJ5R+7rD63AqiDo3b5Q/0CMpTS2TzY dDdRwfIZ0KCo2ULYiG7/rC3kiWtkCnJ46cp0mQxBazxVag+Yj6ETf3sussfCK7iCfd oPWqkg+7q0huweAUoSc25YnHHu0o+zHQoQsBf1/a7XuD3V++u13iwRhx5zyBo8iONf jIGVHz5q/unFHXs/VsEHJ1dsUnjz1LmkYmG4fe8B4BhNGoC9UNZTlsCmaZ86rdsSPs JEZ9JLqVJLGiA== Received: from customer (localhost [127.0.0.1]) by submission (posteo.de) with ESMTPSA id 4421GY3stdz9rxM; Sat, 16 Feb 2019 21:01:09 +0100 (CET) References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> <87sgx3mbcq.fsf@gnu.org> <87tvhf5f8d.fsf@dustycloud.org> <20190216030021.374f4c82@parabola> <87va1kav33.fsf@posteo.net> User-agent: mu4e 1.0; emacs 26.1 From: Brett Gilio To: Workgroup for fully free GNU/Linux distributions Subject: Re: [GNU-linux-libre] [PATCH] gnu: Add ungoogled-chromium. In-reply-to: Date: Sat, 16 Feb 2019 14:01:07 -0600 Message-ID: <87lg2f5wqk.fsf@posteo.net> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Adonay Felipe Nogueira writes: > Em 16/02/2019 12:18, Julie Marchant escreveu: >> libre? The only argument I've seen on the matter is the way copyright >> works, but Chromium is under the Modified BSD License according to >> documentation I was able to find. If some files are not actually covered > > For what is worth, what I learned with projects that don't follow the > Open Source Definition (I know that I shouldn't support this term here, > but I had to mention it) is that they mask their non-compliance behind a > license. Of course we don't intend to foster open source here, as this > project, having the goal to provide a package manager that is under the > GNU project, also aims to create a system distribution that follows the > GNU FSDG and uses such package manager > > If the norm would be to only check the licenses, then we would have for > example, taken ages to figure out that the kernel source files from > upstream of GNU Linux-libre was/is non-free. > > Having a requirement for a package to be first throughly reviewed > eliminates some of the possibility of having non-free functional data or > non-distributable non-functional data. It's not a perfect protection > (since the package in review might have implemented things from other > works that one of the reviewers might not be aware of). > > As I said in a message to these mailing lists, I already started > reviewing Chromium, although this project is big and I might not have > the time nor all the skills to do it alone. Since today, I moved the > review, which was available at [1], to the appropriate Review namespace > at [2]. > > > [1] https://directory.fsf.org/wiki/Talk:Chromium > [2] https://directory.fsf.org/wiki/Review:Chromium-REV-ID-1 Adonay, thank you for taking the initiative here! I think this is a needed step forward. Brett Gilio From debbugs-submit-bounces@debbugs.gnu.org Sat Feb 16 15:06:55 2019 Received: (at 28004) by debbugs.gnu.org; 16 Feb 2019 20:06:55 +0000 Received: from localhost ([127.0.0.1]:50558 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gv6Eh-0004dI-JR for submit@debbugs.gnu.org; Sat, 16 Feb 2019 15:06:55 -0500 Received: from mout02.posteo.de ([185.67.36.66]:36455) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gv6Ee-0004d3-8v for 28004@debbugs.gnu.org; Sat, 16 Feb 2019 15:06:53 -0500 Received: from submission (posteo.de [89.146.220.130]) by mout02.posteo.de (Postfix) with ESMTPS id 6C81F2400E5 for <28004@debbugs.gnu.org>; Sat, 16 Feb 2019 21:06:46 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=posteo.net; s=2017; t=1550347606; bh=+c/nVeO/NVHTkjdqpVl/WlIb0z4MCHLjHvwCyc+fWPY=; h=From:To:Cc:Subject:Date:From; b=M15C+5fRi2zzAcXtvrGC+ItRdEn7+rtJM8UaeAhp933RrAzmpvjbqeNCSKBola3au HNbHfL+tBYw0NFi6lRhWOJMBiqb6nOkJXvfjGt0UVz0K6uWH+wZgrXJbcKqNIkUBkz 2ezGaMLq+IcNGQ7xHrxI1X/lDV4TuTab0+61zHC2D4Mxt6LXOPT3P96GBVEIFhjRJX o0jtzOvS9R5ukQNMd5wSVVPpzVHOwI7Zc9Fax8Kg18qB+yAbI1I1EQmW9xVPPKsbl4 MC4AJu7TSPXEANr4bu5ifcWDE/GctEuhfumBKveIOm5rt2K32CpE5tEvo7J84OqzQX 3IZ6PH7bToFtg== Received: from customer (localhost [127.0.0.1]) by submission (posteo.de) with ESMTPSA id 4421P10Rxzz9rxK; Sat, 16 Feb 2019 21:06:44 +0100 (CET) References: <20190202192023.22087-1-mbakke@fastmail.com> <87k1igpwk8.fsf@dismail.de> <20190203235204.63970587@parabola> <87sgx3mbcq.fsf@gnu.org> <87tvhf5f8d.fsf@dustycloud.org> <20190216030021.374f4c82@parabola> <87va1kav33.fsf@posteo.net> <87lg2f5wqk.fsf@posteo.net> User-agent: mu4e 1.0; emacs 26.1 From: Brett Gilio To: Workgroup for fully free GNU/Linux distributions Subject: Re: [GNU-linux-libre] [PATCH] gnu: Add ungoogled-chromium. In-reply-to: <87lg2f5wqk.fsf@posteo.net> Date: Sat, 16 Feb 2019 14:06:43 -0600 Message-ID: <87k1hz5wh8.fsf@posteo.net> MIME-Version: 1.0 Content-Type: text/plain X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 28004 Cc: guix-devel@gnu.org, 28004@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -3.3 (---) Brett Gilio writes: > Adonay Felipe Nogueira writes: > >> Em 16/02/2019 12:18, Julie Marchant escreveu: >>> libre? The only argument I've seen on the matter is the way copyright >>> works, but Chromium is under the Modified BSD License according to >>> documentation I was able to find. If some files are not actually covered >> >> For what is worth, what I learned with projects that don't follow the >> Open Source Definition (I know that I shouldn't support this term here, >> but I had to mention it) is that they mask their non-compliance behind a >> license. Of course we don't intend to foster open source here, as this >> project, having the goal to provide a package manager that is under the >> GNU project, also aims to create a system distribution that follows the >> GNU FSDG and uses such package manager >> >> If the norm would be to only check the licenses, then we would have for >> example, taken ages to figure out that the kernel source files from >> upstream of GNU Linux-libre was/is non-free. >> >> Having a requirement for a package to be first throughly reviewed >> eliminates some of the possibility of having non-free functional data or >> non-distributable non-functional data. It's not a perfect protection >> (since the package in review might have implemented things from other >> works that one of the reviewers might not be aware of). >> >> As I said in a message to these mailing lists, I already started >> reviewing Chromium, although this project is big and I might not have >> the time nor all the skills to do it alone. Since today, I moved the >> review, which was available at [1], to the appropriate Review namespace >> at [2]. >> >> >> [1] https://directory.fsf.org/wiki/Talk:Chromium >> [2] https://directory.fsf.org/wiki/Review:Chromium-REV-ID-1 > > Adonay, thank you for taking the initiative here! I think this is a > needed step forward. > > Brett Gilio Also, maybe it would be of some help to involve somebody from the FSF to be a neutral mediator on this process until we come to some reasonable conclusion? Marius, I think you can probably go ahead and push that patch, knowing full well that Bill warned a bug report will be filed against the Guix source tree until such time that an audit concludes or Adonay's suggestion is followed through with. Bill, What do you think here? Brett Gilio From debbugs-submit-bounces@debbugs.gnu.org Mon Feb 18 17:43:49 2019 Received: (at 28004-done) by debbugs.gnu.org; 18 Feb 2019 22:43:49 +0000 Received: from localhost ([127.0.0.1]:53381 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gvrdc-0002lZ-Nf for submit@debbugs.gnu.org; Mon, 18 Feb 2019 17:43:48 -0500 Received: from out2-smtp.messagingengine.com ([66.111.4.26]:32809) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1gvrdZ-0002lE-Te for 28004-done@debbugs.gnu.org; Mon, 18 Feb 2019 17:43:47 -0500 Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailout.nyi.internal (Postfix) with ESMTP id B0C3B21FE1; Mon, 18 Feb 2019 17:43:40 -0500 (EST) Received: from mailfrontend2 ([10.202.2.163]) by compute5.internal (MEProxy); Mon, 18 Feb 2019 17:43:40 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=3o4VHRivBSzyZ2Gv/6L1lxxVYt lbc5GU9LgbOgek0N4=; b=RnwIMmcixbZlC3yFlj4DevEZQOyEjql11w+83LpGta EWRXoSdBl3CFL+xGx7E9GbXNrrKiCZ2UljhomYBytNW3Al8/CN8cECo15i9kC0W5 uczn37ZdE5IF/TguQYTHmsu8fhSYqMPeiYFE6adt94U7LSsRAvJtbx293AGgdhJh T6VkiA95ysTnymizx0IvaK4YJxeHR7p718B8D1VMoysKOOldckZwlZ0EspV3ErhT nL2uES4hejn7/tp1n7kb4jsCpQnGtoZqKNCv4e5WtzGBfpjKjDgCVj8yKcmd6oRk YAVTQ040Q7/x3qwlvG2Avus7vHHcvGq/RPE04mTbQPbQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=3o4VHR ivBSzyZ2Gv/6L1lxxVYtlbc5GU9LgbOgek0N4=; b=HWI4ix4GK3WX9sOees9F/F LpEQ4XUnnlHFP+eJI1tAMraiwbFCM099sz3eUNYlY0WhN1FH/MOCqceGwWnbUYJr NGs+Gusr2mUcbsMtcm7ta+aHOf0ihof/cXluKbLsYb2Icxiw/2Fwl5Z+A/auM4Nm e+IEQiFTRjLm3YooklirFZXoU567vhsn4ERz7zSL+vKDYcb/ZVfDSztp7bAtp8pe w4EEcFFh/mbM9GQs6r5B6OnNZY36Q6HWTpPoeIqO4lU5EvZEvJyGY0Wgz9ucaHz3 hYbSy9Dme54ulwsayLIHROruCoXXABtWFwLlqolVG+K3X3TDEBBMz29DrSUGrTpQ == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedutddrtddugddufeefucdltddurdegtdelrddttd dmucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfquhht necuuegrihhlohhuthemuceftddtnecunecujfgurhephffvufgjfhgffffkgggtsehgtd erredtredtnecuhfhrohhmpeforghrihhushcuuegrkhhkvgcuoehmsggrkhhkvgesfhgr shhtmhgrihhlrdgtohhmqeenucffohhmrghinhepghhnuhdrohhrghenucfkphepiedvrd duiedrvddviedrudegtdenucfrrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgvsehf rghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from localhost (140.226.16.62.customer.cdi.no [62.16.226.140]) by mail.messagingengine.com (Postfix) with ESMTPA id 0ECBF100E5; Mon, 18 Feb 2019 17:43:39 -0500 (EST) From: Marius Bakke To: guix-devel@gnu.org Subject: Re: [bug#28004] [PATCH v2] gnu: Add ungoogled-chromium. In-Reply-To: <20190212155815.23817-1-mbakke@fastmail.com> References: <20190202192023.22087-1-mbakke@fastmail.com> <20190212155815.23817-1-mbakke@fastmail.com> User-Agent: Notmuch/0.28.2 (https://notmuchmail.org) Emacs/26.1 (x86_64-pc-linux-gnu) Date: Mon, 18 Feb 2019 23:43:38 +0100 Message-ID: <87k1hwogyt.fsf@fastmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-Debbugs-Envelope-To: 28004-done Cc: 28004-done@debbugs.gnu.org X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: debbugs-submit-bounces@debbugs.gnu.org Sender: "Debbugs-submit" X-Spam-Score: -1.7 (-) --=-=-= Content-Type: text/plain Marius Bakke writes: > Changes in this version: > > * New upstream release. > * No longer using a fork of Ungoogled-Chromium. > * The special HarfBuzz and libvpx variants have been removed due to > obsolesence. I've pushed this patch now, with minor cosmetic improvements: Thanks to everyone who participated! --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAlxrNRoACgkQoqBt8qM6 VPrmXAgAhZ6uZQJu8PPzCqj/vDYtT3aJla3ueKdhoEI0XNXq7AeYFQbifsCCgBbm k32BnER4pepJpzgo0FHs0fR7teeQFQtfd2oCV4rDM77jy1x8jaG8wInqbib3VYhi BbkP7wvL1PFwV7+ZMQKNPh0GdiwW+aQ88rJ30SNRA+gq+2MzxFXxm13vRk4pwxuv Pq0psEVmv8KqEz02bwia3xMFzv9QJWg6Wjy3z2afAb1l0HbvZi+2rj6fPo4vU4NB DbZeroMWyn7s6idL6qq+oVs7zRgA3M5PVM3niLtzPFNuHt4X2ZSNeJDMlrNcx2Y+ njyDSnVtMj5FnNnwWQk3phcLSGw3PA== =mStS -----END PGP SIGNATURE----- --=-=-=-- From unknown Mon Aug 18 09:04:59 2025 Received: (at fakecontrol) by fakecontrolmessage; To: internal_control@debbugs.gnu.org From: Debbugs Internal Request Subject: Internal Control Message-Id: bug archived. Date: Tue, 19 Mar 2019 11:24:04 +0000 User-Agent: Fakemail v42.6.9 # This is a fake control message. # # The action: # bug archived. thanks # This fakemail brought to you by your local debbugs # administrator